BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN010C11

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001190681.1|  ubiquitin 11                                       299   9e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AHI85710.1|  stress-induced protein 5                                300   1e-100   Capsicum annuum
emb|CAI51312.2|  polyubiquitin                                          298   3e-100   Capsicum chinense [bonnet pepper]
tpg|DAA44273.1|  TPA: Ubiquitin fusion protein                          300   4e-100   
ref|XP_004497490.1|  PREDICTED: polyubiquitin 4-like                    297   6e-100   Cicer arietinum [garbanzo]
gb|KJB69254.1|  hypothetical protein B456_011G016600                    298   6e-100   Gossypium raimondii
ref|XP_004976899.1|  PREDICTED: polyubiquitin 3-like                    297   6e-100   Setaria italica
gb|ABF06579.2|  polyubiquitin                                           298   7e-100   Gladiolus grandiflorus
ref|XP_004501591.1|  PREDICTED: polyubiquitin 4-like                    297   7e-100   Cicer arietinum [garbanzo]
gb|ABH08753.1|  ubiquitin                                               300   7e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    297   7e-100   Citrus sinensis [apfelsine]
ref|XP_010931828.1|  PREDICTED: polyubiquitin                           297   7e-100   
ref|XP_008246113.1|  PREDICTED: polyubiquitin                           297   8e-100   Prunus mume [ume]
ref|XP_009758989.1|  PREDICTED: polyubiquitin                           297   8e-100   Nicotiana sylvestris
gb|ACA58351.1|  ubiquitin-like protein                                  298   8e-100   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AAM78180.1|  putative polyubiquitin                                  299   9e-100   Gossypium herbaceum [Arabian cotton]
gb|ACJ85643.1|  unknown                                                 300   9e-100   Medicago truncatula
gb|ACZ69386.1|  polyubiquitin UBQ14                                     298   9e-100   Cucumis sativus [cucumbers]
gb|ABH08755.1|  ubiquitin                                               299   1e-99    Arabidopsis thaliana [mouse-ear cress]
gb|AAZ32851.1|  pentameric polyubiquitin                                298   1e-99    Medicago sativa [alfalfa]
gb|AFP44113.1|  ubiquitin                                               298   1e-99    Lycoris longituba
ref|NP_567286.1|  ubiquitin 11                                          299   1e-99    Arabidopsis thaliana [mouse-ear cress]
gb|AFJ04519.1|  ubiquitin                                               297   1e-99    Vernicia fordii [tung oil tree]
ref|XP_007693173.1|  hypothetical protein COCMIDRAFT_109160             297   1e-99    Bipolaris oryzae ATCC 44560
gb|AAM64530.1|  ubiquitin homolog                                       299   1e-99    Arabidopsis thaliana [mouse-ear cress]
sp|P0CG83.1|UBIQP_HORVU  RecName: Full=Polyubiquitin; Contains: R...    297   1e-99    Hordeum vulgare [barley]
gb|AFK46460.1|  unknown                                                 296   1e-99    Medicago truncatula
ref|XP_009420214.1|  PREDICTED: polyubiquitin                           296   1e-99    
gb|ABI84246.1|  polyubiquitin 10                                        298   1e-99    Arachis hypogaea [goober]
ref|XP_003619702.1|  Ubiquitin-like protein                             300   1e-99    
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            298   1e-99    Phaseolus vulgaris [French bean]
emb|CAD27944.1|  polyubiquitin-like                                     298   2e-99    Oryza sativa [red rice]
gb|AFC36452.1|  ubiquitin                                               298   2e-99    Anoectochilus roxburghii
gb|ACT82769.1|  polyubiquitin                                           297   2e-99    Nicotiana tabacum [American tobacco]
gb|AAZ82816.1|  ubiquitin monomer protein                               296   2e-99    Morus mongolica [Mongolian mulberry]
gb|ABR25718.1|  polyubiquitin containing 7 ubiquitin monomers           296   2e-99    Oryza sativa Indica Group [Indian rice]
pir||PS0380  ubiquitin precursor - rice (fragment)                      297   2e-99 
gb|AAL25813.1|  polyubiquitin                                           296   3e-99    Prunus avium [gean]
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    298   3e-99    
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             299   3e-99    Brachypodium distachyon [annual false brome]
gb|ACJ85618.1|  unknown                                                 298   3e-99    Medicago truncatula
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    298   3e-99    Eucalyptus grandis [rose gum]
ref|XP_003626479.1|  Ubiquitin-like protein                             300   3e-99    
gb|AFW66442.1|  putative ubiquitin family protein                       298   3e-99    
ref|XP_008809849.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    295   4e-99    Phoenix dactylifera
dbj|GAC94856.1|  ubiquitin                                              298   4e-99    Pseudozyma hubeiensis SY62
dbj|GAC77607.1|  ubiquitin and ubiquitin-like proteins                  298   4e-99    Moesziomyces antarcticus T-34
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   298   4e-99    
gb|AEW46688.1|  polyubiquitin                                           298   4e-99    Ulva linza
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             298   4e-99    
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    299   4e-99    
gb|EEC81189.1|  hypothetical protein OsI_24195                          298   5e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_001731772.1|  hypothetical protein MGL_1040                      295   5e-99    Malassezia globosa CBS 7966
emb|CCK72367.1|  hypothetical protein KNAG_0J02880                      295   5e-99    Kazachstania naganishii CBS 8797
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   298   5e-99    Camelina sativa [gold-of-pleasure]
gb|AAM63271.1|  unknown                                                 295   5e-99    Arabidopsis thaliana [mouse-ear cress]
gb|AAB36546.1|  polyubiquitin                                           297   5e-99    Phaseolus vulgaris [French bean]
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             301   5e-99    
gb|AGV54749.1|  ubiquitin 11                                            299   6e-99    Phaseolus vulgaris [French bean]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             298   6e-99    Elaeis guineensis
gb|AET06143.1|  ubiquitin                                               298   6e-99    Papaver somniferum
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                298   6e-99    Erythranthe guttata [common monkey flower]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    298   6e-99    Gossypium raimondii
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      298   6e-99    Setaria italica
ref|XP_002957068.1|  polyubiquitin                                      295   6e-99    Volvox carteri f. nagariensis
gb|AIZ74335.1|  polyubiquitin 3                                         298   6e-99    Pinus massoniana [Chinese red pine]
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          298   6e-99    Sorghum bicolor [broomcorn]
gb|ABD96088.1|  polyubiquitin                                           299   7e-99    Malus domestica [apple tree]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             297   7e-99    
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             299   7e-99    Brachypodium distachyon [annual false brome]
dbj|BAC57955.1|  polyubiquitin                                          297   7e-99    Tripolium pannonicum [sea starwort]
ref|XP_002317213.1|  polyubiquitin family protein                       297   7e-99    Populus trichocarpa [western balsam poplar]
ref|XP_002389222.1|  hypothetical protein MPER_11681                    295   7e-99    
gb|KDP23292.1|  hypothetical protein JCGZ_23125                         295   7e-99    Jatropha curcas
ref|XP_011390959.1|  putative polyubiquitin                             297   7e-99    Ustilago maydis 521
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             297   8e-99    Citrus clementina [clementine]
gb|AAF31707.1|AF221858_1  polyubiquitin                                 297   8e-99    Euphorbia esula [wolf's milk]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   297   8e-99    Citrus sinensis [apfelsine]
ref|XP_002447145.1|  hypothetical protein SORBIDRAFT_06g029360          295   8e-99    Sorghum bicolor [broomcorn]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      300   8e-99    Brassica rapa
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             297   9e-99    
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           300   9e-99    Nicotiana tomentosiformis
gb|AAP31578.1|  ubiquitin                                               297   9e-99    Hevea brasiliensis [jebe]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   297   9e-99    Citrus sinensis [apfelsine]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    297   9e-99    Gossypium raimondii
gb|ABH08754.1|  ubiquitin                                               297   9e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             297   1e-98    Citrus clementina [clementine]
emb|CAA48140.1|  ubiquitin                                              300   1e-98    Antirrhinum majus [garden snapdragon]
emb|CAH59739.1|  polyubiquitin                                          297   1e-98    Plantago major [cart-track plant]
gb|EPS72031.1|  polyubiquitin                                           298   1e-98    Genlisea aurea
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             298   1e-98    
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           296   1e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    297   1e-98    
gb|ABK94002.1|  unknown                                                 300   1e-98    Populus trichocarpa [western balsam poplar]
gb|AAR32784.1|  polyubiquitin                                           296   1e-98    Clusia minor [cupey de monte]
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      300   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_001701379.1|  bi-ubiquitin, major isoform                        294   1e-98    Chlamydomonas reinhardtii
gb|KJB81823.1|  hypothetical protein B456_013G163500                    300   1e-98    Gossypium raimondii
gb|AAO43307.1|  putative polyubiquitin                                  297   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      300   1e-98    Camelina sativa [gold-of-pleasure]
ref|NP_849292.1|  polyubiquitin 14                                      300   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      299   1e-98    Camelina sativa [gold-of-pleasure]
gb|AFK41706.1|  unknown                                                 297   1e-98    Medicago truncatula
emb|CBY46745.1|  polyubiquitin 10 protein                               300   1e-98    Lepidium appelianum [hairy whitetop]
gb|AEZ49160.1|  polyubiquitin                                           298   2e-98    Wolffia australiana
gb|AAK68824.1|  Unknown protein                                         296   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AGZ15412.1|  fiber polyubiquitin                                     296   2e-98    Phaseolus vulgaris [French bean]
gb|AFY06654.1|  polyubiquitin                                           298   2e-98    Carica papaya [mamon]
gb|AFK43392.1|  unknown                                                 296   2e-98    Medicago truncatula
gb|AAC35858.1|  polyubiquitin                                           298   2e-98    Capsicum chinense [bonnet pepper]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            298   2e-98    Phaseolus vulgaris [French bean]
gb|ACB87918.1|  polyubiquitin 3                                         295   2e-98    Malus domestica [apple tree]
ref|XP_003627152.1|  Ubiquitin                                          298   2e-98    
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             298   3e-98    
ref|XP_003590494.1|  Ubiquitin                                          299   3e-98    
gb|ABY60454.1|  putative polyubiquitin                                  298   3e-98    Adonis aestivalis var. palaestina
gb|AES89865.2|  polyubiquitin 3                                         297   3e-98    Medicago truncatula
gb|AES89866.2|  polyubiquitin 3                                         298   3e-98    Medicago truncatula
emb|CBI22349.3|  unnamed protein product                                298   4e-98    Vitis vinifera
gb|AAQ84316.1|  fiber polyubiquitin                                     295   5e-98    Gossypium barbadense [Egyptian cotton]
ref|XP_003687789.1|  hypothetical protein TPHA_0K02250                  292   5e-98    Tetrapisispora phaffii CBS 4417
emb|CCF48657.1|  probable polyubiquitin                                 295   5e-98    Ustilago hordei
emb|CAC94926.1|  putative ubiquitin                                     296   5e-98    Pleurotus sp. 'Florida' [Florida oyster mushroom]
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  295   5e-98    Hypholoma sublateritium FD-334 SS-4
ref|XP_003648495.1|  hypothetical protein Ecym_8408                     292   5e-98    Eremothecium cymbalariae DBVPG#7215
gb|KIY97324.1|  ubiquitin C                                             293   5e-98    Monoraphidium neglectum
ref|XP_007873662.1|  hypothetical protein PNEG_01699                    292   6e-98    Pneumocystis murina B123
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  295   6e-98    Piloderma croceum F 1598
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    295   6e-98    Candida albicans
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 295   6e-98    Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          295   6e-98    Yamadazyma tenuis ATCC 10573
gb|AIS71924.1|  polyubiquitin                                           295   6e-98    Mangifera indica
gb|EHN01342.1|  Ubi4p                                                   292   6e-98    Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   295   6e-98    Piloderma croceum F 1598
emb|CAL30085.1|  polyubiquitin                                          292   6e-98    Globodera pallida
ref|XP_011110054.1|  hypothetical protein H072_4094                     295   6e-98    
gb|EWZ87538.1|  ubiquitin C                                             292   7e-98    Fusarium oxysporum f. sp. lycopersici MN25
ref|XP_719867.1|  hypothetical protein CaO19.6771                       295   7e-98    Candida albicans SC5314
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      298   7e-98    
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   295   7e-98    Brassica rapa
gb|KIR83632.1|  polyubiquitin                                           295   7e-98    Cryptococcus gattii VGIV IND107
emb|CAH59740.1|  polyubiquitin                                          298   7e-98    Plantago major [cart-track plant]
gb|EMS24129.1|  ubiquitin C                                             295   7e-98    Rhodotorula toruloides NP11
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             298   7e-98    Capsella rubella
prf||1604470A  poly-ubiquitin                                           296   8e-98 
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             298   8e-98    
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          298   8e-98    Sorghum bicolor [broomcorn]
ref|XP_007014924.1|  Polyubiquitin 3                                    298   8e-98    Theobroma cacao [chocolate]
dbj|BAJ85978.1|  predicted protein                                      297   8e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACB87916.1|  polyubiquitin 1                                         294   8e-98    Malus domestica [apple tree]
