BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN008G23

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG08050.1|  40S ribosomal S8                                        280   6e-92   Gossypium arboreum [tree cotton]
ref|XP_007146564.1|  hypothetical protein PHAVU_006G051300g             280   9e-92   Phaseolus vulgaris [French bean]
ref|XP_006373483.1|  hypothetical protein POPTR_0017s14180g             278   6e-91   Populus trichocarpa [western balsam poplar]
ref|XP_011021175.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     278   6e-91   Populus euphratica
ref|NP_001105391.1|  40S ribosomal protein S8                           278   9e-91   Zea mays [maize]
ref|XP_011008256.1|  PREDICTED: 40S ribosomal protein S8-like           277   1e-90   Populus euphratica
gb|KJB62959.1|  hypothetical protein B456_009G445800                    276   2e-90   Gossypium raimondii
gb|KHG04827.1|  40S ribosomal S8                                        276   2e-90   Gossypium arboreum [tree cotton]
gb|KJB84080.1|  hypothetical protein B456_N005000                       276   2e-90   Gossypium raimondii
ref|XP_010252680.1|  PREDICTED: 40S ribosomal protein S8                276   3e-90   Nelumbo nucifera [Indian lotus]
ref|XP_006437243.1|  hypothetical protein CICLE_v10032694mg             276   4e-90   Citrus clementina [clementine]
ref|XP_010483522.1|  PREDICTED: 40S ribosomal protein S8-2-like         276   4e-90   Camelina sativa [gold-of-pleasure]
ref|NP_001046866.1|  Os02g0489400                                       275   5e-90   
ref|XP_002446216.1|  hypothetical protein SORBIDRAFT_06g004770          275   5e-90   Sorghum bicolor [broomcorn]
ref|XP_007049644.1|  40S ribosomal protein S8 isoform 1                 275   7e-90   Theobroma cacao [chocolate]
ref|XP_010060252.1|  PREDICTED: 40S ribosomal protein S8                275   8e-90   Eucalyptus grandis [rose gum]
gb|KDP39216.1|  hypothetical protein JCGZ_00973                         275   8e-90   Jatropha curcas
ref|NP_001052526.1|  Os04g0349500                                       275   8e-90   
gb|KDP45274.1|  hypothetical protein JCGZ_15139                         275   8e-90   Jatropha curcas
ref|XP_007134162.1|  hypothetical protein PHAVU_010G024600g             275   8e-90   Phaseolus vulgaris [French bean]
gb|KDO36309.1|  hypothetical protein CISIN_1g045444mg                   275   9e-90   Citrus sinensis [apfelsine]
ref|XP_006452497.1|  hypothetical protein CICLE_v10009415mg             275   1e-89   Citrus clementina [clementine]
ref|XP_006484807.1|  PREDICTED: 40S ribosomal protein S8-like           275   1e-89   Citrus sinensis [apfelsine]
ref|NP_001132384.1|  uncharacterized protein LOC100193830               275   1e-89   Zea mays [maize]
ref|XP_004510234.1|  PREDICTED: 40S ribosomal protein S8-like           274   2e-89   Cicer arietinum [garbanzo]
ref|XP_009778867.1|  PREDICTED: 40S ribosomal protein S8-like           275   2e-89   Nicotiana sylvestris
gb|KJB22170.1|  hypothetical protein B456_004G033000                    274   2e-89   Gossypium raimondii
dbj|BAA07207.1|  ribosomal protein S8                                   274   2e-89   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004242427.1|  PREDICTED: 40S ribosomal protein S8                274   2e-89   Solanum lycopersicum
gb|EAY93669.1|  hypothetical protein OsI_15456                          274   2e-89   Oryza sativa Indica Group [Indian rice]
gb|KJB13805.1|  hypothetical protein B456_002G095300                    274   2e-89   Gossypium raimondii
gb|KHM99496.1|  40S ribosomal protein S8                                274   2e-89   Glycine soja [wild soybean]
ref|XP_003532158.1|  PREDICTED: 40S ribosomal protein S8-like           274   2e-89   Glycine max [soybeans]
gb|KHG18510.1|  40S ribosomal S8                                        273   3e-89   Gossypium arboreum [tree cotton]
ref|XP_008679872.1|  PREDICTED: 40S ribosomal protein S8-like           276   3e-89   
ref|XP_008657369.1|  PREDICTED: uncharacterized protein LOC100193...    273   3e-89   Zea mays [maize]
ref|XP_002269042.2|  PREDICTED: 40S ribosomal protein S8                273   4e-89   Vitis vinifera
ref|XP_008222788.1|  PREDICTED: 40S ribosomal protein S8                273   4e-89   Prunus mume [ume]
ref|XP_002299926.1|  40S ribosomal protein S8                           273   5e-89   Populus trichocarpa [western balsam poplar]
ref|XP_009373606.1|  PREDICTED: 40S ribosomal protein S8                273   5e-89   Pyrus x bretschneideri [bai li]
ref|XP_010454644.1|  PREDICTED: 40S ribosomal protein S8-2              273   5e-89   Camelina sativa [gold-of-pleasure]
ref|XP_009349000.1|  PREDICTED: 40S ribosomal protein S8-like           273   5e-89   Pyrus x bretschneideri [bai li]
ref|XP_009378162.1|  PREDICTED: 40S ribosomal protein S8-like           273   5e-89   Pyrus x bretschneideri [bai li]
gb|KJB81679.1|  hypothetical protein B456_013G156600                    273   6e-89   Gossypium raimondii
ref|XP_004492266.1|  PREDICTED: 40S ribosomal protein S8-like           273   6e-89   Cicer arietinum [garbanzo]
ref|XP_002452585.1|  hypothetical protein SORBIDRAFT_04g028530          273   7e-89   Sorghum bicolor [broomcorn]
gb|KCW58021.1|  hypothetical protein EUGRSUZ_H00750                     273   7e-89   Eucalyptus grandis [rose gum]
ref|XP_008466734.1|  PREDICTED: 40S ribosomal protein S8-2              273   7e-89   Cucumis melo [Oriental melon]
gb|AFK40150.1|  unknown                                                 272   8e-89   Lotus japonicus
gb|KHF98591.1|  40S ribosomal S8                                        272   1e-88   Gossypium arboreum [tree cotton]
ref|XP_004953910.1|  PREDICTED: 40S ribosomal protein S8-like           272   1e-88   Setaria italica
ref|XP_008778380.1|  PREDICTED: 40S ribosomal protein S8-like           272   1e-88   Phoenix dactylifera
gb|KJB84081.1|  hypothetical protein B456_N005000                       273   1e-88   Gossypium raimondii
ref|XP_002275094.1|  PREDICTED: 40S ribosomal protein S8                272   1e-88   Vitis vinifera
ref|XP_004148331.1|  PREDICTED: 40S ribosomal protein S8-like           272   1e-88   Cucumis sativus [cucumbers]
ref|XP_006281069.1|  hypothetical protein CARUB_v10027092mg             272   1e-88   Capsella rubella
gb|AFK37035.1|  unknown                                                 271   2e-88   Lotus japonicus
ref|XP_008792950.1|  PREDICTED: 40S ribosomal protein S8                272   2e-88   Phoenix dactylifera
ref|XP_006601753.1|  PREDICTED: uncharacterized protein LOC100500...    271   2e-88   
gb|KHN25148.1|  40S ribosomal protein S8                                271   2e-88   Glycine soja [wild soybean]
gb|KJB22659.1|  hypothetical protein B456_004G059300                    271   2e-88   Gossypium raimondii
ref|XP_004975334.1|  PREDICTED: 40S ribosomal protein S8-like           271   2e-88   Setaria italica
ref|NP_001240243.1|  uncharacterized protein LOC100813170               271   2e-88   Glycine max [soybeans]
ref|XP_010693327.1|  PREDICTED: 40S ribosomal protein S8-like           271   2e-88   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK33351.1|  unknown                                                 271   2e-88   Lotus japonicus
ref|XP_007020644.1|  40S ribosomal protein S8 isoform 1                 271   2e-88   
ref|XP_006373482.1|  hypothetical protein POPTR_0017s14180g             271   3e-88   Populus trichocarpa [western balsam poplar]
ref|XP_008337490.1|  PREDICTED: 40S ribosomal protein S8                271   3e-88   Malus domestica [apple tree]
gb|ACJ86093.1|  unknown                                                 271   3e-88   Medicago truncatula
ref|XP_011021176.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     271   4e-88   Populus euphratica
ref|XP_010913108.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     271   4e-88   Elaeis guineensis
ref|XP_009416597.1|  PREDICTED: 40S ribosomal protein S8                271   4e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011025495.1|  PREDICTED: 40S ribosomal protein S8-like           270   5e-88   Populus euphratica
ref|XP_009406344.1|  PREDICTED: 40S ribosomal protein S8-like           270   5e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004240435.1|  PREDICTED: 40S ribosomal protein S8-2              270   5e-88   Solanum lycopersicum
ref|XP_010907235.1|  PREDICTED: 40S ribosomal protein S8-like           270   5e-88   Elaeis guineensis
gb|AFK47179.1|  unknown                                                 270   6e-88   Medicago truncatula
ref|XP_006352667.1|  PREDICTED: 40S ribosomal protein S8-like           270   6e-88   Solanum tuberosum [potatoes]
ref|XP_009783183.1|  PREDICTED: 40S ribosomal protein S8                270   7e-88   Nicotiana sylvestris
ref|XP_010646836.1|  PREDICTED: 40S ribosomal protein S8                270   7e-88   
ref|XP_009610547.1|  PREDICTED: 40S ribosomal protein S8                270   7e-88   Nicotiana tomentosiformis
ref|XP_010675861.1|  PREDICTED: 40S ribosomal protein S8                270   7e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010913109.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     270   8e-88   Elaeis guineensis
ref|NP_001236970.1|  uncharacterized protein LOC100500112               270   8e-88   
ref|XP_003520991.1|  PREDICTED: 40S ribosomal protein S8-like           270   8e-88   Glycine max [soybeans]
gb|ACU19111.1|  unknown                                                 270   9e-88   Glycine max [soybeans]
ref|XP_008451649.1|  PREDICTED: 40S ribosomal protein S8-like           270   1e-87   Cucumis melo [Oriental melon]
ref|XP_010278451.1|  PREDICTED: 40S ribosomal protein S8-like           270   1e-87   Nelumbo nucifera [Indian lotus]
ref|XP_002529032.1|  40S ribosomal protein S8, putative                 270   1e-87   Ricinus communis
ref|XP_003547779.1|  PREDICTED: 40S ribosomal protein S8                270   1e-87   Glycine max [soybeans]
ref|XP_011069406.1|  PREDICTED: 40S ribosomal protein S8                270   1e-87   Sesamum indicum [beniseed]
ref|XP_006833291.1|  hypothetical protein AMTR_s00109p00031400          269   1e-87   Amborella trichopoda
emb|CDP15136.1|  unnamed protein product                                271   1e-87   Coffea canephora [robusta coffee]
ref|XP_009413565.1|  PREDICTED: 40S ribosomal protein S8-like           270   1e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002534344.1|  40S ribosomal protein S8, putative                 269   2e-87   Ricinus communis
ref|XP_003551567.1|  PREDICTED: 40S ribosomal protein S8                269   2e-87   Glycine max [soybeans]
ref|XP_011095494.1|  PREDICTED: 40S ribosomal protein S8                269   2e-87   Sesamum indicum [beniseed]
ref|XP_006286561.1|  hypothetical protein CARUB_v10001914mg             269   3e-87   Capsella rubella
ref|XP_009371092.1|  PREDICTED: 40S ribosomal protein S8-like           268   3e-87   Pyrus x bretschneideri [bai li]
ref|XP_002313320.1|  40S ribosomal protein S8                           268   3e-87   Populus trichocarpa [western balsam poplar]
ref|NP_200732.2|  40S ribosomal protein S8-2                            268   5e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069614.1|  PREDICTED: 40S ribosomal protein S8-like           268   5e-87   Eucalyptus grandis [rose gum]
ref|NP_001274851.1|  uncharacterized protein LOC102577693               268   5e-87   Solanum tuberosum [potatoes]
ref|XP_009403610.1|  PREDICTED: 40S ribosomal protein S8-like           268   6e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223947.1|  hypothetical protein PRUPE_ppa011148mg             268   6e-87   Prunus persica
gb|ACU16800.1|  unknown                                                 268   6e-87   Glycine max [soybeans]
sp|O81361.1|RS8_PRUAR  RecName: Full=40S ribosomal protein S8           267   9e-87   Prunus armeniaca
ref|XP_010905161.1|  PREDICTED: 40S ribosomal protein S8-like           267   9e-87   Elaeis guineensis
gb|EYU33688.1|  hypothetical protein MIMGU_mgv1a013525mg                267   1e-86   Erythranthe guttata [common monkey flower]
ref|XP_008809644.1|  PREDICTED: 40S ribosomal protein S8                267   1e-86   Phoenix dactylifera
ref|XP_004247043.1|  PREDICTED: 40S ribosomal protein S8                267   1e-86   Solanum lycopersicum
ref|XP_007149668.1|  hypothetical protein PHAVU_005G089100g             266   1e-86   Phaseolus vulgaris [French bean]
ref|XP_008679876.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     268   2e-86   Zea mays [maize]
ref|XP_010270147.1|  PREDICTED: 40S ribosomal protein S8-like           266   2e-86   Nelumbo nucifera [Indian lotus]
ref|XP_008366424.1|  PREDICTED: 40S ribosomal protein S8                266   2e-86   Malus domestica [apple tree]
ref|XP_010243157.1|  PREDICTED: 40S ribosomal protein S8-like iso...    266   2e-86   Nelumbo nucifera [Indian lotus]
ref|XP_009596732.1|  PREDICTED: 40S ribosomal protein S8                266   2e-86   Nicotiana tomentosiformis
ref|XP_004160707.1|  PREDICTED: 40S ribosomal protein S8-like           266   2e-86   
gb|AGV54796.1|  40S ribosomal protein S8                                266   3e-86   Phaseolus vulgaris [French bean]
ref|XP_009771719.1|  PREDICTED: 40S ribosomal protein S8                266   3e-86   Nicotiana sylvestris
gb|ACU16398.1|  unknown                                                 267   3e-86   Glycine max [soybeans]
ref|XP_009361080.1|  PREDICTED: 40S ribosomal protein S8-like           266   3e-86   Pyrus x bretschneideri [bai li]
ref|XP_004149800.1|  PREDICTED: 40S ribosomal protein S8-like           266   4e-86   Cucumis sativus [cucumbers]
gb|KJB81683.1|  hypothetical protein B456_013G156600                    266   4e-86   Gossypium raimondii
ref|XP_010243156.1|  PREDICTED: 40S ribosomal protein S8-like iso...    266   4e-86   Nelumbo nucifera [Indian lotus]
ref|XP_009405538.1|  PREDICTED: 40S ribosomal protein S8-like           266   4e-86   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY60374.1|  BnaCnng36150D                                          266   4e-86   Brassica napus [oilseed rape]
ref|XP_006409551.1|  hypothetical protein EUTSA_v10022838mg             266   4e-86   Eutrema salsugineum [saltwater cress]
ref|XP_006344091.1|  PREDICTED: 40S ribosomal protein S8-like           266   4e-86   Solanum tuberosum [potatoes]
ref|XP_009131790.1|  PREDICTED: 40S ribosomal protein S8-1              265   6e-86   Brassica rapa
ref|XP_008227073.1|  PREDICTED: 40S ribosomal protein S8-like           265   6e-86   Prunus mume [ume]
gb|ACJ83894.1|  unknown                                                 265   7e-86   Medicago truncatula
ref|XP_009126438.1|  PREDICTED: 40S ribosomal protein S8-1-like         265   8e-86   Brassica rapa
ref|XP_006400597.1|  hypothetical protein EUTSA_v10014589mg             265   1e-85   Eutrema salsugineum [saltwater cress]
gb|KFK31870.1|  hypothetical protein AALP_AA6G169300                    265   1e-85   Arabis alpina [alpine rockcress]
ref|XP_008364326.1|  PREDICTED: 40S ribosomal protein S8-like           265   1e-85   
ref|XP_002873989.1|  ribosomal protein S8                               264   1e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_010493138.1|  PREDICTED: 40S ribosomal protein S8-1              265   1e-85   Camelina sativa [gold-of-pleasure]
gb|KJB62960.1|  hypothetical protein B456_009G445800                    264   1e-85   Gossypium raimondii
gb|ACN31997.1|  unknown                                                 264   1e-85   Zea mays [maize]
ref|XP_009619873.1|  PREDICTED: 40S ribosomal protein S8-like           264   1e-85   Nicotiana tomentosiformis
ref|XP_010420870.1|  PREDICTED: 40S ribosomal protein S8-1-like         264   1e-85   Camelina sativa [gold-of-pleasure]
emb|CDY45095.1|  BnaA02g04810D                                          265   2e-85   Brassica napus [oilseed rape]
ref|XP_007211997.1|  hypothetical protein PRUPE_ppa011067mg             264   2e-85   
ref|XP_009602561.1|  PREDICTED: 40S ribosomal protein S8-like           264   2e-85   Nicotiana tomentosiformis
ref|XP_010541736.1|  PREDICTED: 40S ribosomal protein S8-1-like         263   5e-85   Tarenaya hassleriana [spider flower]
ref|XP_009770276.1|  PREDICTED: 40S ribosomal protein S8-like           262   7e-85   Nicotiana sylvestris
gb|EYU27406.1|  hypothetical protein MIMGU_mgv1a013520mg                262   8e-85   Erythranthe guttata [common monkey flower]
ref|XP_006856815.1|  hypothetical protein AMTR_s00055p00155570          262   9e-85   Amborella trichopoda
emb|CDP03936.1|  unnamed protein product                                262   1e-84   Coffea canephora [robusta coffee]
gb|KFK26269.1|  hypothetical protein AALP_AA8G225000                    262   1e-84   Arabis alpina [alpine rockcress]
ref|XP_009765854.1|  PREDICTED: 40S ribosomal protein S8-like           262   1e-84   Nicotiana sylvestris
ref|XP_009120819.1|  PREDICTED: 40S ribosomal protein S8-1              262   1e-84   Brassica rapa
ref|XP_010235437.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     262   2e-84   Brachypodium distachyon [annual false brome]
gb|ABL85034.1|  ribosomal subunit 8E protein                            261   2e-84   Brachypodium sylvaticum
gb|KJB13806.1|  hypothetical protein B456_002G095300                    261   2e-84   Gossypium raimondii
gb|KJB81682.1|  hypothetical protein B456_013G156600                    260   2e-84   Gossypium raimondii
ref|XP_010535902.1|  PREDICTED: 40S ribosomal protein S8-1-like         261   2e-84   Tarenaya hassleriana [spider flower]
emb|CDY35814.1|  BnaC09g37460D                                          262   2e-84   Brassica napus [oilseed rape]
ref|XP_004290159.1|  PREDICTED: 40S ribosomal protein S8-like           261   2e-84   Fragaria vesca subsp. vesca
emb|CBI39377.3|  unnamed protein product                                261   3e-84   Vitis vinifera
ref|XP_003557224.1|  PREDICTED: 40S ribosomal protein S8                261   4e-84   Brachypodium distachyon [annual false brome]
ref|XP_003574981.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     261   5e-84   Brachypodium distachyon [annual false brome]
ref|XP_002864608.1|  40S ribosomal protein S8                           260   5e-84   
ref|XP_006652189.1|  PREDICTED: 40S ribosomal protein S8-like           260   5e-84   
ref|XP_009594581.1|  PREDICTED: 40S ribosomal protein S8-2-like         260   6e-84   Nicotiana tomentosiformis
gb|KHG14255.1|  40S ribosomal S8                                        259   6e-84   Gossypium arboreum [tree cotton]
emb|CDX92472.1|  BnaA10g15110D                                          261   6e-84   
ref|XP_010097296.1|  40S ribosomal protein S8                           260   6e-84   
emb|CBI26725.3|  unnamed protein product                                259   1e-83   Vitis vinifera
ref|XP_011461093.1|  PREDICTED: 40S ribosomal protein S8                259   1e-83   Fragaria vesca subsp. vesca
emb|CDX88842.1|  BnaA03g08070D                                          259   1e-83   
gb|EYU39184.1|  hypothetical protein MIMGU_mgv1a013531mg                259   2e-83   Erythranthe guttata [common monkey flower]
gb|EMT18438.1|  40S ribosomal protein S8                                259   2e-83   
gb|KJB22660.1|  hypothetical protein B456_004G059300                    258   3e-83   Gossypium raimondii
ref|XP_006648644.1|  PREDICTED: 40S ribosomal protein S8-like           258   4e-83   
ref|XP_003626942.1|  Ribosomal protein S8                               270   5e-83   
ref|XP_006369983.1|  hypothetical protein POPTR_0001s37140g             257   5e-83   
ref|NP_197529.1|  40S ribosomal protein S8-1                            258   6e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006346168.1|  PREDICTED: 40S ribosomal protein S8-like           257   8e-83   Solanum tuberosum [potatoes]
dbj|BAJ89904.1|  predicted protein                                      257   8e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010519957.1|  PREDICTED: 40S ribosomal protein S8-1              257   8e-83   Tarenaya hassleriana [spider flower]
ref|XP_010926672.1|  PREDICTED: 40S ribosomal protein S8-like iso...    256   1e-82   
ref|XP_010327196.1|  PREDICTED: 40S ribosomal protein S8                256   2e-82   Solanum lycopersicum
ref|XP_010926670.1|  PREDICTED: 40S ribosomal protein S8-like iso...    256   2e-82   
ref|XP_004244061.1|  PREDICTED: 40S ribosomal protein S8-like           256   2e-82   Solanum lycopersicum
gb|ACI15738.1|  putative 40S ribosomal protein S8-like protein          256   2e-82   Picrorhiza kurrooa
ref|XP_007049645.1|  40S ribosomal protein S8 isoform 3                 255   3e-82   
ref|NP_001275100.1|  putative 40S ribosomal protein S8-like protein     254   1e-81   Solanum tuberosum [potatoes]
gb|EMS65111.1|  40S ribosomal protein S8                                255   3e-81   Triticum urartu
ref|XP_011089042.1|  PREDICTED: 40S ribosomal protein S8-like           253   3e-81   Sesamum indicum [beniseed]
ref|XP_010520566.1|  PREDICTED: 40S ribosomal protein S8-1-like         253   5e-81   Tarenaya hassleriana [spider flower]
ref|XP_006352532.1|  PREDICTED: 40S ribosomal protein S8                252   8e-81   
gb|EYU39185.1|  hypothetical protein MIMGU_mgv1a013531mg                250   2e-80   Erythranthe guttata [common monkey flower]
gb|EPS68663.1|  hypothetical protein M569_06106                         250   3e-80   Genlisea aurea
gb|ABK21921.1|  unknown                                                 249   9e-80   Picea sitchensis
ref|XP_001761026.1|  predicted protein                                  248   3e-79   
gb|ABK21933.1|  unknown                                                 247   6e-79   Picea sitchensis
gb|ABK22298.1|  unknown                                                 247   8e-79   Picea sitchensis
gb|AET01418.2|  40S ribosomal protein S8                                248   4e-78   Medicago truncatula
gb|ABR16896.1|  unknown                                                 245   4e-78   Picea sitchensis
gb|EPS68749.1|  hypothetical protein M569_06019                         248   7e-77   Genlisea aurea
ref|XP_001773385.1|  predicted protein                                  242   8e-77   
ref|XP_001777587.1|  predicted protein                                  241   1e-76   
ref|XP_001780988.1|  predicted protein                                  241   2e-76   
ref|XP_001777813.1|  predicted protein                                  240   5e-76   
gb|AES86897.2|  40S ribosomal S8-like protein                           237   4e-75   Medicago truncatula
ref|XP_003604700.1|  Ribosomal protein S8                               238   2e-74   
ref|XP_004516802.1|  PREDICTED: 40S ribosomal protein S8-like           238   7e-74   
ref|XP_008676011.1|  PREDICTED: 40S ribosomal protein S8-like           238   1e-73   
ref|XP_001696201.1|  ribosomal protein S8, component of cytosolic...    233   2e-73   Chlamydomonas reinhardtii
gb|ABA01100.1|  40S ribosomal protein S8                                229   3e-72   Chlamydomonas incerta
ref|XP_002963298.1|  hypothetical protein SELMODRAFT_80565              229   6e-72   
ref|XP_002945874.1|  component of cytosolic 80S ribosome and 40S ...    229   9e-72   Volvox carteri f. nagariensis
ref|XP_010539242.1|  PREDICTED: 40S ribosomal protein S8-1-like         223   6e-70   Tarenaya hassleriana [spider flower]
gb|EYU33690.1|  hypothetical protein MIMGU_mgv1a013952mg                224   7e-70   Erythranthe guttata [common monkey flower]
gb|AFW66128.1|  putative ribosomal protein S8e family protein           215   3e-67   
emb|CCA22399.1|  40S ribosomal protein S82 putative                     216   6e-67   Albugo laibachii Nc14
gb|KDD75705.1|  ribosomal protein S8e                                   221   7e-67   Helicosporidium sp. ATCC 50920
ref|XP_011397165.1|  40S ribosomal protein S8                           215   8e-67   Auxenochlorella protothecoides
emb|CEG02139.1|  Ribosomal protein S8e/ribosomal biogenesis NSA2        216   1e-66   Ostreococcus tauri
gb|KJB81680.1|  hypothetical protein B456_013G156600                    214   1e-66   Gossypium raimondii
gb|EPZ31448.1|  40S ribosomal protein S8-B                              215   1e-66   Rozella allomycis CSF55
ref|XP_001422585.1|  Ribosomal protein S8, component of cytosolic...    216   1e-66   Ostreococcus lucimarinus CCE9901
ref|XP_005648786.1|  40S ribosomal protein S8                           215   1e-66   Coccomyxa subellipsoidea C-169
gb|KHG09566.1|  40S ribosomal protein S8                                214   2e-66   Gossypium arboreum [tree cotton]
ref|XP_008799563.1|  PREDICTED: 40S ribosomal protein S8-like           213   2e-66   
ref|XP_005844426.1|  hypothetical protein CHLNCDRAFT_139122             214   1e-65   Chlorella variabilis
gb|KJB81681.1|  hypothetical protein B456_013G156600                    209   5e-65   Gossypium raimondii
gb|KDO22073.1|  40S ribosomal protein S8                                211   6e-65   Saprolegnia parasitica CBS 223.65
gb|AGE46026.1|  40S ribosomal protein S8                                210   7e-65   Elaeis guineensis
ref|XP_008608971.1|  40S ribosomal protein S8                           210   1e-64   Saprolegnia diclina VS20
tpg|DAA53686.1|  TPA: putative ribosomal protein S8e family protein     213   2e-64   
emb|CCI48864.1|  unnamed protein product                                209   4e-64   Albugo candida
gb|ABR25841.1|  40S ribosomal protein S8                                207   6e-64   Oryza sativa Indica Group [Indian rice]
emb|CAA03954.1|  ribosomal protein S8                                   205   8e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005539190.1|  40S ribosomal protein S8                           206   8e-63   Cyanidioschyzon merolae strain 10D
ref|XP_668115.1|  ribosomal protein S8                                  205   1e-62   Cryptosporidium hominis TU502
ref|XP_002142692.1|  40S ribosomal protein S8                           205   2e-62   Cryptosporidium muris RN66
gb|EKD00868.1|  40S ribosomal protein S8                                203   6e-62   Trichosporon asahii var. asahii CBS 8904
ref|XP_627792.1|  40S ribosomal protein S8                              203   7e-62   Cryptosporidium parvum Iowa II
ref|XP_001745896.1|  hypothetical protein                               203   1e-61   Monosiga brevicollis MX1
gb|KHG07290.1|  40S ribosomal S8                                        200   3e-61   Gossypium arboreum [tree cotton]
ref|XP_008871313.1|  40S ribosomal protein S8                           201   3e-61   Aphanomyces invadans
gb|AFW61714.1|  putative ribosomal protein S8e family protein           199   4e-61   
ref|XP_009831251.1|  40S ribosomal protein S8                           201   4e-61   Aphanomyces astaci
ref|XP_003083062.1|  RS8_MAIZE 40S ribosomal protein S8 pir||T040...    206   6e-61   
gb|KFH71035.1|  40S ribosomal protein S8                                201   6e-61   Mortierella verticillata NRRL 6337
gb|KIO10111.1|  hypothetical protein M404DRAFT_996068                   201   7e-61   Pisolithus tinctorius Marx 270
gb|EJT52835.1|  40S ribosomal protein S8                                201   7e-61   Trichosporon asahii var. asahii CBS 2479
gb|AGH70192.1|  40S ribosomal protein S8                                200   9e-61   Placozoa sp. H4
gb|KIK09143.1|  hypothetical protein K443DRAFT_447984                   200   1e-60   Laccaria amethystina LaAM-08-1
ref|XP_572078.1|  40S ribosomal protein S8                              200   2e-60   Cryptococcus neoformans var. neoformans JEC21
gb|AFR96425.1|  small subunit ribosomal protein S8e                     199   2e-60   Cryptococcus neoformans var. grubii H99
ref|XP_003195106.1|  40S ribosomal protein S8                           199   2e-60   Cryptococcus gattii WM276
gb|AAX48884.1|  S8                                                      199   3e-60   Suberites domuncula
ref|XP_002602335.1|  hypothetical protein BRAFLDRAFT_268377             199   3e-60   Branchiostoma floridae
ref|XP_001622696.1|  hypothetical protein NEMVEDRAFT_v1g195152          199   3e-60   Nematostella vectensis
gb|KGG52480.1|  40S ribosomal protein S8                                199   3e-60   Mitosporidium daphniae
gb|KGB76549.1|  40S ribosomal protein S8                                199   3e-60   Cryptococcus gattii VGII R265
gb|KIR49123.1|  ribosomal protein S8.e                                  199   3e-60   Cryptococcus gattii CA1280
ref|XP_007397269.1|  hypothetical protein PHACADRAFT_258531             199   4e-60   Phanerochaete carnosa HHB-10118-sp
ref|XP_002117056.1|  expressed hypothetical protein                     199   4e-60   Trichoplax adhaerens
gb|KIK27780.1|  hypothetical protein PISMIDRAFT_169173                  199   4e-60   Pisolithus microcarpus 441
ref|XP_007266897.1|  40S ribosomal protein S8                           198   6e-60   Fomitiporia mediterranea MF3/22
ref|XP_002158630.1|  PREDICTED: 40S ribosomal protein S8-like iso...    198   8e-60   Hydra vulgaris
gb|KIJ26939.1|  hypothetical protein M422DRAFT_76964                    198   9e-60   Sphaerobolus stellatus SS14
ref|XP_003029339.1|  40S ribosomal protein S8                           198   9e-60   Schizophyllum commune H4-8
gb|KIM64970.1|  hypothetical protein SCLCIDRAFT_1212646                 198   1e-59   Scleroderma citrinum Foug A
ref|XP_009524162.1|  hypothetical protein PHYSODRAFT_285611             197   1e-59   Phytophthora sojae
ref|XP_001880116.1|  40S ribosomal protein S8                           197   1e-59   Laccaria bicolor S238N-H82
ref|XP_007001047.1|  hypothetical protein TREMEDRAFT_55820              197   1e-59   Tremella mesenterica DSM 1558
ref|XP_008647178.1|  PREDICTED: 40S ribosomal protein S8-like           196   1e-59   
tpg|DAA53687.1|  TPA: putative ribosomal protein S8e family protein     206   1e-59   
ref|XP_007873882.1|  30S ribosomal protein S8e                          197   1e-59   
ref|XP_007311714.1|  40S ribosomal protein S8                           197   2e-59   Stereum hirsutum FP-91666 SS1
gb|EMD32142.1|  hypothetical protein CERSUDRAFT_88417                   197   2e-59   Gelatoporia subvermispora B
gb|ETL40555.1|  40S ribosomal protein S8                                196   3e-59   Phytophthora parasitica
ref|XP_005702569.1|  40S ribosomal protein S8e                          196   3e-59   Galdieria sulphuraria
ref|XP_003059699.1|  predicted protein                                  197   3e-59   
ref|XP_007843664.1|  40s ribosomal protein s8                           197   3e-59   
ref|XP_003707560.1|  PREDICTED: 40S ribosomal protein S8-like           196   3e-59   
ref|XP_003699508.1|  PREDICTED: 40S ribosomal protein S8-like           196   3e-59   
ref|XP_009547527.1|  hypothetical protein HETIRDRAFT_440490             196   4e-59   
ref|XP_007317717.1|  hypothetical protein SERLADRAFT_387784             196   4e-59   
gb|KIP11649.1|  hypothetical protein PHLGIDRAFT_27859                   196   4e-59   
ref|XP_006461206.1|  hypothetical protein AGABI2DRAFT_136253            196   5e-59   
gb|KDR75758.1|  hypothetical protein GALMADRAFT_226405                  196   5e-59   
ref|XP_009026500.1|  hypothetical protein HELRODRAFT_193555             196   6e-59   
ref|XP_003386813.1|  PREDICTED: 40S ribosomal protein S8-like           196   6e-59   
gb|EXX59183.1|  ribosomal 40S subunit protein S8B                       196   6e-59   
ref|XP_003397407.1|  PREDICTED: 40S ribosomal protein S8-like           196   6e-59   
ref|XP_007380781.1|  ribosomal protein S8e                              196   7e-59   
gb|EWM25134.1|  40s ribosomal protein s8                                196   8e-59   
gb|KDQ27658.1|  hypothetical protein PLEOSDRAFT_1089421                 195   1e-58   
ref|XP_008905363.1|  40S ribosomal protein S8                           195   1e-58   
ref|XP_002472702.1|  40S ribosomal protein S8                           195   1e-58   
gb|KIY49072.1|  hypothetical protein FISHEDRAFT_65531                   196   1e-58   
gb|ETP45024.1|  40S ribosomal protein S8                                195   1e-58   
gb|KIJ67640.1|  hypothetical protein HYDPIDRAFT_149439                  195   1e-58   
gb|AAX62461.1|  ribosomal protein S8                                    195   1e-58   
gb|AFW61715.1|  putative ribosomal protein S8e family protein           196   2e-58   
ref|XP_005783873.1|  hypothetical protein EMIHUDRAFT_442198             194   2e-58   
gb|KIL68834.1|  hypothetical protein M378DRAFT_157968                   194   2e-58   
ref|XP_005781609.1|  hypothetical protein EMIHUDRAFT_415402             194   2e-58   
ref|XP_002787865.1|  40S ribosomal protein S8, putative                 194   2e-58   
ref|XP_009039782.1|  hypothetical protein AURANDRAFT_30589              194   2e-58   
gb|EJU03954.1|  40S ribosomal protein S8                                194   2e-58   
gb|KDQ57766.1|  hypothetical protein JAAARDRAFT_35455                   194   2e-58   