emb|CDP08569.1|  unnamed protein product                                297   8e-98    Coffea canephora [robusta coffee]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      297   8e-98    Oryza brachyantha
gb|AFW66439.1|  putative ubiquitin family protein                       297   8e-98    
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             297   8e-98    
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                297   9e-98    Erythranthe guttata [common monkey flower]
ref|NP_851029.1|  polyubiquitin 3                                       297   9e-98    Arabidopsis thaliana [mouse-ear cress]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    297   9e-98    Linum usitatissimum
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            297   9e-98    Phaseolus vulgaris [French bean]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             297   9e-98    
ref|XP_007512209.1|  polyubiquitin                                      299   9e-98    Bathycoccus prasinos
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     295   9e-98    Rhodotorula toruloides
ref|XP_007339454.1|  ubiquitin                                          297   9e-98    
gb|AAO42469.1|  putative polyubiquitin                                  297   9e-98    Arabidopsis lyrata [lyrate rockcress]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             297   9e-98    Citrus clementina [clementine]
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           297   9e-98    Brassica rapa
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  295   1e-97    Paxillus rubicundulus Ve08.2h10
ref|XP_002955196.1|  polyubiquitin                                      295   1e-97    Volvox carteri f. nagariensis
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             297   1e-97    
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      297   1e-97    Glycine max [soybeans]
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         298   1e-97    Jatropha curcas
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                300   1e-97    
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           297   1e-97    Fragaria vesca subsp. vesca
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             297   1e-97    Citrus clementina [clementine]
gb|KJB62487.1|  hypothetical protein B456_009G418900                    297   1e-97    Gossypium raimondii
gb|ACD31680.1|  ubiquitin                                               297   1e-97    Gossypium hirsutum [American cotton]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           297   1e-97    Nelumbo nucifera [Indian lotus]
ref|XP_003082269.1|  polyubiquitin (ISS)                                296   1e-97    
emb|CAA40323.1|  polyubiquitin protein                                  298   1e-97    Helianthus annuus
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             297   1e-97    
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      297   1e-97    Citrus sinensis [apfelsine]
ref|XP_001830230.1|  ubiquitin                                          297   1e-97    Coprinopsis cinerea okayama7#130
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  295   1e-97    Pisolithus microcarpus 441
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             297   1e-97    Citrus clementina [clementine]
ref|XP_003619701.1|  Ubiquitin-like protein                             296   1e-97    
gb|AAF04147.1|  ubiquitin precursor                                     300   1e-97    Hevea brasiliensis [jebe]
gb|ACJ85658.1|  unknown                                                 294   1e-97    Medicago truncatula
gb|AAB36545.1|  ubiquitin-like protein                                  301   1e-97    Phaseolus vulgaris [French bean]
ref|XP_005850582.1|  hypothetical protein CHLNCDRAFT_48528              294   1e-97    Chlorella variabilis
gb|AAO43308.1|  putative polyubiquitin                                  295   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                300   1e-97    Pyrus x bretschneideri [bai li]
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    300   1e-97    Nicotiana sylvestris
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    297   1e-97    Phoenix dactylifera
gb|KJB13592.1|  hypothetical protein B456_002G083000                    300   1e-97    Gossypium raimondii
gb|EIE88012.1|  polyubiquitin                                           294   1e-97    Rhizopus delemar RA 99-880
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         297   1e-97    Jatropha curcas
gb|KJB81825.1|  hypothetical protein B456_013G163500                    300   1e-97    Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      300   1e-97    Nicotiana sylvestris
ref|XP_004156525.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    293   1e-97    
gb|AES89856.2|  polyubiquitin 3                                         294   1e-97    Medicago truncatula
emb|CDP05795.1|  unnamed protein product                                300   1e-97    Coffea canephora [robusta coffee]
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      300   1e-97    Nelumbo nucifera [Indian lotus]
emb|CBY46746.1|  polyubiquitin 10 protein                               300   1e-97    Lepidium campestre [bastard cress]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     300   1e-97    Arabidopsis thaliana [mouse-ear cress]
gb|EIE85715.1|  polyubiquitin                                           294   1e-97    Rhizopus delemar RA 99-880
gb|AAB68045.1|  polyubiquitin                                           300   1e-97    Fragaria x ananassa
gb|AAB95250.1|  ubiquitin                                               297   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607659.1|  Ubiquitin                                          295   1e-97    
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           297   2e-97    Elaeis guineensis
gb|EWZ40370.1|  ubiquitin C                                             294   2e-97    Fusarium oxysporum Fo47
ref|NP_849300.4|  polyubiquitin 10                                      299   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      299   2e-97    Nicotiana tomentosiformis
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      298   2e-97    Brachypodium distachyon [annual false brome]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         298   2e-97    
gb|ERG83124.1|  polyubiquitin-a                                         291   2e-97    
gb|AFW66438.1|  putative ubiquitin family protein                       298   2e-97    
gb|KDB11907.1|  ubiquitin                                               296   2e-97    Ustilaginoidea virens
ref|XP_001783045.1|  predicted protein                                  294   2e-97    
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   298   2e-97    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA76889.1|  ubiquitin                                              291   2e-97    Trichophyton mentagrophytes
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   296   2e-97    Amanita muscaria Koide BX008
prf||1101405A  ubiquitin precursor                                      292   2e-97 
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        299   2e-97    
gb|KJB14874.1|  hypothetical protein B456_002G147600                    298   2e-97    Gossypium raimondii
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             293   2e-97    Selaginella moellendorffii
emb|CAA54603.1|  pentameric polyubiquitin                               298   2e-97    Nicotiana tabacum [American tobacco]
gb|KJB62485.1|  hypothetical protein B456_009G418900                    296   2e-97    Gossypium raimondii
emb|CBY16339.1|  unnamed protein product                                292   3e-97    Oikopleura dioica
gb|ADO60140.1|  ubiquitin                                               293   3e-97    Beauveria bassiana
ref|XP_001755431.1|  predicted protein                                  293   3e-97    
emb|CDP08567.1|  unnamed protein product                                298   3e-97    Coffea canephora [robusta coffee]
gb|KDN44728.1|  polyubiquitin                                           293   3e-97    Tilletiaria anomala UBC 951
dbj|BAK61738.1|  ubiquitin                                              292   3e-97    Larcopyle butschlii
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                297   3e-97    
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                296   3e-97    Serpula lacrymans var. lacrymans S7.3
dbj|BAL61087.1|  polyubiquitin                                          293   3e-97    Dianthus caryophyllus [carnation]
dbj|BAH70616.1|  ACYPI007765                                            290   3e-97    Acyrthosiphon pisum
emb|CEF99839.1|  Ubiquitin conserved site                               297   4e-97    Ostreococcus tauri
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    296   4e-97    Populus euphratica
ref|XP_001764949.1|  predicted protein                                  296   4e-97    
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      296   4e-97    Populus euphratica
ref|NP_001148453.1|  LOC100282068                                       298   4e-97    Zea mays [maize]
emb|CAA60629.1|  unnamed protein product                                291   4e-97    Acanthamoeba sp. 4b3
ref|XP_004934049.1|  PREDICTED: polyubiquitin-A-like                    290   4e-97    
gb|AAO43309.1|  putative polyubiquitin                                  294   4e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  293   4e-97    Naumovozyma dairenensis CBS 421
gb|EGA57707.1|  Ubi4p                                                   293   4e-97    Saccharomyces cerevisiae FostersB
gb|AIY27743.1|  polyubiquitin Ubi10                                     296   4e-97    Betula luminifera [liang ye hua]
ref|XP_006372519.1|  polyubiquitin family protein                       296   4e-97    Populus trichocarpa [western balsam poplar]
emb|CCL99875.1|  predicted protein                                      296   4e-97    Fibroporia radiculosa
emb|CEP60563.1|  LALA0S01e13784g1_1                                     293   5e-97    Lachancea lanzarotensis
ref|XP_001931824.1|  ubiquitin                                          293   5e-97    Pyrenophora tritici-repentis Pt-1C-BFP
dbj|BAH71116.1|  ACYPI006410                                            290   5e-97    Acyrthosiphon pisum
gb|KEH31155.1|  polyubiquitin 3                                         298   5e-97    Medicago truncatula
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             300   5e-97    Phaseolus vulgaris [French bean]
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   295   5e-97    Sphaerobolus stellatus SS14
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              293   5e-97    Pseudocercospora fijiensis CIRAD86
ref|XP_011504237.1|  PREDICTED: polyubiquitin                           290   5e-97    Ceratosolen solmsi marchali
gb|EPX74297.1|  ubiquitin                                               293   5e-97    Schizosaccharomyces octosporus yFS286
gb|EJW05300.1|  polyubiquitin                                           290   5e-97    Edhazardia aedis USNM 41457
gb|KIY45417.1|  ubiquitin                                               295   6e-97    Fistulina hepatica ATCC 64428
emb|CCT70325.1|  UBI4-Ubiquitin                                         295   6e-97    Fusarium fujikuroi IMI 58289
ref|XP_011175038.1|  PREDICTED: polyubiquitin                           290   6e-97    
gb|KIR63773.1|  polyubiquitin                                           295   6e-97    Cryptococcus gattii CA1873
ref|XP_001555417.1|  polyubiquitin                                      295   6e-97    Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             295   6e-97    Exserohilum turcica Et28A
ref|XP_003030030.1|  polyubiquitin                                      295   6e-97    Schizophyllum commune H4-8
gb|KIY53974.1|  polyubiquitin                                           295   6e-97    Fistulina hepatica ATCC 64428
ref|XP_002419618.1|  ubiquitin, putative                                295   6e-97    Candida dubliniensis CD36
ref|XP_001598085.1|  polyubiquitin                                      295   7e-97    Sclerotinia sclerotiorum 1980 UF-70
gb|EFN65063.1|  Ubiquitin                                               290   7e-97    Camponotus floridanus
ref|XP_004333233.1|  ubiquitin domain containing protein                292   7e-97    Acanthamoeba castellanii str. Neff
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                298   7e-97    
gb|AHC00631.1|  polyubiquitin                                           296   7e-97    Ganoderma lucidum
ref|XP_007763327.1|  polyubiquitin                                      295   7e-97    Coniophora puteana RWD-64-598 SS2
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           299   7e-97    Eucalyptus grandis [rose gum]
ref|XP_005056765.1|  PREDICTED: polyubiquitin-C-like isoform X3         290   7e-97    
ref|XP_009171122.1|  hypothetical protein T265_07359                    290   7e-97    Opisthorchis viverrini [Southeast Asian liver fluke]
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 295   7e-97    Scleroderma citrinum Foug A
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         298   7e-97    Elaeis guineensis
ref|XP_002872109.1|  predicted protein                                  298   7e-97    
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  295   7e-97    
ref|XP_001828882.1|  ubiquitin C                                        295   7e-97    
ref|XP_008555690.1|  PREDICTED: polyubiquitin                           290   7e-97    
gb|AGV54228.1|  polyubiquitin-like protein                              298   8e-97    
gb|KJB81824.1|  hypothetical protein B456_013G163500                    298   8e-97    
ref|XP_004335788.1|  polyubiquitin, putative                            290   8e-97    
ref|NP_001105376.1|  polyubiquitin                                      298   8e-97    
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    292   8e-97    
gb|ABU40645.1|  polyubiquitin                                           298   8e-97    
gb|AFK47245.1|  unknown                                                 292   8e-97    
ref|XP_006381473.1|  polyubiquitin family protein                       295   8e-97    
ref|NP_001174480.1|  Os05g0504766                                       298   8e-97    
gb|ADD52202.1|  ubiquitin                                               298   8e-97    
ref|XP_001420612.1|  predicted protein                                  298   8e-97    
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    298   8e-97    
gb|KJB62483.1|  hypothetical protein B456_009G418900                    298   8e-97    
gb|KIR29996.1|  polyubiquitin                                           295   9e-97    
gb|KFX48439.1|  Polyubiquitin                                           291   9e-97    
ref|XP_002508175.1|  ubiquitin                                          297   9e-97    
gb|EFN76024.1|  Ubiquitin                                               292   9e-97    
ref|XP_007366816.1|  polyubiquitin                                      295   9e-97    
gb|EKV18932.1|  hypothetical protein PDIP_25190                         292   9e-97    
gb|AAQ07453.1|  ubiquitin                                               297   9e-97    
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    297   9e-97    
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             297   9e-97    
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                297   9e-97    
ref|XP_010497209.1|  PREDICTED: polyubiquitin                           289   9e-97    
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      297   9e-97    
emb|CCW69248.1|  unnamed protein product                                289   9e-97    
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      297   1e-96    