ref|XP_011141954.1|  PREDICTED: 40S ribosomal protein S8                194   2e-58   
ref|XP_006561561.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     194   2e-58   
ref|XP_003690352.1|  PREDICTED: 40S ribosomal protein S8-like           194   2e-58   
ref|XP_002771622.1|  40S ribosomal protein S8, putative                 194   2e-58   
sp|Q8WQI5.1|RS8_SPOFR  RecName: Full=40S ribosomal protein S8           194   3e-58   
ref|NP_001037263.1|  ribosomal protein S8                               194   3e-58   
ref|XP_008033648.1|  40S ribosomal protein S8                           194   3e-58   
gb|KIM92086.1|  hypothetical protein PILCRDRAFT_810109                  194   4e-58   
dbj|BAN20524.1|  ribosomal protein S8                                   194   4e-58   
gb|ACY95327.1|  ribosomal protein S8                                    193   5e-58   
dbj|BAM18930.1|  ribosomal protein S8                                   193   5e-58   
gb|AAN05595.1|  ribosomal protein S8                                    193   5e-58   
emb|CBJ28525.1|  conserved unknown protein                              193   5e-58   
ref|XP_003725128.1|  PREDICTED: 40S ribosomal protein S8-like           193   6e-58   
gb|KII92951.1|  hypothetical protein PLICRDRAFT_89444                   193   6e-58   
gb|KIK45130.1|  hypothetical protein CY34DRAFT_22712                    193   6e-58   
ref|XP_007864455.1|  ribosomal protein S8e                              193   6e-58   
ref|XP_008365334.1|  PREDICTED: 40S ribosomal protein S8-like           192   7e-58   
gb|EHJ65952.1|  40S ribosomal protein S8                                196   9e-58   
gb|EPT02637.1|  hypothetical protein FOMPIDRAFT_1022771                 193   9e-58   
ref|XP_010746502.1|  PREDICTED: 40S ribosomal protein S8                192   9e-58   
gb|ABR27879.1|  40S ribosomal protein S8                                192   9e-58   
gb|KIY67149.1|  40S ribosomal protein S8                                192   9e-58   
gb|ADO27837.1|  40S ribosomal protein s8                                192   1e-57   
ref|XP_007361817.1|  ribosomal protein S8e                              192   1e-57   
dbj|BAM17705.1|  ribosomal protein S8                                   192   1e-57   
ref|NP_001011604.2|  40S ribosomal protein S8                           192   1e-57   
ref|XP_003742816.1|  PREDICTED: 40S ribosomal protein S8-like           192   1e-57   
ref|XP_003448492.1|  PREDICTED: 40S ribosomal protein S8-like           192   1e-57   
ref|XP_008550312.1|  PREDICTED: 40S ribosomal protein S8                192   2e-57   
emb|CAJ17173.1|  ribosomal protein S8e                                  192   2e-57   
gb|AAC69196.2|  40S ribosomal protein S8                                192   2e-57   
gb|ABR13294.1|  putative 40S ribosomal protein S8                       189   2e-57   
ref|XP_011167792.1|  PREDICTED: 40S ribosomal protein S8                192   2e-57   
gb|ABZ04260.1|  ribosomal protein rps8                                  192   2e-57   
gb|KDQ21918.1|  hypothetical protein BOTBODRAFT_150960                  191   3e-57   
gb|AFJ45046.1|  ribosomal protein S8                                    191   3e-57   
ref|XP_005924603.1|  PREDICTED: 40S ribosomal protein S8-like           191   3e-57   
ref|XP_005729057.1|  PREDICTED: 40S ribosomal protein S8-like           191   4e-57   
gb|EMS22797.1|  40S ribosomal protein s8                                191   4e-57   
emb|CDO76014.1|  hypothetical protein BN946_scf184665.g6                191   4e-57   
ref|XP_001955491.1|  GF18798                                            191   4e-57   
gb|AEL28852.1|  ribosomal protein S8                                    191   4e-57   
gb|ACQ57870.1|  40S ribosomal protein S8                                191   4e-57   
ref|XP_011338463.1|  PREDICTED: 40S ribosomal protein S8                191   4e-57   
ref|XP_008333134.1|  PREDICTED: 40S ribosomal protein S8                191   4e-57   
ref|XP_011258954.1|  PREDICTED: 40S ribosomal protein S8                191   4e-57   
gb|AFW73090.1|  putative ribosomal protein S8e family protein           197   5e-57   
emb|CDW77683.1|  ribosomal protein s8e family protein                   191   5e-57   
gb|AFM90620.1|  40S ribosomal protein S8                                191   5e-57   
ref|XP_007878137.1|  hypothetical protein PFL1_06854                    191   6e-57   
gb|AJG43845.1|  ribosomal protein rps8                                  191   7e-57   
ref|XP_008660669.1|  PREDICTED: 40S ribosomal protein S8-like           188   7e-57   
gb|KIW06343.1|  40S ribosomal protein S8-A                              190   7e-57   
ref|XP_002552513.1|  40S ribosomal protein S8                           190   7e-57   
tpg|DAA42540.1|  TPA: putative ribosomal protein S8e family protein     191   7e-57   
ref|XP_006881181.1|  PREDICTED: 40S ribosomal protein S8-like           190   8e-57   
ref|XP_011059444.1|  PREDICTED: 40S ribosomal protein S8                190   8e-57   
ref|NP_651740.1|  ribosomal protein S8, isoform C                       190   8e-57   
ref|NP_001128155.1|  40S ribosomal protein S8                           190   9e-57   
gb|EMG50668.1|  Ribosomal protein S8                                    190   9e-57   
gb|ADT80672.1|  ribosomal protein S8                                    190   9e-57   
gb|KIM40224.1|  hypothetical protein M413DRAFT_446389                   190   1e-56   
gb|EJY84320.1|  40S ribosomal protein S8-2                              190   1e-56   
emb|CEG73596.1|  Putative 40S ribosomal protein S8                      189   1e-56   
ref|XP_003975488.1|  PREDICTED: 40S ribosomal protein S8-like           190   1e-56   
dbj|BAF45896.1|  ribosomal protein S8                                   190   1e-56   
gb|AAV84252.1|  ribosomal protein S8                                    190   1e-56   
emb|CCO29805.1|  40S ribosomal protein S8-A AltName: Full=RP19          189   2e-56   
emb|CEG65019.1|  Putative 40S ribosomal protein S8                      189   2e-56   
ref|XP_765516.1|  40S ribosomal protein S8e                             189   2e-56   
ref|XP_006675830.1|  hypothetical protein BATDEDRAFT_36328              189   2e-56   
emb|CCQ18591.1|  40S ribosomal protein S8                               189   2e-56   
ref|XP_002000771.1|  GI10411                                            189   2e-56   
ref|XP_002505425.1|  predicted protein                                  189   2e-56   
gb|EFX81462.1|  hypothetical protein DAPPUDRAFT_303431                  189   2e-56   
ref|NP_001187073.1|  40S ribosomal protein S8                           189   2e-56   
gb|ADQ00177.1|  40S ribosomal protein S8                                188   2e-56   
gb|AFW85401.1|  putative ribosomal protein S8e family protein           189   2e-56   
gb|AEE62947.1|  unknown                                                 189   2e-56   
ref|NP_593100.1|  40S ribosomal protein S8                              189   2e-56   
ref|XP_005815191.1|  PREDICTED: 40S ribosomal protein S8-like iso...    189   2e-56   
ref|XP_001487630.1|  hypothetical protein PGUG_01007                    189   2e-56   
gb|ESW98222.1|  40S ribosomal protein S8-A                              189   2e-56   
ref|XP_001830182.1|  40S ribosomal protein S8                           189   2e-56   
emb|CDS03736.1|  hypothetical protein LRAMOSA01137                      189   2e-56   
emb|CAH57693.1|  40S ribosomal protein S8                               189   2e-56   
emb|CDS12850.1|  hypothetical protein LRAMOSA05034                      189   3e-56   
ref|XP_002098521.1|  GE23892                                            189   3e-56   
emb|CEP60259.1|  LALA0S01e06612g1_1                                     188   3e-56   
gb|ABV60330.1|  40S ribosomal protein S8-like protein                   189   3e-56   
ref|NP_594519.1|  40S ribosomal protein S8                              188   4e-56   
dbj|BAD26659.1|  Ribosomal protein S8                                   189   4e-56   
ref|XP_002129681.1|  PREDICTED: 40S ribosomal protein S8                189   4e-56   
ref|XP_005303088.1|  PREDICTED: 40S ribosomal protein S8                189   4e-56   
ref|XP_004995866.1|  40S ribosomal protein S8                           188   4e-56   
emb|CDH48276.1|  40s ribosomal protein s8                               188   4e-56   
ref|XP_011123171.1|  hypothetical protein AOL_s00081g50                 188   4e-56   
emb|CEL58813.1|  40S ribosomal protein S8-B OS=Saccharomyces cere...    189   5e-56   
ref|XP_007567486.1|  PREDICTED: 40S ribosomal protein S8                188   5e-56   
ref|XP_006114784.1|  PREDICTED: 40S ribosomal protein S8                188   6e-56   
ref|XP_002908634.1|  40S ribosomal protein S8-2                         188   6e-56   
ref|XP_003107910.1|  CRE-RPS-8 protein                                  188   6e-56   
ref|XP_004678985.1|  PREDICTED: 40S ribosomal protein S8                188   6e-56   
ref|XP_008290025.1|  PREDICTED: 40S ribosomal protein S8                188   6e-56   
gb|EJT41679.1|  hypothetical protein SKUD_188904                        187   6e-56   
gb|EHN03767.1|  Rps8bp                                                  187   6e-56   
gb|AAT08014.1|  putative 40S ribosomal protein S8                       189   6e-56   
gb|ABM55665.1|  putative ribosomal protein S8e                          188   6e-56   
ref|XP_011102403.1|  rps8ap                                             187   7e-56   
gb|KIM21886.1|  hypothetical protein M408DRAFT_333202                   188   7e-56   
ref|XP_011107810.1|  hypothetical protein H072_1819                     187   7e-56   
ref|XP_009227358.1|  40S ribosomal protein S8                           187   7e-56   
gb|ABX44780.1|  putative 40S ribosomal protein RPS8                     188   8e-56   
gb|EFN82821.1|  40S ribosomal protein S8                                187   8e-56   
gb|KDE09590.1|  40S ribosomal protein S8                                188   8e-56   
ref|NP_001239055.1|  40S ribosomal protein S8                           187   9e-56   
ref|XP_006273333.1|  PREDICTED: 40S ribosomal protein S8                187   1e-55   
ref|XP_008107755.1|  PREDICTED: 40S ribosomal protein S8                187   1e-55   
gb|ETN60870.1|  40S ribosomal protein S8                                187   1e-55   
ref|XP_001376099.1|  PREDICTED: 40S ribosomal protein S8                187   1e-55   
ref|XP_004197370.1|  Piso0_004620                                       187   1e-55   
ref|XP_005717008.1|  40S ribosomal protein S8                           187   1e-55   
ref|XP_002073028.1|  GK13918                                            187   1e-55   
ref|XP_002055878.1|  GJ10625                                            187   1e-55   
gb|ABY87394.1|  ribosomal protein S8                                    187   1e-55   
ref|XP_001357651.1|  GA20600                                            187   1e-55   
ref|XP_011181207.1|  PREDICTED: 40S ribosomal protein S8                187   1e-55   
ref|XP_002175151.1|  40S ribosomal protein S8                           187   1e-55   
gb|ACH44382.1|  putative 40S ribosomal protein S8                       187   1e-55   
ref|NP_001232282.1|  putative 40S ribosomal protein S8                  187   2e-55   
gb|EPX70812.1|  40S ribosomal protein S8                                187   2e-55   
ref|XP_001604111.1|  PREDICTED: 40S ribosomal protein S8                187   2e-55   
ref|XP_006634805.1|  PREDICTED: 40S ribosomal protein S8-like           187   2e-55   
ref|XP_005856295.1|  small subunit ribosomal protein S8e                186   2e-55   
gb|KIK67276.1|  hypothetical protein GYMLUDRAFT_861869                  187   2e-55   
gb|KJA28980.1|  hypothetical protein HYPSUDRAFT_155175                  187   2e-55   
gb|EYB94089.1|  hypothetical protein Y032_0175g487                      187   2e-55   
gb|AFM88001.1|  40S ribosomal protein S8                                187   2e-55   
emb|CAH04320.1|  S8e ribosomal protein                                  187   2e-55   
emb|CDH55703.1|  40s ribosomal protein s8                               187   2e-55   
gb|EHH14717.1|  hypothetical protein EGK_00685                          187   2e-55   
gb|EHN02771.1|  Rps8bp                                                  186   2e-55   
ref|XP_004536550.1|  PREDICTED: 40S ribosomal protein S8-like           187   2e-55   
ref|XP_002173241.1|  40S ribosomal protein S8                           186   2e-55   
ref|XP_004343838.1|  40S ribosomal protein S8                           187   2e-55   
ref|XP_007766704.1|  40S ribosomal protein S8                           187   2e-55   
ref|XP_001996113.1|  GH14312                                            186   2e-55   
gb|AFJ45055.1|  ribosomal protein S8                                    186   2e-55   
ref|XP_007374865.1|  hypothetical protein SPAPADRAFT_60688              186   2e-55   
ref|XP_951769.1|  40S ribosomal protein S8                              186   2e-55   
ref|XP_004078646.1|  PREDICTED: 40S ribosomal protein S8                186   2e-55   
gb|ETN68840.1|  ribosomal protein S8.e                                  186   3e-55   
ref|XP_967339.1|  PREDICTED: 40S ribosomal protein S8                   186   3e-55   
gb|KIK98345.1|  hypothetical protein PAXRUDRAFT_823950                  186   3e-55   
gb|KIJ19037.1|  hypothetical protein PAXINDRAFT_166933                  186   3e-55   
emb|CDI77661.1|  40S ribosomal protein S8, putative                     186   3e-55   
ref|XP_002618871.1|  hypothetical protein CLUG_00030                    186   3e-55   
emb|CAJ17178.1|  ribosomal protein S8e                                  186   3e-55   
emb|CAJ17175.1|  ribosomal protein S8e                                  186   3e-55   
gb|ADX97198.1|  40S ribosomal protein s8                                186   3e-55   
ref|XP_002547240.1|  40S ribosomal protein S8                           186   3e-55   
gb|AFJ45047.1|  ribosomal protein S8                                    185   4e-55   
ref|XP_004555428.1|  PREDICTED: 40S ribosomal protein S8-like           188   4e-55   
gb|EFX06643.1|  40S ribosomal protein s8e                               186   4e-55   
gb|AFJ45049.1|  ribosomal protein S8                                    185   4e-55   
ref|XP_009691025.1|  40S ribosomal protein S8                           185   4e-55   
gb|AFJ45051.1|  ribosomal protein S8                                    185   4e-55   
gb|EPY51976.1|  40S ribosomal protein S8                                186   4e-55   
gb|KDR14766.1|  40S ribosomal protein S8                                186   5e-55   
ref|XP_011444203.1|  PREDICTED: 40S ribosomal protein S8-like           186   5e-55   
emb|CDR38460.1|  CYFA0S02e01926g1_1                                     185   5e-55   
ref|XP_007061727.1|  PREDICTED: 40S ribosomal protein S8                186   5e-55   
ref|XP_008432867.1|  PREDICTED: 40S ribosomal protein S8                186   5e-55   
ref|XP_009863870.1|  PREDICTED: 40S ribosomal protein S8                186   5e-55   
emb|CAD91426.1|  ribosomal protein S8                                   186   5e-55   
ref|XP_010714500.1|  PREDICTED: 40S ribosomal protein S8                187   5e-55   
ref|XP_007355914.1|  40S ribosomal protein S8                           186   5e-55   
gb|AFJ45048.1|  ribosomal protein S8                                    185   6e-55   
ref|XP_003676688.1|  hypothetical protein NCAS_0E02590                  185   6e-55   
ref|XP_009637143.1|  PREDICTED: 40S ribosomal protein S8                186   6e-55   
ref|XP_002633134.1|  C. briggsae CBR-RPS-8 protein                      185   6e-55   
gb|AFM89547.1|  40S ribosomal protein S8                                186   6e-55   
ref|NP_009481.1|  ribosomal 40S subunit protein S8A                     185   6e-55   
gb|AJQ07966.1|  Rps8ap                                                  185   6e-55   
ref|XP_001893693.1|  40S ribosomal protein S8                           185   6e-55   
gb|AFM90684.1|  40S ribosomal protein S8                                185   7e-55   
ref|NP_001279579.1|  ribosomal protein S8                               185   7e-55   
gb|AFW85400.1|  putative ribosomal protein S8e family protein           191   7e-55   
dbj|BAH70813.1|  ACYPI001578                                            185   7e-55   
gb|AJP85760.1|  Rps8ap                                                  185   7e-55   



>gb|KHG08050.1| 40S ribosomal S8 [Gossypium arboreum]
Length=218

 Score =   280 bits (717),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKKAAA  +   E    A EE KKSNHV RKLEKRQ+ RKLDSH+EEQFGSGRL+A
Sbjct  121  DIGRKKKAAAAAKKEGEEGETATEEVKKSNHVLRKLEKRQQSRKLDSHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  181  CISSRPGQCGRADGYILE  198



>ref|XP_007146564.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
 gb|ESW18558.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
Length=218

 Score =   280 bits (716),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK  A  +   E    A EE KKSNHV RKLEKR++ R LDSH+EEQFG GRL+A
Sbjct  121  DIGRKKKIVASAKKEGEDGEAATEEVKKSNHVLRKLEKRKQSRVLDSHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR+DGYILE
Sbjct  181  CISSRPGQCGRSDGYILE  198



>ref|XP_006373483.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51280.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=220

 Score =   278 bits (711),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKKA  KKET E+      EETKKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKAVVKKETPEQEGEATTEETKKSNHVIRKLEKRQQVRKLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  SISSRPGQCGRADGYILE  198



>ref|XP_011021175.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Populus euphratica]
Length=218

 Score =   278 bits (710),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKKA  KKET E+      EETKKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKAVVKKETPEQEGEATTEETKKSNHVIRKLEKRQQGRKLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  SISSRPGQCGRADGYILE  198



>ref|NP_001105391.1| 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679873.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679875.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679877.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Zea mays]
 sp|Q08069.2|RS8_MAIZE RecName: Full=40S ribosomal protein S8 [Zea mays]
 gb|AAB06330.1| ribosomal protein S8 [Zea mays]
 gb|ACF80433.1| unknown [Zea mays]
 gb|ACG24637.1| 40S ribosomal protein S8 [Zea mays]
 gb|AFW66125.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66129.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66130.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66138.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66142.1| putative ribosomal protein S8e family protein [Zea mays]
Length=221