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         297   1e-96    
ref|XP_007864655.1|  ubiquitin                                          297   1e-96    
ref|NP_568397.1|  ubiquitin 4                                           297   1e-96    
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                297   1e-96    
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      297   1e-96    
gb|AAY86773.1|  polyubiquitin                                           297   1e-96    
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                300   1e-96    
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             297   1e-96    
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      297   1e-96    
ref|XP_002891806.1|  predicted protein                                  297   1e-96    
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    297   1e-96    
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         297   1e-96    
gb|ADP05114.1|  polyubiquitin 10                                        291   1e-96    
gb|KJB62482.1|  hypothetical protein B456_009G418900                    297   1e-96    
ref|XP_002953480.1|  polyubiquitin                                      295   1e-96    
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             297   1e-96    
gb|AAX40652.1|  polyubiquitin                                           297   1e-96    
gb|KJB81827.1|  hypothetical protein B456_013G163500                    300   1e-96    
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           300   1e-96    
gb|ACS68205.1|  ubiquitin 10.2                                          297   1e-96    
gb|AAB95252.1|  ubiquitin                                               297   1e-96    
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    300   1e-96    
gb|KJB62486.1|  hypothetical protein B456_009G418900                    297   1e-96    
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    297   1e-96    
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             297   1e-96    
gb|KJB13590.1|  hypothetical protein B456_002G083000                    300   1e-96    
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    297   1e-96    
emb|CAA25706.1|  unnamed protein product                                290   1e-96    
ref|XP_005644220.1|  polyubiquitin                                      294   1e-96    
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             298   1e-96    
ref|XP_004929680.1|  PREDICTED: polyubiquitin-C-like isoform X1         289   1e-96    
ref|XP_766242.1|  ubiquitin                                             289   1e-96    
ref|NP_849299.4|  polyubiquitin 10                                      300   1e-96    
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   300   1e-96    
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    299   1e-96    
emb|CAB81074.1|  polyubiquitin (ubq10)                                  300   2e-96    
ref|XP_005820110.1|  ubiquitin                                          289   2e-96    
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        291   2e-96    
ref|XP_006649690.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    291   2e-96    
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                300   2e-96    
ref|NP_001053957.1|  Os04g0628100                                       297   2e-96    
emb|CDI55056.1|  probable polyubiquitin                                 291   2e-96    
ref|XP_008060805.1|  PREDICTED: polyubiquitin-B                         288   2e-96    
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  296   2e-96    
dbj|GAK65396.1|  ubiquitin                                              295   2e-96    
gb|EMS22298.1|  polyubiquitin                                           291   2e-96    
gb|EMS65864.1|  Polyubiquitin                                           297   2e-96    
gb|AAZ42330.1|  ubiquitin protein 1                                     289   2e-96    
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   291   2e-96    
ref|XP_003052575.1|  predicted protein                                  294   2e-96    
emb|CCA70326.1|  related to UBI4-Ubiquitin                              291   2e-96    
ref|XP_009609090.1|  PREDICTED: polyubiquitin 11                        289   2e-96    
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  291   2e-96    
ref|XP_005779770.1|  hypothetical protein EMIHUDRAFT_114700             288   2e-96    
ref|XP_005763036.1|  hypothetical protein EMIHUDRAFT_358059             288   2e-96    
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      298   2e-96    
gb|AAO43305.1|  putative polyubiquitin                                  295   2e-96    
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             294   2e-96    
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   291   2e-96    
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      296   2e-96    
ref|XP_001755307.1|  predicted protein                                  294   2e-96    
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    298   3e-96    
dbj|GAA27344.2|  polyubiquitin-A                                        293   3e-96    
ref|XP_008597200.1|  Ubiquitin subgroup                                 290   3e-96    
gb|KIK81924.1|  hypothetical protein PAXRUDRAFT_736824                  291   3e-96    
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      294   3e-96    
gb|EZF98642.1|  polyubiquitin                                           291   3e-96    
ref|XP_002551324.1|  ubiquitin                                          293   3e-96    
gb|EXX74853.1|  ubiquitin                                               289   3e-96    
gb|AAO43306.1|  putative polyubiquitin                                  294   3e-96    
gb|KHJ83418.1|  ubiquitin family protein                                290   3e-96    
gb|EMS60894.1|  Polyubiquitin                                           298   3e-96    
tpg|DAA34466.1|  TPA: ubiquitin                                         289   3e-96    
emb|CAI83757.1|  Polyubiqutin 4                                         289   3e-96    
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          298   3e-96    
gb|AAA49129.1|  ubiquitin polyprotein (heat shock related)              288   4e-96    
gb|AFK73707.1|  ubiquitin                                               288   4e-96    
ref|XP_011269968.1|  hypothetical protein CAOG_08398                    290   4e-96    
emb|CCG34086.1|  Polyubiquitin                                          293   4e-96    
gb|AAH08661.1|  Ubc protein                                             290   4e-96    
ref|XP_006153239.1|  PREDICTED: polyubiquitin-B                         291   4e-96    
gb|EPS29015.1|  hypothetical protein PDE_03961                          293   4e-96    
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    290   4e-96    
emb|CAX71218.1|  polyubiquitin                                          289   4e-96    
gb|EJW80596.1|  polyubiquitin                                           289   4e-96    
ref|XP_006407638.1|  hypothetical protein EUTSA_v10022008mg             290   5e-96    
ref|XP_002139206.1|  ubiquitin family protein                           288   5e-96    
emb|CAX79673.1|  ubiquitin C                                            287   5e-96    
ref|XP_001777816.1|  predicted protein                                  295   5e-96    
gb|AAL91103.1|  ubiquitin                                               291   5e-96    
dbj|BAK61744.1|  ubiquitin                                              290   5e-96    
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           298   5e-96    
ref|XP_007049060.1|  Polyubiquitin 10                                   298   5e-96    
ref|XP_005800829.1|  PREDICTED: polyubiquitin-C-like                    287   5e-96    
ref|XP_004635917.1|  PREDICTED: polyubiquitin-B-like                    288   5e-96    
gb|AGM32540.1|  polyubiquitin-B-like isoform                            291   5e-96    
gb|ACX46987.1|  ubiquitin                                               297   6e-96    
gb|ETN61808.1|  Ubiquitin-5E                                            287   6e-96    
ref|XP_004833160.1|  ubiquitin family member protein                    287   6e-96    
ref|XP_002839703.1|  hypothetical protein                               293   6e-96    
ref|NP_001232755.1|  putative ubiquitin C variant 4                     287   6e-96    
gb|AAC67552.1|  polyubiquitin                                           295   6e-96    
ref|XP_001227036.1|  polyubiquitin                                      293   6e-96    
gb|AFD53810.1|  ubiquitin                                               291   6e-96    
ref|XP_008969367.1|  PREDICTED: polyubiquitin-C                         287   6e-96    
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                295   6e-96    
gb|AFR98116.1|  polyubiquitin                                           295   6e-96    
gb|KFP73354.1|  Polyubiquitin-B                                         288   6e-96    
ref|XP_009419640.1|  PREDICTED: polyubiquitin-like                      287   6e-96    
gb|EMP26515.1|  Polyubiquitin-C                                         287   6e-96    
gb|AAV84265.1|  ubiquitin                                               288   6e-96    
gb|EEH07231.1|  ubiquitin                                               293   6e-96    
ref|XP_001210780.1|  ubiquitin                                          293   6e-96    
dbj|GAA55031.1|  ubiquitin C                                            290   6e-96    
gb|AAA82978.1|  polyubiquitin                                           295   6e-96    
dbj|BAC56573.1|  similar to polyubiquitin                               288   6e-96    
ref|XP_004341200.1|  polyubiquitin, putative                            290   6e-96    
ref|XP_002494205.1|  Ubiquitin                                          293   6e-96    
ref|XP_004339363.1|  polyubiquitin, putative                            290   6e-96    
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             295   6e-96    
ref|XP_008278997.1|  PREDICTED: polyubiquitin                           288   6e-96    
ref|XP_007441627.1|  PREDICTED: polyubiquitin-C-like                    287   6e-96    
gb|EJU00136.1|  ubiquitin                                               295   6e-96    
dbj|BAP70433.1|  Ubiquitin                                              293   6e-96    
emb|CDR94459.1|  polyubiquitin, putative                                287   6e-96    
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     290   6e-96    
ref|XP_003196661.1|  ATP-dependent protein binding protein              295   6e-96    
ref|XP_009689464.1|  ubiquitin                                          287   6e-96    
ref|XP_005768395.1|  hypothetical protein EMIHUDRAFT_436615             291   6e-96    
ref|XP_009093028.1|  PREDICTED: polyubiquitin-B isoform X1              287   6e-96    
gb|EUC59758.1|  polyubiquitin                                           295   7e-96    
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             295   7e-96    
pdb|2ZVN|A  Chain A, Nemo Cozi Domain Incomplex With Diubiquitin ...    287   7e-96    
gb|KIW56414.1|  polyubiquitin                                           293   7e-96    
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      293   7e-96    
dbj|BAK61751.1|  ubiquitin                                              290   7e-96    
ref|NP_001045980.1|  Os02g0161900                                       298   7e-96    
dbj|BAK03691.1|  predicted protein                                      298   7e-96    
gb|AEH41483.1|  ubiquitin                                               293   7e-96    
gb|AAV65292.1|  polyubiquitin                                           293   7e-96    
pdb|3B08|A  Chain A, Crystal Structure Of The Mouse Hoil1-l-nzf I...    287   7e-96    
ref|XP_003791115.1|  PREDICTED: polyubiquitin-B                         287   7e-96    
gb|KEZ40313.1|  Polyubiquitin                                           293   7e-96    
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          290   7e-96    
gb|ETN78467.1|  ubiquitin family protein                                290   7e-96    
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  293   7e-96    
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     293   7e-96    
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  295   7e-96    
dbj|BAN21697.1|  ubiquitin                                              288   7e-96    
gb|KFV20239.1|  Polyubiquitin-B                                         287   7e-96    
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          298   7e-96    
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  295   7e-96    
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          290   7e-96    
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 295   7e-96    
dbj|BAN65371.1|  polyubiquitin, putative                                287   7e-96    
gb|KFM06793.1|  Polyubiquitin-B                                         287   7e-96    
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    298   7e-96    
emb|CDP08563.1|  unnamed protein product                                287   7e-96    
ref|XP_954057.1|  ubiquitin                                             287   7e-96    
gb|EKV13151.1|  hypothetical protein PDIG_39650                         293   8e-96    
gb|EEQ88150.1|  ubiquitin                                               292   8e-96    
dbj|BAJ91912.1|  predicted protein                                      298   8e-96    
ref|XP_001880135.1|  ubiquitin                                          295   8e-96    
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                298   8e-96    
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    295   8e-96    
gb|AEZ66647.1|  putative beta-1,6-glucanase                             295   8e-96    
gb|AAB95251.1|  ubiquitin                                               297   8e-96    
gb|ADD24466.1|  Ubiquitin                                               290   8e-96    
dbj|BAH71115.1|  ACYPI006410                                            290   8e-96    
emb|CAA40324.1|  hexaubiquitin protein                                  297   8e-96    
gb|KHJ77263.1|  ubiquitin family protein                                288   8e-96    
ref|XP_751791.1|  polyubiquitin UbiD/Ubi4                               293   8e-96    
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  295   8e-96    
gb|KFK38370.1|  hypothetical protein AALP_AA3G105100                    291   8e-96    
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    295   8e-96    
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  295   8e-96    
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      297   8e-96    
gb|KDR10312.1|  Ubiquitin                                               290   8e-96    
ref|XP_011278194.1|  PREDICTED: polyubiquitin-B-like                    288   8e-96    
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      297   8e-96    
gb|ACN40936.1|  unknown                                                 297   8e-96    
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           297   8e-96    
dbj|BAK02501.1|  predicted protein                                      297   9e-96    
ref|XP_659604.1|  hypothetical protein AN2000.2                         293   9e-96    
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           298   9e-96    
ref|XP_002783557.1|  Ubiquitin D, putative                              287   9e-96    
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      297   9e-96    
pdb|4KSL|D  Chain D, Gumby/fam105b In Complex With Linear Di-ubiq...    287   9e-96    
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             297   9e-96    
gb|EEH20847.2|  polyubiquitin                                           293   9e-96    



>ref|NP_001190681.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_003626480.1| Ubiquitin-like protein [Medicago truncatula]
 ref|XP_008345057.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009358112.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358113.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009345196.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009345209.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 gb|AAR83856.1| hexameric polyubiquitin 6PU11 [Capsicum annuum]
 emb|CAN77120.1| hypothetical protein VITISV_031666 [Vitis vinifera]
 gb|ACJ85770.1| unknown [Medicago truncatula]
 gb|AEE82471.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFK33927.1| unknown [Medicago truncatula]
 gb|AFK34391.1| unknown [Lotus japonicus]
 gb|AFP43342.1| polyubiquitin [Arabidopsis thaliana]
 gb|EPS65462.1| hypothetical protein M569_09314 [Genlisea aurea]
 gb|AHW29561.1| polyubiquitin [Picrorhiza kurrooa]
 emb|CDY46367.1| BnaA09g19810D [Brassica napus]
Length=153

 Score =   299 bits (766),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  153


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AHI85710.1| stress-induced protein 5, partial [Capsicum annuum]
Length=169

 Score =   300 bits (767),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  20   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  79

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  80   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  139

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  140  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  169


 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/93 (99%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  172  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  351
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  1    IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  60

Query  352  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  93



>emb|CAI51312.2| polyubiquitin [Capsicum chinense]
Length=153

 Score =   298 bits (763),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRFRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  153


 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLR RGG 
Sbjct  61   IQKESTLHLVLRFRGGM  77



>tpg|DAA44273.1| TPA: Ubiquitin fusion protein [Zea mays]
Length=205

 Score =   300 bits (767),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP  459
            KQLEDGRTLADYNIQKESTLHLVLRLRGG   P
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGIIEP  156


 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004497490.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=154

 Score =   297 bits (761),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (389),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB69254.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=162

 Score =   298 bits (762),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKT  240
            ESTLHLVLRLRGGMQIFVKT
Sbjct  140  ESTLHLVLRLRGGMQIFVKT  159


 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004976899.1| PREDICTED: polyubiquitin 3-like [Setaria italica]
Length=153

 Score =   297 bits (761),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGL  153


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABF06579.2| polyubiquitin, partial [Gladiolus grandiflorus]
Length=162

 Score =   298 bits (762),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTG  249
            ESTLHLVLRLRGGMQIFVKTLTG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTG  162


 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004501591.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=152

 Score =   297 bits (761),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   300 bits (767),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  70   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  129

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  130  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  189

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  190  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  219


 Score =   283 bits (725),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  22   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  201
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  202  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  381
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  382  TLADYNIQKESTLHLVLRLRGGF  450
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>ref|XP_006495477.1| PREDICTED: polyubiquitin 3-like, partial [Citrus sinensis]
Length=164