 Score =   278 bits (710),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakke--taeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK  A K+     +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL
Sbjct  121  DIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_011008256.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
 ref|XP_011015899.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=220

 Score =   277 bits (709),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK A   +   E    A EE KKSNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKTAPAAKKEGEDGEAAVEEEKKSNHVQRKLEKRQQTRKLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  SISSRPGQCGRADGYILE  198



>gb|KJB62959.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=218

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKKAAA  +   E    A EE KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKAAAGAKKEGEEGETATEEVKKSSHVLRKLEKRQQSRTLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  181  CISSRPGQCGRADGYILE  198



>gb|KHG04827.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  A K+ A E   VA EETKKSNHVQRK EKRQKER LD+H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKTAAKKEATEEGEVAVEETKKSNHVQRKHEKRQKERTLDAHIEEQFGSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>gb|KJB84080.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=219

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  A K+ A E   VAAEETKKSNHV RKLEKRQKER LD+H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKTAAKKEATEDGEVAAEETKKSNHVLRKLEKRQKERTLDAHIEEQFGSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_010252680.1| PREDICTED: 40S ribosomal protein S8 [Nelumbo nucifera]
Length=220

 Score =   276 bits (706),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK++A  +   E      EE KKSNHV RKLEKRQ+  KLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKSSASAKKEGEDGEATTEEAKKSNHVLRKLEKRQQGHKLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  AISSRPGQCGRADGYILE  198



>ref|XP_006437243.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
 gb|ESR50483.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
Length=223

 Score =   276 bits (705),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 188/200 (94%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketa--eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKKA  KKET    E+   AAEETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL
Sbjct  121  DIGRKKKAVTKKETTEEGESAAAAAEETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_010483522.1| PREDICTED: 40S ribosomal protein S8-2-like [Camelina sativa]
Length=220

 Score =   276 bits (705),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKKAAA K+  EE + VA E+ KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+A
Sbjct  121  DIGRKKKAAASKKEGEEGDAVATEDVKKSNHVQRKLEIRQEGRALDSHLEEQFSSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  181  CISSRPGQCGRADGYILE  198



>ref|NP_001046866.1| Os02g0489400 [Oryza sativa Japonica Group]
 sp|P49199.2|RS8_ORYSJ RecName: Full=40S ribosomal protein S8 [Oryza sativa Japonica 
Group]
 pdb|3J60|I Chain I, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD21871.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAD21876.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAF08780.1| Os02g0489400 [Oryza sativa Japonica Group]
 dbj|BAG95703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73196.1| hypothetical protein OsI_07259 [Oryza sativa Indica Group]
 gb|EEE57012.1| hypothetical protein OsJ_06781 [Oryza sativa Japonica Group]
Length=220

 Score =   275 bits (704),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKKA A K+ AE +      EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL+
Sbjct  121  DIGRKKKAPAAKKDAEGQDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_002446216.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
 gb|EES10544.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
Length=220

 Score =   275 bits (704),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKK   AKK+ AE +     AEETKKSNHVQRKLEKRQ+ R LD+H+EEQFGSGRL+
Sbjct  121  DIGRKKVPVAKKDAAEGQEGEAIAEETKKSNHVQRKLEKRQQGRALDTHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_007049644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOX93801.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=219

 Score =   275 bits (703),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  A K+ A E     AEETKKSNHV RKLEKRQK+RKLD+H+EEQFG+GRL+A
Sbjct  121  DIGR-KKKTAAKKEATEEGEGVAEETKKSNHVVRKLEKRQKDRKLDAHIEEQFGAGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_010060252.1| PREDICTED: 40S ribosomal protein S8 [Eucalyptus grandis]
 gb|KCW66870.1| hypothetical protein EUGRSUZ_F00627 [Eucalyptus grandis]
Length=219

 Score =   275 bits (703),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK  A  +   E     AEE KKS+HV RKLEKRQ ERKLD H+EEQF SGRL+A
Sbjct  121  DIGRKKKNQASAKKEGEEAEAPAEEVKKSSHVLRKLEKRQTERKLDQHIEEQFSSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  SISSRPGQCGRADGYILE  198



>gb|KDP39216.1| hypothetical protein JCGZ_00973 [Jatropha curcas]
Length=219

 Score =   275 bits (703),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  A  +   E    A EE KKSNHV RKLEKRQ+ RKLD H+EEQF  GRLMA
Sbjct  121  DIGR-KKKVAATKKEGEEGEGATEEVKKSNHVLRKLEKRQQTRKLDPHIEEQFAGGRLMA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|NP_001052526.1| Os04g0349500 [Oryza sativa Japonica Group]
 emb|CAE05511.1| OSJNBa0038P21.4 [Oryza sativa Japonica Group]
 dbj|BAF14440.1| Os04g0349500 [Oryza sativa Japonica Group]
 gb|EAZ30323.1| hypothetical protein OsJ_14370 [Oryza sativa Japonica Group]
 dbj|BAG90858.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   275 bits (703),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKKA A K+ A   +    A EE KKSNHV RKLEKRQ+ R LDSH+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKDAAEGQEGEAATEEAKKSNHVVRKLEKRQQTRTLDSHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>gb|KDP45274.1| hypothetical protein JCGZ_15139 [Jatropha curcas]
Length=221

 Score =   275 bits (703),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 188/201 (94%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaee---tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            DIGRKKK  AKKET EE        AEE KKSNHVQRKLEKRQK+RKLD H+EEQFG+GR
Sbjct  121  DIGRKKKTVAKKETTEEGDAAAPATAEEAKKSNHVQRKLEKRQKDRKLDPHIEEQFGAGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACISSRPGQCGRADGYILE
Sbjct  181  LLACISSRPGQCGRADGYILE  201



>ref|XP_007134162.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
 gb|ESW06156.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
Length=218

 Score =   275 bits (703),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGL  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK AAKK++AEE +  AAEE KKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+A
Sbjct  121  DIGRKKKTAAKKDSAEEGDAAAAEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGYILE
Sbjct  181  CISSRPGQCGRCDGYILE  198



>gb|KDO36309.1| hypothetical protein CISIN_1g045444mg, partial [Citrus sinensis]
 gb|KDO60870.1| hypothetical protein CISIN_1g044642mg, partial [Citrus sinensis]
Length=217

 Score =   275 bits (702),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 181/200 (91%), Positives = 185/200 (93%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakk--etaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKKA  KK      E    AAEETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL
Sbjct  121  DIGRKKKAVTKKETTEEGEGAAAAAEETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_006452497.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
 ref|XP_006474961.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
 gb|ESR65737.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
Length=223

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 186/201 (93%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketa---eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            DIGRKKKAAA   T    EE E  A EE KKSNHV RKLEKRQK+R LD H+EEQFGSGR
Sbjct  121  DIGRKKKAAAAATTKKEGEEGEAPATEEAKKSNHVSRKLEKRQKDRTLDPHIEEQFGSGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACI+SRPGQCGRADGYILE
Sbjct  181  LLACIASRPGQCGRADGYILE  201



>ref|XP_006484807.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
Length=223

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 181/200 (91%), Positives = 185/200 (93%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakk--etaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKKA  KK      E    AAEETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL
Sbjct  121  DIGRKKKAVTKKETTEEGEGAAAAAEETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|NP_001132384.1| uncharacterized protein LOC100193830 [Zea mays]
 gb|ACF81204.1| unknown [Zea mays]
Length=221

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 185/200 (93%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK   A K  T  +     AEETKKSNHVQRK+EKRQ++R LD+H+EEQFGSGRL
Sbjct  121  DIGRKKKVPVAKKDATEGQEGEAIAEETKKSNHVQRKIEKRQQDRALDTHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACIS+RPGQCGRADGYILE
Sbjct  181  LACISARPGQCGRADGYILE  200



>ref|XP_004510234.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=217

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK  A K+ A E      EE KKSNHVQRKLE RQKER+LDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKTASKKDAPEEAEAVTEEAKKSNHVQRKLETRQKERQLDSHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_009778867.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=223

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkk-aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK A+ K+ T E       EE KKSNHV RKLEKRQK+RKLD HLEEQFGSGRL 
Sbjct  121  DIGRKKKGASKKETTEEGEAAAPVEEAKKSNHVARKLEKRQKDRKLDPHLEEQFGSGRLY  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|KJB22170.1| hypothetical protein B456_004G033000 [Gossypium raimondii]
Length=216

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 177/198 (89%), Gaps = 2/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR  K     +   E      EE KKSNHV RK+EKRQ+ RKLD H+E+QF SGRL+A
Sbjct  121  DIGR--KKKTAAKKEGEEGETGTEEVKKSNHVLRKMEKRQQNRKLDPHIEDQFASGRLLA  178

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  179  CISSRPGQCGRADGYILE  196



>dbj|BAA07207.1| ribosomal protein S8 [Oryza sativa Japonica Group]
Length=220

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakket-aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK          +      EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL+
Sbjct  121  DIGRKKKEPPHPRGCCGQDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_004242427.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=220

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeet-egvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK AA K+   E  +G A EETKKSNHV RK+EKRQ ERKLDSHLEEQF SGRL 
Sbjct  121  DIGRKKKGAAAKKETAEEGDGAATEETKKSNHVLRKIEKRQAERKLDSHLEEQFSSGRLY  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|EAY93669.1| hypothetical protein OsI_15456 [Oryza sativa Indica Group]
Length=221

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKKA A K+ A   +    A EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKDAAEGQEGEAATEEAKKSNHVVRKLEKRQQTRTLDAHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>gb|KJB13805.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
 gb|KJB13807.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=219

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            D+GRKKK  A     + E     AEE KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+
Sbjct  121  DLGRKKKTLAAATKKDGEEGETVAEEAKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|KHM99496.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            ++GRKKK+AA     E E    A EE KKSNHV RKLEKR++ R LD H+EEQFG GRL+
Sbjct  121  EVGRKKKSAAASVKKEGEDGEAATEEVKKSNHVVRKLEKRKQNRVLDPHIEEQFGGGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_003532158.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
Length=219

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            ++GRKKK+AA     E E    A EE KKSNHV RKLEKR++ R LD H+EEQFG GRL+
Sbjct  121  EVGRKKKSAAASVKKEGEDGEAATEEVKKSNHVVRKLEKRKQNRVLDPHIEEQFGGGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|KHG18510.1| 40S ribosomal S8 [Gossypium arboreum]
Length=216

 Score =   273 bits (699),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 177/198 (89%), Gaps = 2/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR  K     +   E      EE KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+A
Sbjct  121  DIGR--KKKTAAKKEGEEGETGTEEVKKSNHVLRKLEKRQQNRKLDPHIEDQFASGRLLA  178

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  179  CISSRPGQCGRADGYILE  196



>ref|XP_008679872.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=301

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  81   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  140

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  141  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  200

Query  398  DIGRkkkaaakke--taeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK  A K+     +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL
Sbjct  201  DIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRL  260

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  261  LACISSRPGQCGRADGYILE  280



>ref|XP_008657369.1| PREDICTED: uncharacterized protein LOC100193830 isoform X1 [Zea 
mays]
Length=223

 Score =   273 bits (699),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 185/200 (93%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK   A K  T  +     AEETKKSNHVQRK+EKRQ++R LD+H+EEQFGSGRL
Sbjct  121  DIGRKKKVPVAKKDATEGQEGEAIAEETKKSNHVQRKIEKRQQDRALDTHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACIS+RPGQCGRADGYILE
Sbjct  181  LACISARPGQCGRADGYILE  200



>ref|XP_002269042.2| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
 emb|CAN64937.1| hypothetical protein VITISV_011515 [Vitis vinifera]
Length=221

 Score =   273 bits (699),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK  AKKET EE EG A EETKKSNHV RKLEKRQ++ +LD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKTTAKKETTEEGEGGATEETKKSNHVLRKLEKRQQDHRLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  SISSRPGQCGRADGYILE  198



>ref|XP_008222788.1| PREDICTED: 40S ribosomal protein S8 [Prunus mume]
Length=221

 Score =   273 bits (698),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGRKKK AA K+   E      EE KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+A
Sbjct  121  EIGRKKKTAAAKKDTPEEGEATTEEAKKSNHVARKLEKRQQGRTLDAHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  181  CISSRPGQCGRADGYILE  198



>ref|XP_002299926.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92677.1| unknown [Populus trichocarpa]
 gb|EEE84731.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=220

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK A   +   E    A EE KKS HVQRKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKTAPAAKKEGEDGEAAVEEEKKSKHVQRKLEKRQQTRKLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  SISSRPGQCGRADGYILE  198



>ref|XP_009373606.1| PREDICTED: 40S ribosomal protein S8 [Pyrus x bretschneideri]
Length=221

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGRKKK+A  K+   E      EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGRKKKSAVAKKDTPEEGEGTTEEAKKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGYILE
Sbjct  181  CISSRPGQCGRCDGYILE  198



>ref|XP_010454644.1| PREDICTED: 40S ribosomal protein S8-2 [Camelina sativa]
Length=218

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 179/198 (90%), Gaps = 2/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR  K  A     +E + VA EE KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+A
Sbjct  121  DIGR--KKKAAAAATKEGDAVATEEVKKSNHVQRKLETRQEGRALDSHLEEQFSSGRLLA  178

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  179  CISSRPGQCGRADGYILE  196



>ref|XP_009349000.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGRKKK+ A K+   +      EE +KSNHV RK EKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGRKKKSGAAKKDNPDEGEGTTEEARKSNHVTRKREKRQEGRTLDPHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGY+LE
Sbjct  181  CISSRPGQCGRCDGYVLE  198