 Score =   297 bits (761),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   170 bits (431),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKT  255
            ESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKT  164


 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010931828.1| PREDICTED: polyubiquitin [Elaeis guineensis]
 gb|AFW66446.1| ubiquitin2 [Zea mays]
 gb|AFW70220.1| polyubiquitin-like protein [Zea mays]
Length=153

 Score =   297 bits (760),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_008246113.1| PREDICTED: polyubiquitin [Prunus mume]
Length=153

 Score =   297 bits (760),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGI  153


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009758989.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
Length=154

 Score =   297 bits (760),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   298 bits (764),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  330
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAM78180.1| putative polyubiquitin [Gossypium herbaceum]
 gb|AAM78181.1| putative polyubiquitin [Gossypium raimondii]
 gb|AAM78182.1| putative polyubiquitin [Gossypium barbadense]
 gb|AAM78183.1| putative polyubiquitin, partial [Gossypium barbadense]
 gb|AAM78184.1| putative polyubiquitin [Gossypioides kirkii]
Length=204

 Score =   299 bits (765),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  55   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  114

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  115  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  174

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  175  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  204


 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/128 (99%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = +1

Query  67   VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  246
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  1    VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  60

Query  247  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  426
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  427  VLRLRGGF  450
            VLRLRGG 
Sbjct  121  VLRLRGGM  128



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   300 bits (767),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   295 bits (756),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACZ69386.1| polyubiquitin UBQ14 [Cucumis sativus]
Length=197

 Score =   298 bits (764),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  48   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  107

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  108  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  167

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  168  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  197


 Score =   243 bits (619),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +1

Query  88   KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  267
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  1    KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  60

Query  268  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  61   VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  120

Query  448  F  450
             
Sbjct  121  M  121



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  72   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  131

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  132  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  191

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  192  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  221


 Score =   287 bits (735),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +1

Query  16   TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  195
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  196  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  375
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  120

Query  376  GRTLADYNIQKESTLHLVLRLRGGF  450
            GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  GRTLADYNIQKESTLHLVLRLRGGM  145



>gb|AAZ32851.1| pentameric polyubiquitin [Medicago sativa]
Length=189

 Score =   298 bits (763),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  26   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  85

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  86   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  145

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  146  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  175


 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/99 (99%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +1

Query  154  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  333
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  334  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99


 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  102  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  161

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITL  264
            ESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  162  ESTLHLVLRLRGGMQIFVKTLTGKTITL  189



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   298 bits (763),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  7    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  66

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  67   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  126

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  127  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  156


 Score =   205 bits (522),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  83   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  315
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIDNVKAKIQD
Sbjct  143  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVKAKIQD  187


 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +1

Query  211  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  390
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  391  DYNIQKESTLHLVLRLRGGF  450
            DYNIQKESTLHLVLRLRGG 
Sbjct  61   DYNIQKESTLHLVLRLRGGM  80



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AFJ04519.1| ubiquitin, partial [Vernicia fordii]
Length=176

 Score =   297 bits (761),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  27   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  86

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  87   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  146

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  147  KQLEDGRTLADYNIQKESTLHLVLRLRGG  175


 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/100 (99%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +1

Query  151  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  330
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  1    RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  60

Query  331  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  100



>ref|XP_007693173.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
 gb|EUC40302.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
Length=175

 Score =   297 bits (761),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  26   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  85

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  86   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  145

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  146  KQLEDGRTLADYNIQKESTLHLVLRLRGG  174


 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/99 (99%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +1

Query  154  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  333
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  334  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVL LRGG 
Sbjct  61   IQKESTLHLVLXLRGGM  77



>sp|P0CG83.1|UBIQP_HORVU RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Hordeum vulgare]
 emb|CAA27751.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   297 bits (760),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  22   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  81

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  82   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  141

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  142  KQLEDGRTLADYNIQKESTLHLVLRLRGG  170


 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  166  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  345
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  346  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  95



>gb|AFK46460.1| unknown [Medicago truncatula]
Length=153

 Score =   296 bits (759),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKE TLHLVLRLRGGF
Sbjct  124  KQLEDGRTLADYNIQKEFTLHLVLRLRGGF  153


 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009420214.1| PREDICTED: polyubiquitin [Musa acuminata subsp. malaccensis]
Length=153

 Score =   296 bits (759),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   298 bits (762),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  339
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  192


 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   300 bits (767),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  55   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  114

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  115  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  174

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  175  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  204


 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  131  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  190

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  330
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  191  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240


 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  52   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  111

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  112  IQKESTLHLVLRLRGGM  128



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   298 bits (762),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/114 (99%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  342
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQ
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQ  193


 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CAD27944.1| polyubiquitin-like [Oryza sativa]
Length=219

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI    +RLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIHQTSKRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTL  420
            KQLEDGRTLADYNIQKESTL
Sbjct  200  KQLEDGRTLADYNIQKESTL  219


 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/76 (99%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  223  QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  402
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  2    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  61

Query  403  QKESTLHLVLRLRGGF  450
            QKESTLHLVLRLRGG 
Sbjct  62   QKESTLHLVLRLRGGM  77



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  35   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  94

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  95   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  154

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  155  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  184


 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/108 (99%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  127  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  306
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  307  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  108


 Score =   203 bits (517),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  111  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  170

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  312
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI+
Sbjct  171  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIR  214



>gb|ACT82769.1| polyubiquitin [Nicotiana tabacum]
Length=188

 Score =   297 bits (761),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  26   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  85

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  86   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  145

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  146  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  175


 Score =   194 bits (493),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +1

Query  154  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  333
            TL DYNIQKESTLHLVLRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLPDYNIQKESTLHLVLRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  334  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99


 Score =   174 bits (440),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/87 (100%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  102  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  161

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTIT  261
            ESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  162  ESTLHLVLRLRGGMQIFVKTLTGKTIT  188



>gb|AAZ82816.1| ubiquitin monomer protein [Morus mongolica]
Length=152

 Score =   296 bits (757),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLV+RLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVIRLRGG  152


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABR25718.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=178

 Score =   296 bits (759),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  29   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  88

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  89   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  148

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  149  KQLEDGRTLADYNIQKESTLHLVLRLRGG  177


 Score =   204 bits (519),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +1

Query  145  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  324
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  1    DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  60

Query  325  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  102



>pir||PS0380 ubiquitin precursor - rice (fragment)
 dbj|BAA02241.1| poly-ubiquitin [Oryza sativa Japonica Group]
Length=189

 Score =   297 bits (760),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  40   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  99

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  100  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  159

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  160  KQLEDGRTLADYNIQKESTLHLVLRLRGGL  189


 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +1

Query  112  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  291
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  292  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  113



>gb|AAL25813.1| polyubiquitin, partial [Prunus avium]
Length=154

 Score =   296 bits (757),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  5    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  64

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFAG
Sbjct  65   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTPPDQQRLIFAG  124

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQ+ESTLHLVLRLRGGF
Sbjct  125  KQLEDGRTLADYNIQEESTLHLVLRLRGGF  154


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  217  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  396
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  1    GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  60

Query  397  NIQKESTLHLVLRLRGGF  450
            NIQKESTLHLVLRLRGG 
Sbjct  61   NIQKESTLHLVLRLRGGM  78



>ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=232

 Score =   298 bits (764),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   299 bits (765),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  471
            KQLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  236


 Score =   297 bits (761),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   298 bits (764),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGY  229


 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
Length=232

 Score =   298 bits (764),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  128  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  187

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  188  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  247

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  248  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  277


 Score =   297 bits (761),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  52   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  111

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  112  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  171

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  172  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  201


 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  109  IQKESTLHLVLRLRGGM  125



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   298 bits (762),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   273 bits (698),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/137 (100%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKE  411
            KQLEDGRTLADYNIQKE
Sbjct  200  KQLEDGRTLADYNIQKE  216


 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_008809849.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=153

 Score =   295 bits (756),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGXPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGXPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|GAC94856.1| ubiquitin [Pseudozyma hubeiensis SY62]
Length=228

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>dbj|GAC77607.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAK66521.1| ubiquitin domain containing protein [Pseudozyma antarctica]
Length=228

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  6    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  65

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  66   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  125

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  126  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  155


 Score =   265 bits (677),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/149 (91%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  82   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  141

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV             QQRLIFAG
Sbjct  142  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVXXXXXXXXXXXXXQQRLIFAG  201

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  202  KQLEDGRTLADYNIQKESTLHLVLRLRGG  230


 Score =   154 bits (390),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  63   IQKESTLHLVLRLRGGM  79



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   298 bits (762),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/147 (100%), Positives = 147/147 (100%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLR  441
            KQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLR  226


 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   290 bits (741),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRL  438
            KQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRF  225


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   299 bits (766),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   299 bits (766),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  306
            ESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  216  ESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257


 Score =   155 bits (391),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  74   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  133

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  134  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  193

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  194  KQLEDGRTLADYNIQKESTLHLVLRLRGG  222


 Score =   278 bits (710),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  31   TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  210
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  211  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  390
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  127

Query  391  DYNIQKESTLHLVLRLRGGF  450
            DYNIQKESTLHLVLRLRGG 
Sbjct  128  DYNIQKESTLHLVLRLRGGM  147



>ref|XP_001731772.1| hypothetical protein MGL_1040 [Malassezia globosa CBS 7966]
 gb|EDP44558.1| hypothetical protein MGL_1040 [Malassezia globosa CBS 7966]
Length=154

 Score =   295 bits (755),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/74 (97%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGM  222
            ESTLHLVLRLRGG+
Sbjct  140  ESTLHLVLRLRGGV  153



>emb|CCK72367.1| hypothetical protein KNAG_0J02880 [Kazachstania naganishii CBS 
8797]
 gb|KGR16822.1| polyubiquitin [Candida albicans P37037]
Length=153

 Score =   295 bits (755),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGF  153


 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (389),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAM63271.1| unknown [Arabidopsis thaliana]
Length=154

 Score =   295 bits (755),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   297 bits (761),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  66   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  125

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  126  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  185

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  186  KQLEDGRTLADYNIQKESTLHLVLRLRGGL  215


 Score =   277 bits (708),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +1

Query  34   LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  213
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  214  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  393
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  394  YNIQKESTLHLVLRLRGGF  450
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   211 bits (536),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  321
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   299 bits (766),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  120  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  179

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  180  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  239

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  240  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  269


 Score =   296 bits (759),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  44   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  103

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  104  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  163

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  164  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  193


 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +1

Query  160  ADYNI-QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  336
             +YN+ ++E   H        MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  20   CNYNLGRREYGSHFHSFKPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  79

Query  337  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  80   QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  117



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   298 bits (762),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   298 bits (762),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   298 bits (762),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/74 (99%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGM  222
            ESTLHLVLRLRGG+
Sbjct  216  ESTLHLVLRLRGGV  229



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   298 bits (762),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   298 bits (762),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002957068.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ41870.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=153

 Score =   295 bits (754),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGL  153


 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   298 bits (763),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  69   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  128

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  129  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  188

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  218


 Score =   281 bits (720),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  25   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  204
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  205  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  384
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  385  LADYNIQKESTLHLVLRLRGGF  450
            LADYNIQKESTLHLVLRLRGG 
Sbjct  121  LADYNIQKESTLHLVLRLRGGM  142


 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/100 (99%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  145  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  204

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  205  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   298 bits (762),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (757),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKDSTLHLVLRLRGG  228


 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   299 bits (765),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  240

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  241  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   296 bits (759),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  45   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  104

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  105  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  164

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  165  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/118 (99%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  97   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  276
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  277  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   297 bits (761),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (757),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   299 bits (765),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  104  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  163

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  164  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  223

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  471
            KQLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  224  KQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  260


 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  28   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  87

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  88   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  147

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  148  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  177


 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +1

Query  202  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  381
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  382  TLADYNIQKESTLHLVLRLRGGF  450
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  79   TLADYNIQKESTLHLVLRLRGGM  101



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   297 bits (761),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   297 bits (761),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGI  229


 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002389222.1| hypothetical protein MPER_11681 [Moniliophthora perniciosa FA553]
 gb|EEB90152.1| hypothetical protein MPER_11681 [Moniliophthora perniciosa FA553]
Length=153

 Score =   295 bits (754),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KDP23292.1| hypothetical protein JCGZ_23125 [Jatropha curcas]
Length=153

 Score =   295 bits (754),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRT ADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTHADYNIQKESTLHLVLRLRGGI  153


 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_011390959.1| putative polyubiquitin [Ustilago maydis 521]
 gb|KIS67457.1| putative polyubiquitin [Ustilago maydis 521]
Length=228

 Score =   297 bits (761),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (389),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (756),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRNLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   297 bits (760),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  66   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  125

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  126  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  185

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  186  KQLEDGRTLADYNIQKESTLHLVLRLRGG  214


 Score =   277 bits (708),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +1

Query  34   LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  213
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  214  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  393
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  394  YNIQKESTLHLVLRLRGGF  450
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002447145.1| hypothetical protein SORBIDRAFT_06g029360 [Sorghum bicolor]
 gb|EES11473.1| hypothetical protein SORBIDRAFT_06g029360 [Sorghum bicolor]
Length=153

 Score =   295 bits (754),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGK+ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   300 bits (768),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   297 bits (761),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   297 bits (761),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   300 bits (768),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLED RTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDERTLADYNIQKESTLHLVLRLRGGM  153


 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   297 bits (761),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   297 bits (761),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   297 bits (760),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   297 bits (760),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  70   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  129

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  130  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  189

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  190  KQLEDGRTLADYNIQKESTLHLVLRLRGG  218


 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  22   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  201
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  202  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  381
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  382  TLADYNIQKESTLHLVLRLRGGF  450
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  147  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  206

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  296


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  71   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  130

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  131  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  190

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  191  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  19   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  198
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  199  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  378
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  379  RTLADYNIQKESTLHLVLRLRGGF  450
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   149 bits (376),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIF  231
            ESTLHLVLRLRGG+  F
Sbjct  216  ESTLHLVLRLRGGLTGF  232



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  125  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  184

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  185  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  244

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  245  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  49   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  108

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  109  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  168

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  198


 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +1

Query  85   DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  264
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  265  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  444
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  445  GF  450
            G 
Sbjct  121  GM  122



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  294
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253


 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABR25697.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=201

 Score =   296 bits (757),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  52   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  111

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  112  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  171

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  172  KQLEDGRTLADYNIQKESTLHLVLRLRGG  200


 Score =   248 bits (633),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  76   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  255
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  1    KIQDKEGIPPDQQRLIFAGKQLEDGRTLXDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  60

Query  256  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  435
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
Sbjct  61   ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  120

Query  436  LRGGF  450
            LRGG 
Sbjct  121  LRGGM  125



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   295 bits (755),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLV RLRGG 
Sbjct  61   IQKESTLHLVXRLRGGM  77



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD NIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAR32784.1| polyubiquitin [Clusia minor]
Length=223

 Score =   296 bits (759),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  32   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  91

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  92   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  151

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  152  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  181


 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  136  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  315
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  1    QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  60

Query  316  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  105


 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  108  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  167

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITL-EVESSDTIDNVKAKIQDKEGIP  330
            ESTLHLVLRLRGGMQIFVKTLTGK      V +   +  VKAKIQDKEGIP
Sbjct  168  ESTLHLVLRLRGGMQIFVKTLTGKDHHFWXVRTPIPLIMVKAKIQDKEGIP  218



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   295 bits (755),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
             QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  TQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (755),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_001701379.1| bi-ubiquitin, major isoform [Chlamydomonas reinhardtii]
 gb|EDO97495.1| bi-ubiquitin, major isoform [Chlamydomonas reinhardtii]
Length=153

 Score =   294 bits (752),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (755),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   297 bits (761),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  24   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  83

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  84   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  143

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  144  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  159

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  160  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  219

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  220  KQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/97 (99%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +1

Query  160  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  339
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  340  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (759),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  159  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  218

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  219  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  278

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  279  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  7    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  66

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  67   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  126

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  127  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  156


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  83   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  143  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  202

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  203  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  232


 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +1

Query  211  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  390
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  391  DYNIQKESTLHLVLRLRGGF  450
            DYNIQKESTLHLVLRLRGG 
Sbjct  61   DYNIQKESTLHLVLRLRGGM  80



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  24   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  83

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  84   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  143

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  144  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  159

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  160  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  219

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  220  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/106 (99%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  176  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  235

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  318
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  236  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  205  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  384
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  385  LADYNIQKESTLHLVLRLRGGF  450
            LADYNIQKESTLHLVLRLRGG 
Sbjct  76   LADYNIQKESTLHLVLRLRGGM  97



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   296 bits (759),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   296 bits (759),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   283 bits (724),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDG TLADYNIQKE TL LVL  RGGF
Sbjct  200  KQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229


 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  115  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  174

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  175  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  234

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  235  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  39   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  98

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  99   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  158

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  159  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  188


 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  148  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  327
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  328  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  112



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   296 bits (759),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   295 bits (756),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  116  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  175

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  176  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  235

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  236  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  40   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  99

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  100  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  159

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  160  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  189


 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +1

Query  112  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  291
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  292  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  113



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (758),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   225 bits (574),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/114 (99%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  342
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269


 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACB87918.1| polyubiquitin 3 [Malus domestica]
Length=188

 Score =   295 bits (754),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  183
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  184  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  363
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  364  QLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGM  149


 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  76   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  135

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  339
            ESTLHLVLRLRGGMQ+FVKTLTG TITLEVE+SDTIDNVK KIQDKEGIPPDQ
Sbjct  136  ESTLHLVLRLRGGMQMFVKTLTGNTITLEVETSDTIDNVKDKIQDKEGIPPDQ  188



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 115/150 (77%), Gaps = 35/150 (23%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTIT                                 
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTIT---------------------------------  242

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
              LEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  243  --LEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   274 bits (701),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 137/138 (99%), Positives = 138/138 (100%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKES  414
            KQLEDGRTLADYNIQKE+
Sbjct  276  KQLEDGRTLADYNIQKEN  293


 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   298 bits (762),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  15   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  74

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  75   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  134

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  135  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  164


 Score =   298 bits (762),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  91   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  150

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  151  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  240


 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  167  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  226

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  345
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  227  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281


 Score =   176 bits (447),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/88 (99%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +1

Query  187  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  366
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  367  LEDGRTLADYNIQKESTLHLVLRLRGGF  450
            LEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGM  88



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/89 (100%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLE  267
            ESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLE  244


 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGY  305


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   298 bits (763),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  31   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  90

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  91   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  150

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  151  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  180


 Score =   298 bits (763),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  107  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  166

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  167  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  226

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  227  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  256


 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/109 (99%), Positives = 109/109 (100%), Gaps = 0/109 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  183  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  242

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  327
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  243  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  28   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  87

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  88   IQKESTLHLVLRLRGGM  104



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   295 bits (756),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTL LVLRLRGGF
Sbjct  200  KQLEDGRTLADYNIQKESTLPLVLRLRGGF  229


 Score =   295 bits (755),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003687789.1| hypothetical protein TPHA_0K02250 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE65355.1| hypothetical protein TPHA_0K02250 [Tetrapisispora phaffii CBS 
4417]
Length=153

 Score =   292 bits (748),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (383),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CCF48657.1| probable polyubiquitin [Ustilago hordei]
Length=228

 Score =   295 bits (756),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVEPSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   296 bits (757),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  121  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  180

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  181  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  210


 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  49   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  228
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  229  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  408
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  409  ESTLHLVLRLRGGF  450
            ESTLHLVLRLRGG 
Sbjct  121  ESTLHLVLRLRGGM  134


 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  137  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  196

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  306
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  197  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAR  238



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   295 bits (756),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (755),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003648495.1| hypothetical protein Ecym_8408 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET41678.1| Hypothetical protein Ecym_8408 [Eremothecium cymbalariae DBVPG#7215]
Length=153

 Score =   292 bits (748),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (383),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KIY97324.1| ubiquitin C, partial [Monoraphidium neglectum]
Length=186

 Score =   293 bits (751),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  321
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKE
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKE  186


 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007873662.1| hypothetical protein PNEG_01699 [Pneumocystis murina B123]
 gb|EMR09940.1| hypothetical protein PNEG_01699 [Pneumocystis murina B123]
Length=153