>ref|XP_009378162.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGRKKK+ A K+   +      EE +KSNHV RKLEKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGRKKKSGAAKKDTPDEGEGTTEEARKSNHVTRKLEKRQEGRTLDPHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGY+LE
Sbjct  181  CISSRPGQCGRCDGYVLE  198



>gb|KJB81679.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=217

 Score =   273 bits (697),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK +A  +   E    A EE KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKSAAAKKEGEEGETATEEVKKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_004492266.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=218

 Score =   273 bits (697),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGRKKK+AA K+ + E    A EE KKSNHVQRKLE RQK+R+LDSH+EEQFG GRL+A
Sbjct  121  EIGRKKKSAAAKKDSVEEVEAATEEAKKSNHVQRKLENRQKDRQLDSHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  181  CISSRPGQCGRADGYILE  198



>ref|XP_002452585.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
 gb|EES05561.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
Length=221

 Score =   273 bits (697),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGR--kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGR  K  AA K+    +    AAEE KKSNHV+RKLEKRQ+ R+LD+H+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKEAAEGQEGEAAAEEAKKSNHVKRKLEKRQEGRELDAHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>gb|KCW58021.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=221

 Score =   273 bits (697),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKKAAA K+ A E E   AEE KKS HV RKLEKRQK+R+LD+H+EEQFGSGRL+A
Sbjct  121  DIGRKKKAAAAKKEATEGEAAPAEEAKKSAHVLRKLEKRQKDRQLDAHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR+DGYILE
Sbjct  181  CISSRPGQCGRSDGYILE  198



>ref|XP_008466734.1| PREDICTED: 40S ribosomal protein S8-2 [Cucumis melo]
Length=220

 Score =   273 bits (697),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK AA  +  EE +  AAEE KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRLMA
Sbjct  121  DIGRKKKTAASTKKDEEGDAAAAEEVKKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRLMA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  181  CISSRPGQCGRADGYILE  198



>gb|AFK40150.1| unknown [Lotus japonicus]
Length=217

 Score =   272 bits (696),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSE VTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK  A K+ + E     AE+TKKSNHVQRKLE RQK+R LDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKTAAKKDSTEEGEAVAEDTKKSNHVQRKLENRQKDRTLDSHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>gb|KHF98591.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSVHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            D+GRKKK  A     E E     AEE KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+
Sbjct  121  DLGRKKKTPAAATKKEGEEGETVAEEAKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_004953910.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakke--taeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKKA A K+     +    AAEETKKSNHVQRKLEKR+  R LD H+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKDGAEGQEGEAAAEETKKSNHVQRKLEKRKDGRALDPHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACI+SRPGQCGRADGYILE
Sbjct  181  LACIASRPGQCGRADGYILE  200



>ref|XP_008778380.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=222

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaa-kketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGRKKKA A  K+ A E    A EE KKSNHV RKL+KRQ+ RKLD H+EEQFGSGRL+
Sbjct  121  EIGRKKKAPAGTKKEATEEGEGATEEAKKSNHVLRKLDKRQQGRKLDPHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|KJB84081.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=259

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 186/197 (94%), Gaps = 1/197 (1%)
 Frame = +2

Query  41   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  220
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL
Sbjct  42   GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  101

Query  221  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  400
            DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD
Sbjct  102  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  161

Query  401  IGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMAC  580
            IGR KK  A K+ A E   VAAEETKKSNHV RKLEKRQKER LD+H+EEQFGSGRL+AC
Sbjct  162  IGR-KKKTAAKKEATEDGEVAAEETKKSNHVLRKLEKRQKERTLDAHIEEQFGSGRLLAC  220

Query  581  ISSRPGQCGRADGYILE  631
            ISSRPGQCGRADGYILE
Sbjct  221  ISSRPGQCGRADGYILE  237



>ref|XP_002275094.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=219

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGL  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKKA+A  +   E     AEETKKSNHV RKLEKRQ+E KLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKASATAKKEGEEGDGPAEETKKSNHVVRKLEKRQQEHKLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  AISSRPGQCGRADGYILE  198



>ref|XP_004148331.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 ref|XP_004162922.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN61144.1| hypothetical protein Csa_2G059750 [Cucumis sativus]
Length=219

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  +     EE      EE KKSNHVQRK+EKRQ++RKLD H+EEQF SGRLMA
Sbjct  121  DIGR-KKKTSASVKKEEEGDAGTEEVKKSNHVQRKIEKRQQDRKLDPHIEEQFSSGRLMA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_006281069.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
 gb|EOA13967.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
Length=220

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKKWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSE VTRKTRILDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKKAAA K+  E  + V  EE KKSNHVQRKLE RQ++R +DSHLEEQF SGRL+A
Sbjct  121  DIGRKKKAAATKKEGEGGDAVTTEEVKKSNHVQRKLEMRQEDRAIDSHLEEQFSSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGRADGYILE
Sbjct  181  CIASRPGQCGRADGYILE  198



>gb|AFK37035.1| unknown [Lotus japonicus]
Length=218

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSE VTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            D+GRKKK A   +   E    A EE KKSNHV RKLEKR + R LD+H+EEQFG GRL+A
Sbjct  121  DLGRKKKGATAAKKEGEDVETATEEAKKSNHVLRKLEKRTENRTLDAHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR+DGYILE
Sbjct  181  CISSRPGQCGRSDGYILE  198



>ref|XP_008792950.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=222

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 186/200 (93%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY+QHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYIQHYGV  120

Query  398  DIGRkkkaaakketaeeteg--vaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            +IGRKKK  A K+ A E +    AAEE KKS+HV RKLEKRQ+ R+LD H+EEQFGSGRL
Sbjct  121  EIGRKKKTPAAKKEATEGQEGDGAAEEVKKSSHVLRKLEKRQQGRQLDPHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_006601753.1| PREDICTED: uncharacterized protein LOC100500112 isoform X1 [Glycine 
max]
 gb|KHN21285.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVK+AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK  A K+ + E    AAEETKKSNHVQRKLEKRQK+RKLDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKVASKKDSTEEGEAAAEETKKSNHVQRKLEKRQKDRKLDSHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>gb|KHN25148.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGR KK AA K+   E    VA EE KKSNH+QRKLEKRQK+RKLD+H+EEQFGSGRL+
Sbjct  121  EIGRKKKTAAKKETAEEGAAAVAVEEAKKSNHLQRKLEKRQKDRKLDAHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|KJB22659.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=219

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRR+TGGK+KAWRKKRKYELGRQP NTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKYELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSE+VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGI  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  A K+ A E    AAEETK+S HV RKLEKRQK+RKLD H+EEQFG GRL+A
Sbjct  121  DIGR-KKKMASKKEATEEPEGAAEETKRSKHVARKLEKRQKDRKLDPHVEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_004975334.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKKA A K+ A   +     AEETKKSNHV RKLEKR+  R+LD H+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKDAAEGQEGEAVAEETKKSNHVTRKLEKRKVGRQLDPHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACI+SRPGQCGRADGYILE
Sbjct  181  LACIASRPGQCGRADGYILE  200



>ref|NP_001240243.1| uncharacterized protein LOC100813170 [Glycine max]
 gb|ACU18370.1| unknown [Glycine max]
 gb|KHN10948.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK  A K+ + E    AAEETKKSNHVQRKLEKRQK+R LDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKVAAKKDSTEEGEAAAEETKKSNHVQRKLEKRQKDRNLDSHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_010693327.1| PREDICTED: 40S ribosomal protein S8-like [Beta vulgaris subsp. 
vulgaris]
Length=217

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            D+GR KK AA     E  EG   EE KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+A
Sbjct  121  DVGR-KKKAAAAAKKETEEGETTEEAKKSNHVARKLEKRQQNRTLDAHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>gb|AFK33351.1| unknown [Lotus japonicus]
Length=218

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWR+KRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRRKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSE VTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            D+GRKKK A   +   E      EE KKSNHV RKLEKR + R LD+H+EEQFG GRL+A
Sbjct  121  DLGRKKKGATAAKKEGEDVETVTEEAKKSNHVLRKLEKRTENRTLDAHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR+DGYILE
Sbjct  181  CISSRPGQCGRSDGYILE  198



>ref|XP_007020644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 ref|XP_007020645.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12169.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12170.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=220

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK AA     E  E   +A EE KKS HV RKLEKRQ  RKLDSH+EEQFGSGRL
Sbjct  121  DIGRKKKTAAAAAKKEGGEDGEIATEEVKKSGHVLRKLEKRQLNRKLDSHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_006373482.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51279.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=219

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK A  K+   E      EETKKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKAVVKKETPEEGEATTEETKKSNHVIRKLEKRQQVRKLDPHIEEQFGSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  180  SISSRPGQCGRADGYILE  197



>ref|XP_008337490.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=221

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR+KK+A  K+   E      EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGRRKKSAVAKKDTPEEGEGTTEEAKKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGYILE
Sbjct  181  CISSRPGQCGRCDGYILE  198



>gb|ACJ86093.1| unknown [Medicago truncatula]
 gb|AFK33939.1| unknown [Medicago truncatula]
 gb|KEH22555.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=217

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++GR KK  A K+ + E   V AEE KKS+HVQRKLE+RQK+R+LDSH+EEQFG GRL+A
Sbjct  121  EVGR-KKKTAAKKDSAEEAEVVAEEVKKSSHVQRKLEQRQKDRQLDSHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_011021176.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Populus euphratica]
Length=217

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK A  K+   E      EETKKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKAVVKKETPEEGEATTEETKKSNHVIRKLEKRQQGRKLDPHIEEQFGSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  180  SISSRPGQCGRADGYILE  197



>ref|XP_010913108.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Elaeis guineensis]
Length=224

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 182/201 (91%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegv---aaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            +IGRKKKA A  +           A EE KKSNHV RKLEKRQ+ RKLD H+EEQFGSGR
Sbjct  121  EIGRKKKAPAATKKEATEGQEGEGATEEPKKSNHVLRKLEKRQQGRKLDPHIEEQFGSGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACISSRPGQCGRADGYILE
Sbjct  181  LLACISSRPGQCGRADGYILE  201



>ref|XP_009416597.1| PREDICTED: 40S ribosomal protein S8 [Musa acuminata subsp. malaccensis]
Length=223

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDHGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            +IGRKKKA A K+ A   +    A EE  KSNHV RKLEKRQ+ RKLD+H+EEQF SGRL
Sbjct  121  EIGRKKKAPAVKKEATEGQEAEPATEEANKSNHVTRKLEKRQQGRKLDAHIEEQFSSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGY+LE
Sbjct  181  LACISSRPGQCGRADGYVLE  200



>ref|XP_011025495.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=219

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeet-kkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK  A  +   E    AA E  K+SNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+
Sbjct  121  DIGRKKKTTAASKKEGEEGEAAATEEVKQSNHVQRKLEKRQQTRKLDPHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  181  ASISSRPGQCGRADGYILE  199



>ref|XP_009406344.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDHGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGRKKKA + K+ A E    A EE KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  EIGRKKKAPSAKKEATEEGEAATEEEKKSNHVTRKLEKRQQGRKLDPHIEEQFGSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  181  SISSRPGQCGRADGYILE  198



>ref|XP_004240435.1| PREDICTED: 40S ribosomal protein S8-2 [Solanum lycopersicum]
Length=220

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DI  +KK  A K+     EG AAEE KKSNHV RK+EKRQK+R LDSHLEEQF SGRL A
Sbjct  121  DI-GRKKKGAAKKETTTEEGDAAEEAKKSNHVVRKIEKRQKDRTLDSHLEEQFSSGRLYA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_010907235.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=223

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGR KK  AA K+ A E    A EE KKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+
Sbjct  121  EIGRKKKAPAASKKEATEEGEGATEEAKKSNHVLRKLEKRQQCRTLDPHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|AFK47179.1| unknown [Medicago truncatula]
 gb|KEH18114.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=215

 Score =   270 bits (690),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 178/198 (90%), Gaps = 3/198 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR           EE    A EE KKS HVQRKLE+RQKER+LD+H+EEQFG GRL+A
Sbjct  121  DIGR---KKKNVSKKEEEAEAATEEVKKSAHVQRKLEQRQKERQLDAHIEEQFGGGRLLA  177

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  178  CISSRPGQCGRADGYILE  195



>ref|XP_006352667.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=221

 Score =   270 bits (691),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 180/200 (90%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGR--kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGR  K  AA K+   E     AAEETKKSNHV RK+EKR  +RKLDSHLEEQF SGRL
Sbjct  121  DIGRKKKGAAAKKETAEEGESAAAAEETKKSNHVLRKIEKRLADRKLDSHLEEQFSSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
             ACISSRPGQCGRADGYILE
Sbjct  181  YACISSRPGQCGRADGYILE  200



>ref|XP_009783183.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   270 bits (691),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISTNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK  A  +     E    AAEETKKSNHV RK+E RQK+RKLD H+EEQFG GRL
Sbjct  121  DIGRKKKGPAKKETTEEGEGAAAAAEETKKSNHVLRKIETRQKDRKLDPHIEEQFGGGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_010646836.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=220

 Score =   270 bits (690),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATG KKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGSKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK AA K+   E      EETKKS+HV RKLEKRQ +RKLD H+EEQF SGRL+A
Sbjct  121  DIGR-KKKAAAKKETTEEGEAPVEETKKSSHVLRKLEKRQADRKLDPHIEEQFSSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_009610547.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=224