 Score =   292 bits (748),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGM  222
            ESTLHLVLRLRGG+
Sbjct  140  ESTLHLVLRLRGGV  153



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (754),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>sp|P0CG73.1|UBI1P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Candida albicans]
 gb|AAA84868.1| ubiquitin precursor [Candida albicans]
Length=229

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   290 bits (742),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRSRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   149 bits (376),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLR RGG 
Sbjct  61   IQKESTLHLVLRSRGGM  77



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (754),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (754),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLH VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   254 bits (650),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/128 (100%), Positives = 128/128 (100%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRT  384
            KQLEDGRT
Sbjct  200  KQLEDGRT  207


 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLH VLRLRGG 
Sbjct  61   IQKESTLHRVLRLRGGM  77



>gb|EHN01342.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW08781.1| Ubi4p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=153

 Score =   292 bits (748),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (754),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/74 (97%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215

Query  181  ESTLHLVLRLRGGM  222
            ESTLHLVLRLRGG+
Sbjct  216  ESTLHLVLRLRGGV  229



>emb|CAL30085.1| polyubiquitin [Globodera pallida]
Length=154

 Score =   292 bits (748),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (754),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EWZ87538.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXM08999.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=153

 Score =   292 bits (748),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   295 bits (755),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   292 bits (748),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   298 bits (763),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  86   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  145

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  146  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  205

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  235


 Score =   298 bits (762),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  162  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  221

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  222  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  281

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  282  KQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 132/156 (85%), Gaps = 6/156 (4%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA------  162
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L       
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSPFAR  63

Query  163  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  342
            + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  64   NAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  123

Query  343  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  159


 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  387
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNL  56



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   295 bits (755),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            E+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKE+ LHLVLRLRGG 
Sbjct  61   IQKETNLHLVLRLRGGM  77



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   295 bits (754),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  69   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  128

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  129  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  188

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  217


 Score =   280 bits (715),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  25   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  204
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  205  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  384
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  385  LADYNIQKESTLHLVLRLRGGF  450
            L+DYNIQKESTLHLVLRLRGG 
Sbjct  121  LSDYNIQKESTLHLVLRLRGGM  142



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   298 bits (762),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EMS24129.1| ubiquitin C [Rhodosporidium toruloides NP11]
Length=238

 Score =   295 bits (755),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYN+QKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNVQKESTLHLVLRLRGGM  153


 Score =   286 bits (733),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 148/157 (94%), Gaps = 8/157 (5%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN+QK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKT--------ITLEVESSDTIDNVKAKIQDKEGIPPD  336
            ESTLHLVLRLRGGMQIFVKTLTGKT        ITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSITLEVESSDTIDNVKAKIQDKEGIPPD  199

Query  337  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            QQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  200  QQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  236


 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   298 bits (762),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (756),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>prf||1604470A poly-ubiquitin
Length=272

 Score =   296 bits (759),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  47   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  106

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  107  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  166

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  167  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  196


 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  123  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  182

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  183  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  242

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  243  KQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  94   GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  273
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  274  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  120



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   298 bits (762),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (755),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRG  444
            KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRG  303


 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   298 bits (762),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   298 bits (762),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   297 bits (761),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACB87916.1| polyubiquitin 1 [Malus domestica]
Length=208

 Score =   294 bits (752),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTG++ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGESITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGR+LADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRSLADYNIQKESTLHLVLRLRGGM  153


 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTG++ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR+LADYNIQK
Sbjct  80   FVKTLTGESITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRSLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGM IFVK+LTGKTITLEVESS+TIDNV+AKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMHIFVKSLTGKTITLEVESSETIDNVQAKIQDKEGIPPDQQRLIFAG  199


 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   297 bits (761),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   297 bits (761),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLDDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   297 bits (761),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 142/150 (95%), Gaps = 8/150 (5%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRLIFAG  267

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  268  KQLEDGRTLADYNIQKESTLHLVLRLRGGY  297


 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   297 bits (761),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   295 bits (756),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   148 bits (374),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/74 (99%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGM  222
            ESTLHLVLRLRGG+
Sbjct  292  ESTLHLVLRLRGGV  305



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  240

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  241  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            F+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  45   FLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  104

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  105  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  164

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  165  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   237 bits (604),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  97   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  276
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  277  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118


 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%), Gaps = 0/109 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  197  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  256

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  327
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  257  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   299 bits (766),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  131  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  190

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  191  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  250

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  251  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  280


 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  207  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  266

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  267  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  326

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  327  KQLEDGRTLADYNIQKESTLHLVLRLRGG  355


 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 149/201 (74%), Gaps = 51/201 (25%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEG----------------------------  96
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                            
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIESSLA  63

Query  97   -----------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  207
                                   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
Sbjct  64   LRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  123

Query  208  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  387
            LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  124  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  183

Query  388  ADYNIQKESTLHLVLRLRGGF  450
            ADYNIQKESTLHLVLRLRGG 
Sbjct  184  ADYNIQKESTLHLVLRLRGGM  204


 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 76/128 (59%), Gaps = 51/128 (40%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE--------------------------  321
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE                          
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  322  -------------------------GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  426
                                     GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  427  VLRLRGGF  450
            VLRLRGG 
Sbjct  121  VLRLRGGM  128



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   295 bits (754),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYN+QKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNVQKESTLHLVLRLRGGM  153


 Score =   293 bits (751),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN+QK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLQDYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   295 bits (754),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (754),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   297 bits (760),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  71   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  130

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  131  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  190

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  191  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  19   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  198
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  199  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  378
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  379  RTLADYNIQKESTLHLVLRLRGGF  450
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144


 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/149 (94%), Positives = 141/149 (95%), Gaps = 8/149 (5%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  147  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  206

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQRLIFAG
Sbjct  207  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQRLIFAG  258

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  259  KQLEDGRTLADYNIQKESTLHLVLRLRGG  287



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   295 bits (754),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002955196.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ43715.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=229

 Score =   295 bits (754),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGM I VKTLTGK I +++E SDTI+ +K ++++KEGIPP QQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMMIKVKTLTGKEIEIDIEPSDTIERIKERVEEKEGIPPVQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQ+ D +   DYNI+  S LHLVL LRGG 
Sbjct  200  KQMNDDKQAKDYNIEGGSVLHLVLALRGGL  229


 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIF  231
            ESTLHLVLRLRGGMQI 
Sbjct  292  ESTLHLVLRLRGGMQIL  308


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (755),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL DYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305


 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (754),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  56   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  115

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  116  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  175

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  176  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  205


 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  132  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  191

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  192  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  251

Query  361  KQLEDG  378
            KQLEDG
Sbjct  252  KQLEDG  257


 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +1

Query  91   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  270
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  271  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  309
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score =   154 bits (390),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   293 bits (749),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (749),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  98   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  157

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  158  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  217

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  218  KQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  22   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  81

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  82   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  141

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  142  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  171


 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  166  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  345
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  346  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  95



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003619701.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES75919.1| pentameric polyubiquitin [Medicago truncatula]
Length=290

 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 133/150 (89%), Gaps = 15/150 (10%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE                G PPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVE---------------RGYPPDQQRLIFAGKQLEDGRTLADYNIQK  200

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  201  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  260

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  261  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  290


 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 132/150 (88%), Gaps = 15/150 (10%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE                G PPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE---------------RGYPPDQQRLIFAG  184

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  185  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  214


 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAF04147.1| ubiquitin precursor [Hevea brasiliensis]
Length=381

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   293 bits (750),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITL VESSDTIDNVKAKIQDKEGIPPDQQR IFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLGVESSDTIDNVKAKIQDKEGIPPDQQRFIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  L     LADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGSSLRMVAPLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   276 bits (705),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITL VESSDTIDNVKAKIQDKEGIPPDQQR IFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLGVESSDTIDNVKAKIQDKEGIPPDQQRFIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
              L     LADYNIQKESTLHLVLRLRGG 
Sbjct  200  SSLRMVAPLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACJ85658.1| unknown [Medicago truncatula]
Length=228

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+FAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLVFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   252 bits (644),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLV  429
              L  G  L+   IQKESTLHLV
Sbjct  200  NNLRMG-GLSLIYIQKESTLHLV  221


 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  258  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  317

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  318  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  377

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  378  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  106  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  165

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  166  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  225

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  226  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  255


 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  182  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  241

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  242  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  301

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  302  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  331


 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = +1

Query  37   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  216
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  217  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  396
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  397  NIQKESTLHLVLRLRGGF  450
            NIQKESTLHLVLRLRGG 
Sbjct  162  NIQKESTLHLVLRLRGGM  179



>ref|XP_005850582.1| hypothetical protein CHLNCDRAFT_48528 [Chlorella variabilis]
 gb|EFN58480.1| hypothetical protein CHLNCDRAFT_48528 [Chlorella variabilis]
Length=229

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL+FAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLVFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGM I VKTLTGK I +++E +DT+  +K ++++KEGIPP QQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMMIKVKTLTGKEIEIDIEPTDTVQRIKERVEEKEGIPPVQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            K + D +   DYNI+  S LHLVL LRGG
Sbjct  200  KAMNDDKMAKDYNIEGGSVLHLVLALRGG  228


 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  24   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  83

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAG
Sbjct  84   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAG  143

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  144  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   291 bits (745),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQK  159

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  160  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  219

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  220  KQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/97 (99%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +1

Query  160  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  339
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  340  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  252  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  311

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  312  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  371

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  372  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  401


 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  24   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  83

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  84   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  143

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  144  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  159

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  160  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  219

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  220  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  176  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  235

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  236  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  295

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  296  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  325


 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  81   IQKESTLHLVLRLRGGM  97



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  228  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  287

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  288  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  347

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  377


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  76   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  135

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  136  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  195

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  225


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  152  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  211

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  212  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  271

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  301


 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  183
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  184  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  363
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  364  QLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGM  149



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   295 bits (756),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (756),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  367

Query  181  ESTLHLVLRLRGGMQI  228
            ESTLHLVLRLRGG ++
Sbjct  368  ESTLHLVLRLRGGFRM  383



>gb|EIE88012.1| polyubiquitin [Rhizopus delemar RA 99-880]
Length=231

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSD+IDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSD+IDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   295 bits (755),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   296 bits (757),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004156525.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis 
sativus]
Length=208