 Score =   270 bits (691),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISANKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK  A  +     E    AAEETKKSNHV RK+E RQK+RKLD H+EEQFG GRL
Sbjct  121  DIGRKKKGPAKKETTEEGEGAAAAAEETKKSNHVLRKIETRQKDRKLDPHIEEQFGGGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_010675861.1| PREDICTED: 40S ribosomal protein S8 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   270 bits (690),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK AA     E  EG   EE KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+A
Sbjct  121  EIGR-KKKAAASAKKEAEEGETTEEAKKSNHVARKLEKRQQTRTLDAHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_010913109.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Elaeis guineensis]
Length=222

 Score =   270 bits (690),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeet-kkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGRKKKA A  +     EG  A E  KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+
Sbjct  121  EIGRKKKAPAATKKEATEEGEGATEEPKKSNHVLRKLEKRQQGRKLDPHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|NP_001236970.1| uncharacterized protein LOC100500112 [Glycine max]
 gb|ACU14990.1| unknown [Glycine max]
Length=217

 Score =   270 bits (689),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR LDVVYNASNNELVRTQTLVK+AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRTLDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK  A K+ + E    AAEETKKSNHVQRKLEKRQK+RKLDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKVASKKDSTEEGEAAAEETKKSNHVQRKLEKRQKDRKLDSHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_003520991.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
 gb|KHN05782.1| 40S ribosomal protein S8 [Glycine soja]
Length=220

 Score =   270 bits (690),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 182/200 (91%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGR--kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            +IGR  K  A  +          AAEE KKSNHVQRKLEKRQK+RKLD+H+EEQFG GRL
Sbjct  121  EIGRKKKTAAKKETAEEGGDAAAAAEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFGGGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>gb|ACU19111.1| unknown [Glycine max]
Length=220

 Score =   270 bits (690),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 190/200 (95%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaee--tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            +IGRKKK AAKKETAEE      A EE KKSNHVQRKLEKRQK+RKLD+H+EEQFG GRL
Sbjct  121  EIGRKKKTAAKKETAEEGGDAVAATEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFGGGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_008451649.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis melo]
Length=219

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  +     EE      EE KKSNHVQRK+EKRQ++RKLD H+EEQF SGRLMA
Sbjct  121  DIGR-KKKTSASAKKEEEGDAGTEEVKKSNHVQRKIEKRQQDRKLDPHIEEQFSSGRLMA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_010278451.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=219

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKKAAAKK+TAE +      EETKKS+HV RKLEKR +  KLD H+EEQFGSGRL+
Sbjct  121  DIGRKKKAAAKKDTAEGQEGDGTTEETKKSSHVLRKLEKRLQGHKLDPHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_002529032.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF33343.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=219

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  A  +   E    A EE KKSNHV RKLEKRQ+ RKLD H+EEQFG GRL+A
Sbjct  121  DIGR-KKKTAAAKKEGEEGEAATEEVKKSNHVLRKLEKRQQIRKLDPHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_003547779.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
Length=219

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGR KK AA K+   E    VA EE KKSNH+QRKLEKRQK+RKLD+H+EEQFG GRL+
Sbjct  121  EIGRKKKTAAKKETAEEGAAAVAVEEAKKSNHLQRKLEKRQKDRKLDAHIEEQFGGGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_011069406.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  A K+  EE E  A EE KKSNHVQRK+EKRQ++RK+D H+EEQF SGRL+A
Sbjct  121  DIGR-KKKTAAKKEGEEAEAAATEEVKKSNHVQRKIEKRQQDRKIDPHIEEQFSSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  180  AISSRPGQCGRADGYILE  197



>ref|XP_006833291.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
 gb|ERM98569.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
Length=218

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 176/198 (89%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGI  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK     +   E    A EE  KS HV RKLEKRQ+  KLD H+EEQFG GRL+A
Sbjct  121  DIGR-KKKTGAAKKEGEEGEAAIEEVNKSKHVLRKLEKRQEGHKLDPHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>emb|CDP15136.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSS+KTVRRIRVRGGNVKWRALR
Sbjct  55   MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSDKTVRRIRVRGGNVKWRALR  114

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  115  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  174

Query  398  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGR KK    KKE  E     A EETKKSNHV RK+EKRQKERKLD+H+EEQFGSGRL+
Sbjct  175  DIGRKKKAVVVKKEGEEGEAAAATEETKKSNHVLRKIEKRQKERKLDAHIEEQFGSGRLL  234

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  235  ACISSRPGQCGRADGYILE  253



>ref|XP_009413565.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=222

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD+GNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY QHYG+
Sbjct  61   LDSGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYFQHYGI  120

Query  398  DIGRkkka-aakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGRKKKA  A K+ A E    A EE KKSNHV RKLEKRQ+  KLD H+EEQFG+GRL+
Sbjct  121  EIGRKKKAPTASKKEAAEEGEAAVEEGKKSNHVTRKLEKRQQGCKLDPHIEEQFGAGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_002534344.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF28038.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=221

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkka-aakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK  A K+    E EG AAEE+KKSNHV RKLEKRQK+RKLD+H+EEQF  GRL+
Sbjct  121  DIGRKKKTVAKKETEEGEGEGAAAEESKKSNHVIRKLEKRQKDRKLDAHIEEQFWGGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_003551567.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
 gb|KHN28407.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAATRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            ++GRKKK+AA     E E    A EE KKSNHV RKLEKR++ R LD H+EEQFG GRL+
Sbjct  121  EVGRKKKSAAASAKKEGEDGEAATEEVKKSNHVLRKLEKRKQNRVLDPHIEEQFGGGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_011095494.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK  A K+  EETE    EE KKSNHVQRKLEKRQ++RK+D H+EEQFG GRL+A
Sbjct  121  DIGR-KKKTAAKKEGEETEAAGTEEVKKSNHVQRKLEKRQQDRKIDQHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  180  AISSRPGQCGRADGYILE  197



>ref|XP_006286561.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
 gb|EOA19459.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
Length=221

 Score =   269 bits (687),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 183/201 (91%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae---etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            ++GRKKK AA     E   + E  A EETKKSNHVQRK+E RQ+ R LDSH+E+QF SGR
Sbjct  121  EVGRKKKNAATSTKKEGEDKEEVAAPEETKKSNHVQRKIEGRQETRTLDSHIEDQFASGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACISSRPGQCGRADGYILE
Sbjct  181  LLACISSRPGQCGRADGYILE  201



>ref|XP_009371092.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=220

 Score =   268 bits (686),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK+A  K+   E      EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGR-KKSAVAKKDTPEEGEGTTEEAKKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGYILE
Sbjct  180  CISSRPGQCGRCDGYILE  197



>ref|XP_002313320.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92635.1| unknown [Populus trichocarpa]
 gb|EEE87275.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=219

 Score =   268 bits (686),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeet-kkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK  A  +   E    AA E  K+SNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+
Sbjct  121  DIGRKKKTTAAAKKEGEEGEAAATEEVKQSNHVQRKLEKRQQIRKLDPHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  181  ASISSRPGQCGRADGYILE  199



>ref|NP_200732.2| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
 sp|Q9FIF3.1|RS82_ARATH RecName: Full=40S ribosomal protein S8-2 [Arabidopsis thaliana]
 dbj|BAB09769.1| 40S ribosomal protein S8 [Arabidopsis thaliana]
 gb|AAO42849.1| At5g59240 [Arabidopsis thaliana]
 dbj|BAE99897.1| 40S ribosomal protein S8 - like [Arabidopsis thaliana]
 gb|AED97161.1| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
Length=210

 Score =   268 bits (684),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 175/198 (88%), Gaps = 10/198 (5%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDV YNASNNELVRTQTLVKSAIVQVDAAPFKQ YLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQGYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR           ++ E V  EE KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+A
Sbjct  121  DIGR----------KKKGEAVTTEEVKKSNHVQRKLEMRQEGRALDSHLEEQFSSGRLLA  170

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGRADGYILE
Sbjct  171  CIASRPGQCGRADGYILE  188



>ref|XP_010069614.1| PREDICTED: 40S ribosomal protein S8-like [Eucalyptus grandis]
 gb|KCW58022.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=222

 Score =   268 bits (685),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGR KK AAAKKE  EE E   AEE KKS HV RKLEKRQK+R+LD+H+EEQFGSGRL+
Sbjct  121  DIGRKKKAAAAKKEATEEGEAAPAEEAKKSAHVLRKLEKRQKDRQLDAHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGR+DGYILE
Sbjct  181  ACISSRPGQCGRSDGYILE  199



>ref|NP_001274851.1| uncharacterized protein LOC102577693 [Solanum tuberosum]
 gb|ABA46755.1| unknown [Solanum tuberosum]
Length=224

 Score =   268 bits (685),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 181/200 (91%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLS+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG 
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGA  120

Query  398  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK  A  +     E    AAEETKKSNHVQRK+E RQK+R LD HLEEQFG GRL
Sbjct  121  DIGRKKKGPAKKETTEEGEGAAAAAEETKKSNHVQRKIENRQKDRTLDPHLEEQFGGGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGR DGYILE
Sbjct  181  LACISSRPGQCGRCDGYILE  200



>ref|XP_009403610.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=220

 Score =   268 bits (684),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD+GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYGV
Sbjct  61   LDSGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGV  120

Query  398  DIGRkkkaaakket-aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGRKKKA    +  A E    AAEE KKSNHV RKLEKRQ+ R LD H+E+QFG+GRL+
Sbjct  121  EIGRKKKAPTASKKDAMEEGEAAAEEEKKSNHVTRKLEKRQQGRILDPHIEDQFGAGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGR+DGYILE
Sbjct  181  ACISSRPGQCGRSDGYILE  199



>ref|XP_007223947.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
 gb|EMJ25146.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
Length=222

 Score =   268 bits (684),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakket-aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGRKKK AA  +    E      EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+
Sbjct  121  EIGRKKKTAAAAKKDTPEEGEATTEEAKKSNHVARKLEKRQQGRTLDGHIEEQFGGGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|ACU16800.1| unknown [Glycine max]
Length=243

 Score =   268 bits (686),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAW KKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWGKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGR KK AA K+   E    VA EE KKSNH+QRKLEKRQK+RKLD+H+EEQFG GRL+
Sbjct  121  EIGRKKKTAAKKETAEEGAAAVAVEEAKKSNHLQRKLEKRQKDRKLDAHIEEQFGGGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>sp|O81361.1|RS8_PRUAR RecName: Full=40S ribosomal protein S8 [Prunus armeniaca]
 gb|AAC24583.1| 40S ribosomal protein S8 [Prunus armeniaca]
Length=221

 Score =   267 bits (683),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGRKKK AA K+   E      EE KKSNHV  KLEKRQ+ R LD+H+EEQFG G+L+A
Sbjct  121  EIGRKKKTAAAKKDTPEEGEATTEEAKKSNHVAIKLEKRQQGRTLDAHIEEQFGGGKLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCG+ADG ILE
Sbjct  181  CISSRPGQCGKADGDILE  198



>ref|XP_010905161.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=224

 Score =   267 bits (683),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeeteg--vaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            +IGRKKKAA  K+   E +    AAEE KKSNHV RKLEKRQ+ RKLD H+EEQFG GRL
Sbjct  121  EIGRKKKAAVAKKETAEGQEGDGAAEEAKKSNHVLRKLEKRQQGRKLDPHIEEQFGGGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +A ISSRPGQCGRADGYILE
Sbjct  181  LASISSRPGQCGRADGYILE  200



>gb|EYU33688.1| hypothetical protein MIMGU_mgv1a013525mg [Erythranthe guttata]
Length=218

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DI R KK AA K+  EE E  A EE KKSNHVQRK+EKRQ+ERK+D+H+EEQFGSGRL+A
Sbjct  121  DISR-KKKAAVKKEGEEAEAAATEEAKKSNHVQRKIEKRQEERKIDTHIEEQFGSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  180  AISSRPGQCGRADGYILE  197



>ref|XP_008809644.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=223

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+Q+DAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQIDAAPFKQWYLQHYGV  120

Query  398  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            +IGR KK  AA K+ A E    A EE KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+
Sbjct  121  EIGRKKKAPAATKKEATEEGEGATEEAKKSSHVLRKLEKRQQGRTLDPHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGR+DGYILE
Sbjct  181  ACISSRPGQCGRSDGYILE  199



>ref|XP_004247043.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=222

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLS+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG 
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGA  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK AAKK+T EE E  A EETKKSNHVQRK+E RQK+R LD HLEEQFG GRL+A
Sbjct  121  DIGRKKKGAAKKDTTEEGEAAAPEETKKSNHVQRKIENRQKDRTLDPHLEEQFGGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGYILE
Sbjct  181  CISSRPGQCGRCDGYILE  198



>ref|XP_007149668.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
 gb|ESW21662.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
Length=217

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQSANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK AA K+ + E    AAEETKKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+A
Sbjct  121  EIGR-KKKAASKKDSTEEADAAAEETKKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_008679876.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Zea mays]
Length=258

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 2/197 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK  A K+     +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL
Sbjct  121  DIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRL  180

Query  572  MACISSRPGQCGRADGY  622
            +ACISSRPGQCGRADGY
Sbjct  181  LACISSRPGQCGRADGY  197



>ref|XP_010270147.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=221

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGL  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK+++  +   E      EE KKSNHV RKLEKRQ+  KLD H+EEQF SGRL+A
Sbjct  121  DIGRKKKSSSAAKKEGEEGEATTEEAKKSNHVLRKLEKRQQGHKLDPHIEEQFSSGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
             I+SRPGQCGRADGYILE
Sbjct  181  AIASRPGQCGRADGYILE  198