 Score =   293 bits (751),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/157 (96%), Positives = 150/157 (96%), Gaps = 4/157 (3%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGG----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  348
            ESTLHLVLRLRGG    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  64   ESTLHLVLRLRGGIIEPMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  123

Query  349  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP  459
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG   P
Sbjct  124  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGIIEP  160


 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF*IP  459
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>gb|AES89856.2| polyubiquitin 3 [Medicago truncatula]
Length=231

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLGDYNIQKESTLHLVLRLRGGM  153


 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFV TLTGKTITL+VESSDTI +VK  +++K GIP DQ R++ AG
Sbjct  140  ESTLHLVLRLRGGMQIFVNTLTGKTITLDVESSDTIADVKLTLEEKVGIPLDQVRVVIAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQL+D  TLA YNIQKESTLH+VL++ GG
Sbjct  200  KQLKDSYTLAHYNIQKESTLHMVLQVFGG  228


 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   295 bits (756),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (756),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN+QK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNVQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            +QKESTLHLVLRLRGG 
Sbjct  61   VQKESTLHLVLRLRGGM  77



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVL LRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLSLRGGM  153


 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EIE85715.1| polyubiquitin [Rhizopus delemar RA 99-880]
Length=230

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSD+IDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSD+IDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQ+ESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQRESTLHLVLRLRGGM  153


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ+
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQR  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003607659.1| Ubiquitin [Medicago truncatula]
Length=259

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQK
Sbjct  32   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYNIQK  91

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  92   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  151

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  152  KQLEDGRTLGDYNIQKESTLHLVLRLRGGM  181


 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQK
Sbjct  108  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLGDYNIQK  167

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFV TLTGKTITL+VESSDTI +VK  +++K GIP DQ R++ AG
Sbjct  168  ESTLHLVLRLRGGMQIFVNTLTGKTITLDVESSDTIADVKLTLEEKVGIPLDQVRVVIAG  227

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQL+D  TLA YNIQKESTLH+VL++ GG
Sbjct  228  KQLKDSYTLAHYNIQKESTLHMVLQVFGG  256


 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  29   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  88

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  89   IQKESTLHLVLRLRGGM  105



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            F+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (756),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (383),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   296 bits (758),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   292 bits (748),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGCTLADYNIQKESTLHLVLRLRGGM  153


 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQK
Sbjct  80   FVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  40   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  99

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  100  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  159

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  160  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  189


 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  116  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  175

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  176  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  235

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  236  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  265


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  192  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  251

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  252  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  311

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  312  KQLEDGRTLADYNIQKESTLHLVLRLRGG  340


 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  97   IQKESTLHLVLRLRGGM  113



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  32   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  91

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  92   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  151

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  152  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  181


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  108  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  167

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  168  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  227

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  228  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  257


 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  184  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  243

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  244  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  303

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  304  KQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  175  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  354
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  355  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  105



>gb|ERG83124.1| polyubiquitin-a [Ascaris suum]
Length=153

 Score =   291 bits (745),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGY  153


 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  201  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  260

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  261  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  320

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  321  KQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score =   276 bits (707),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 149/195 (76%), Gaps = 45/195 (23%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN---  171
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN   
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  172  ------------------------------------------IQKESTLHLVLRLRGGMQ  225
                                                      IQKESTLHLVLRLRGGMQ
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQKESTLHLVLRLRGGMQ  199

Query  226  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  405
            IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ
Sbjct  200  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  259

Query  406  KESTLHLVLRLRGGF  450
            KESTLHLVLRLRGG 
Sbjct  260  KESTLHLVLRLRGGM  274


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (755),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (751),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  201  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  260

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  261  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  320

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  321  KQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score =   276 bits (707),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 149/195 (76%), Gaps = 45/195 (23%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN---  171
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN   
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  172  ------------------------------------------IQKESTLHLVLRLRGGMQ  225
                                                      IQKESTLHLVLRLRGGMQ
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQKESTLHLVLRLRGGMQ  199

Query  226  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  405
            IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ
Sbjct  200  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  259

Query  406  KESTLHLVLRLRGGF  450
            KESTLHLVLRLRGG 
Sbjct  260  KESTLHLVLRLRGGM  274


 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAA76889.1| ubiquitin [Trichophyton mentagrophytes]
 dbj|BAA88168.1| ubiquitin [Arthroderma otae]
Length=153

 Score =   291 bits (744),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (755),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>prf||1101405A ubiquitin precursor
Length=191

 Score =   292 bits (748),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  42   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  101

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  102  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  161

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  162  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  190


 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +1

Query  106  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  285
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  1    DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  60

Query  286  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            IDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  61   IDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  115



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  45   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  104

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  105  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  164

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  165  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  240

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  241  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  197  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  256

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  257  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  316

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRG  444
            KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  317  KQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 114/150 (76%), Gaps = 35/150 (23%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLE                                   DGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLE-----------------------------------DGRTLADYNIQK  28

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  29   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  88

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  89   KQLEDGRTLADYNIQKESTLHLVLRLRGGM  118



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  330
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   295 bits (756),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (756),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CBY16339.1| unnamed protein product [Oikopleura dioica]
Length=188

 Score =   292 bits (747),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   205 bits (522),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  324
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKE 
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEA  187


 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   293 bits (750),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQK  408
            KQLEDGRTL+DYNIQK
Sbjct  200  KQLEDGRTLSDYNIQK  215


 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   293 bits (751),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   291 bits (744),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRG  444
            KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRG  227


 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  57   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  116

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  117  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  176

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  177  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  206


 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  133  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  192

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  193  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  252

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  253  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  282


 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  209  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  268

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  269  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  328

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNI   +   L  + R  F
Sbjct  329  KQLEDGRTLADYNITPLTMSRLRSKTRRAF  358


 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  54   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  113

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  114  IQKESTLHLVLRLRGGM  130



>gb|KDN44728.1| polyubiquitin [Tilletiaria anomala UBC 951]
Length=229

 Score =   293 bits (751),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESGDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESGDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESGDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF*I  456
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79


 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESGDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTG  249
            ESTLHLVLRLRGG +   +  TG
Sbjct  140  ESTLHLVLRLRGGAKKRCQNGTG  162



>dbj|BAK61738.1| ubiquitin [Larcopyle butschlii]
Length=188

 Score =   292 bits (747),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITL+VESSDTI NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTI NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   207 bits (528),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITL+VESSDTI NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  327
            ESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTI NVKAKIQDKEGI
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLDVESSDTISNVKAKIQDKEGI  188


 Score =   151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITL+VESSDTI NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   297 bits (761),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  38   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  97

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  98   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  157

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  158  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  187


 Score =   297 bits (761),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  114  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  173

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  174  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  233

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  234  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   297 bits (760),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  190  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  249

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  250  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  309

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  310  KQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +1

Query  211  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  390
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  391  DYNIQKESTLHLVLRLRGGF  450
            DYNIQKESTLHLVLRLRGG 
Sbjct  92   DYNIQKESTLHLVLRLRGGM  111



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/144 (98%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVL  432
            KQLEDGRTL+DYNIQKESTLHLV 
Sbjct  276  KQLEDGRTLSDYNIQKESTLHLVF  299


 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   293 bits (750),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAH70616.1| ACYPI007765 [Acyrthosiphon pisum]
Length=153

 Score =   290 bits (743),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   297 bits (760),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  38   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  97

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  98   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  157

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  158  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  187


 Score =   297 bits (760),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  114  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  173

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  174  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  233

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  234  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   296 bits (759),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  190  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  249

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  250  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  309

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  310  KQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  95   IQKESTLHLVLRLRGGM  111



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQK+STLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKDSTLHLVLRLRGGM  153


 Score =   295 bits (756),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGG  447
            KQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            +STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  DSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEEGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   296 bits (758),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTIT  261
            ESTLHLVLRLRGGM+I   TL  K IT
Sbjct  292  ESTLHLVLRLRGGMEIIEDTLASKIIT  318


 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_011038259.1| PREDICTED: polyubiquitin-like [Populus euphratica]
 ref|XP_011038263.1| PREDICTED: polyubiquitin-like [Populus euphratica]
Length=305

 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEEGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   298 bits (764),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  292  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  351

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  352  KQLEDGRTLADYNIQKESTLHLVLRLRGGY  381


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CAA60629.1| unnamed protein product [Acanthamoeba sp. 4b3]
Length=172

 Score =   291 bits (744),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKQKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   181 bits (458),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/93 (98%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  279
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  172


 Score =   150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004934049.1| PREDICTED: polyubiquitin-A-like, partial [Bombyx mori]
Length=155

 Score =   290 bits (743),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQI  228
            ESTLHLVLRLRGGMQI
Sbjct  140  ESTLHLVLRLRGGMQI  155



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   294 bits (752),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  24   FVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  83

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAG
Sbjct  84   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAG  143

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  144  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  100  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQK  159

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ+RLIFAG
Sbjct  160  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQKRLIFAG  219

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLA YNIQKESTLHLVLRLRGG 
Sbjct  220  KQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/97 (98%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +1

Query  160  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  339
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  340  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   293 bits (750),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (750),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EGA57707.1| Ubi4p [Saccharomyces cerevisiae FostersB]
Length=248

 Score =   293 bits (751),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   291 bits (746),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK LEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/93 (98%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  279
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  248


 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  78   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  137

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  138  ESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAG  197

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  198  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  227


 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  154  FVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  213

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  214  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  273

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  274  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  303


 Score =   270 bits (691),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 141/150 (94%), Gaps = 2/150 (1%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  61

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  62   ESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  121

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  151


 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  230  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  289

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  303
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  290  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  216  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  275

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  276  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   293 bits (750),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (750),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  163  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  222

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  223  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  282

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  283  KQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312


 Score =   296 bits (757),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  11   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  70

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  71   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  130

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  131  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  160


 Score =   296 bits (757),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  87   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  146

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  147  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  206

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  207  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  236


 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  68   IQKESTLHLVLRLRGGM  84



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  4    FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  63

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  64   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  123

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  124  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  80   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  139

Query  181  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  360
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAG
Sbjct  140  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAG  199

Query  361  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  450
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  200  KQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229


 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  399
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  400  IQKESTLHLVLRLRGGF  450
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880