>ref|XP_008366424.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_009364625.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009364657.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009335423.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 179/201 (89%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGR---kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            +IGR      AA K+    E    AAEE KKSNHV RKLEKRQ+ R LD H+EEQFG GR
Sbjct  121  EIGRKKKTAAAAKKEAEDGEAPAAAAEEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACISSRPGQCGR DGYILE
Sbjct  181  LLACISSRPGQCGRCDGYILE  201



>ref|XP_010243157.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Nelumbo 
nucifera]
Length=217

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 178/198 (90%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLV+SAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DI  +KK  A K+   E      EETKKSNHV RKLEKR +  KLD H+EEQFGSGRL+A
Sbjct  121  DI-GRKKKGAAKKDTAEEGDGTTEETKKSNHVLRKLEKRLQSHKLDPHIEEQFGSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  180  CISSRPGQCGRADGYILE  197



>ref|XP_009596732.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=223

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaee-tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK AAKKET EE      AEE KKSNHV RKLEKRQK+RKLD HLEEQFG+GRL 
Sbjct  121  DIGRKKKGAAKKETTEEGEAATPAEEAKKSNHVARKLEKRQKDRKLDPHLEEQFGAGRLY  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_004160707.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
Length=221

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAV+RKTRILDVVYNASNNELVRTQTLVKSA+VQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVSRKTRILDVVYNASNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeet-kkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK AA  +  EE +  AA E  KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRLM
Sbjct  121  DIGRKKKTAASAKKDEEGDAAAAAEEVKKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRLM  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>gb|AGV54796.1| 40S ribosomal protein S8 [Phaseolus vulgaris]
Length=218

 Score =   266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELG  PANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGPPPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQ YG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQPYGL  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGRKKK AAKK++AEE +  AAEE KKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+A
Sbjct  121  DIGRKKKTAAKKDSAEEGDAAAAEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLA  180

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGYILE
Sbjct  181  CISSRPGQCGRCDGYILE  198



>ref|XP_009771719.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 182/200 (91%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DI--GRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DI   +K  A  +     E    AAEETKKSNHV RKLEKRQK+R+LD+HLEEQFG+GRL
Sbjct  121  DIGRKKKGAAKKETAEEGEGAAAAAEETKKSNHVARKLEKRQKDRQLDAHLEEQFGAGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>gb|ACU16398.1| unknown [Glycine max]
Length=256

 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAATRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            ++GRKKK+AA     E E    A EE KKSNHV RKLEKR++ R LD H+EEQFG GRL+
Sbjct  121  EVGRKKKSAAASAKKEGEDGEAATEEVKKSNHVLRKLEKRKQNRVLDPHIEEQFGGGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_009361080.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009348460.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 180/201 (90%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae---etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            +IGRKKK AA  +      E    A EE KKSNHV RKLEKRQ+ R LD H+EEQFG GR
Sbjct  121  EIGRKKKTAAAAKKEAEDGEAPAAAPEEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACISSRPGQCGR DGYILE
Sbjct  181  LLACISSRPGQCGRCDGYILE  201



>ref|XP_004149800.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN47709.1| hypothetical protein Csa_6G382970 [Cucumis sativus]
Length=222

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAV+RKTRILDVVYNASNNELVRTQTLVKSA+VQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVSRKTRILDVVYNASNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeet--kkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DIGRKKK AA  +  EE +  AA     KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRL
Sbjct  121  DIGRKKKTAASAKKDEEGDAAAAAAEEVKKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            MACISSRPGQCGRADGYILE
Sbjct  181  MACISSRPGQCGRADGYILE  200



>gb|KJB81683.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=245

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR KK +A  +   E    A EE KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKSAAAKKEGEEGETATEEVKKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLA  179

Query  578  CISSRPGQCGRADGYI  625
            CISSRPGQCGRADGY+
Sbjct  180  CISSRPGQCGRADGYL  195



>ref|XP_010243156.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Nelumbo 
nucifera]
Length=219

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLV+SAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKK AAKK+TAE +      EETKKSNHV RKLEKR +  KLD H+EEQFGSGRL+
Sbjct  121  DIGRKKKGAAKKDTAEGQEGDGTTEETKKSNHVLRKLEKRLQSHKLDPHIEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_009405538.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=224

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 180/201 (90%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDA PFK WYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDATPFKHWYLQHYGV  120

Query  398  DIGRkkkaaakketaeet---egvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            +IGRKKKA A  +           AAEE KKSNHV RKLEKRQ+ R LD H+EEQFG+GR
Sbjct  121  EIGRKKKAPAAAKKEATEVPEGEAAAEEAKKSNHVTRKLEKRQQGRTLDPHIEEQFGAGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACISSRPGQCGRADGYILE
Sbjct  181  LLACISSRPGQCGRADGYILE  201



>emb|CDY60374.1| BnaCnng36150D, partial [Brassica napus]
Length=228

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 180/206 (87%), Gaps = 8/206 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  3    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  62

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  63   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  122

Query  398  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  553
            ++GRKKK A+     +             A EETKKSNHV RK+E RQ+ R LDSH+E+Q
Sbjct  123  EVGRKKKNASAAAVKKDGEEGGEAAPAAAAPEETKKSNHVLRKIESRQEGRSLDSHIEDQ  182

Query  554  FGSGRLMACISSRPGQCGRADGYILE  631
            F SGRL+ACISSRPGQCGRADGYILE
Sbjct  183  FASGRLLACISSRPGQCGRADGYILE  208



>ref|XP_006409551.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
 gb|ESQ51004.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
Length=225

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 181/205 (88%), Gaps = 7/205 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae-------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQF  556
            ++GRKKK A+     E            A EETKKSNHV RK+E+RQ+ R LDSH+E+QF
Sbjct  121  EVGRKKKNASSATKKEGEDGEDASAPAAAPEETKKSNHVLRKIEQRQEGRSLDSHIEDQF  180

Query  557  GSGRLMACISSRPGQCGRADGYILE  631
             SGRL+ACISSRPGQCGRADGYILE
Sbjct  181  ASGRLLACISSRPGQCGRADGYILE  205



>ref|XP_006344091.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=223

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQ ANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQSANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DI--GRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DI   +K  A  +  T E      AEE KKSNHV RK+EKRQK+R LDSHLEEQF SGRL
Sbjct  121  DIGRKKKGAAKKETTTEEGEAAAPAEEAKKSNHVVRKIEKRQKDRTLDSHLEEQFSSGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
             ACISSRPGQCGRADGYILE
Sbjct  181  YACISSRPGQCGRADGYILE  200



>ref|XP_009131790.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=226

 Score =   265 bits (678),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 180/206 (87%), Gaps = 8/206 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  553
            ++GRKKK A+     +             A EETKKSNHV RK+E RQ+ R LDSH+E+Q
Sbjct  121  EVGRKKKNASAVAAKKDGEEGEEVAPAAAAPEETKKSNHVLRKIESRQEGRSLDSHIEDQ  180

Query  554  FGSGRLMACISSRPGQCGRADGYILE  631
            F SGRL+ACISSRPGQCGRADGYILE
Sbjct  181  FASGRLLACISSRPGQCGRADGYILE  206



>ref|XP_008227073.1| PREDICTED: 40S ribosomal protein S8-like [Prunus mume]
Length=225

 Score =   265 bits (678),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 180/204 (88%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeet------egvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  559
            +IGRKKK AA  +   E           AEE KKSNHV RKLEKRQ+ R LD H+EEQFG
Sbjct  121  EIGRKKKTAAAAKKEGEEGDAAAAPAAVAEEVKKSNHVVRKLEKRQQSRTLDQHIEEQFG  180

Query  560  SGRLMACISSRPGQCGRADGYILE  631
             GRL+ACISSRPGQCGRADGYILE
Sbjct  181  GGRLLACISSRPGQCGRADGYILE  204



>gb|ACJ83894.1| unknown [Medicago truncatula]
Length=216

 Score =   265 bits (677),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 181/198 (91%), Gaps = 2/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKK   +K++ YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKSWRKKRK-YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            L TGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  60   LGTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++GR KK  A K+ + E   V AEE KKS+HVQRKLE+RQK+R+LDSH+EEQFG GRL+A
Sbjct  120  EVGR-KKKTAAKKDSAEEAEVVAEEVKKSSHVQRKLEQRQKDRQLDSHIEEQFGGGRLLA  178

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  179  CISSRPGQCGRADGYILE  196



>ref|XP_009126438.1| PREDICTED: 40S ribosomal protein S8-1-like [Brassica rapa]
Length=226

 Score =   265 bits (677),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 178/206 (86%), Gaps = 8/206 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  553
            ++GRKKK        E             A EE KKSNHVQRK+E RQ+ R LDSH+E+Q
Sbjct  121  EVGRKKKTVPSAAKKEGEDGEEAAPAAAAAPEEVKKSNHVQRKIESRQEGRSLDSHIEDQ  180

Query  554  FGSGRLMACISSRPGQCGRADGYILE  631
            F SGRL+ACISSRPGQCGRADGYILE
Sbjct  181  FASGRLLACISSRPGQCGRADGYILE  206



>ref|XP_006400597.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
 gb|ESQ42050.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
Length=226

 Score =   265 bits (676),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 179/206 (87%), Gaps = 8/206 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  553
            ++GRKKK A      E               EETKKSNHV RK+E+RQ+ R LDSH+E+Q
Sbjct  121  EVGRKKKNAGASTKKEGEDTEDAPAAAAATPEETKKSNHVLRKIEQRQEGRSLDSHIEDQ  180

Query  554  FGSGRLMACISSRPGQCGRADGYILE  631
            F SGRL+ACISSRPGQCGRADGYILE
Sbjct  181  FASGRLLACISSRPGQCGRADGYILE  206



>gb|KFK31870.1| hypothetical protein AALP_AA6G169300 [Arabis alpina]
Length=219

 Score =   265 bits (676),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLS NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  398  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            ++GRKKK A      E E    AAEETKKSNHV RK+++RQ++R LDSH+E+QF SGRL+
Sbjct  121  EVGRKKKPAPSATKKEGEDVEEAAEETKKSNHVLRKIKERQEDRNLDSHIEDQFSSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  181  ACISSRPGQCGRADGYILE  199



>ref|XP_008364326.1| PREDICTED: 40S ribosomal protein S8-like [Malus domestica]
 ref|XP_008345024.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_008355313.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=222

 Score =   265 bits (676),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 179/201 (89%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSE VTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketae---etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            +IGRKKK AA  +      E    A EE KKSNHV RKLEKRQ+ R LD H+EEQFG GR
Sbjct  121  EIGRKKKTAAAAKKEAEDGEAPAAAPEEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACISSRPGQCGR DGYILE
Sbjct  181  LLACISSRPGQCGRCDGYILE  201



>ref|XP_002873989.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50248.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 181/200 (91%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  398  DIGRkkkaaakket--aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            ++GRKKK AA  +    E  E  A EETKKSNH+ RK+E RQ+ R LDSH+E+QF SGRL
Sbjct  121  EVGRKKKNAASTKKDAEEGEEVAAVEETKKSNHLSRKIESRQEGRSLDSHIEDQFASGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_010493138.1| PREDICTED: 40S ribosomal protein S8-1 [Camelina sativa]
Length=223

 Score =   265 bits (676),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 181/203 (89%), Gaps = 5/203 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketa-----eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGS  562
            ++GRKKK A           +E     AEETKKSNHVQRK+E RQ+ R LDSH+E+QF S
Sbjct  121  EVGRKKKTAVTTTKKDGEDGDEAAPAVAEETKKSNHVQRKIESRQETRTLDSHIEDQFAS  180

Query  563  GRLMACISSRPGQCGRADGYILE  631
            GRL+ACISSRPGQCGRADGYILE
Sbjct  181  GRLLACISSRPGQCGRADGYILE  203



>gb|KJB62960.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=211

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAA  +   E    A EE 
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAGAKKEGEEGETATEEV  139

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILE
Sbjct  140  KKSSHVLRKLEKRQQSRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYILE  191



>gb|ACN31997.1| unknown [Zea mays]
 gb|AFW66127.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66131.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66132.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
 gb|AFW66139.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66140.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
Length=214

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakke--taeetegvaae  469
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK  A K+     +    AAE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAAKKDNAEGQEVEAAAE  139

Query  470  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            ETKKSNHV RKLEKR++ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILE
Sbjct  140  ETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYILE  193



>ref|XP_009619873.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=220

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 176/199 (88%), Gaps = 3/199 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGNYSWGSEA+TRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAITRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            VDIGR  K        E  E  A  E KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+
Sbjct  121  VDIGR--KKKTAASKKEGEEAEAVPEEKKSNHVQRKLQKRQQDRKIDPHIEEQFASGRLL  178

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  179  AAISSRPGQCGRADGYILE  197



>ref|XP_010420870.1| PREDICTED: 40S ribosomal protein S8-1-like [Camelina sativa]
Length=223

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 183/203 (90%), Gaps = 5/203 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakk-----etaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGS  562
            ++GRKKK AA       E A+E      EETKKSNHV+RK+E RQ+ R LDSH+E+QF S
Sbjct  121  EVGRKKKTAATTTKKDGEDADEAAPAIPEETKKSNHVKRKIETRQESRTLDSHIEDQFAS  180

Query  563  GRLMACISSRPGQCGRADGYILE  631
            GRL+ACISSRPGQCGRADGYILE
Sbjct  181  GRLLACISSRPGQCGRADGYILE  203



>emb|CDY45095.1| BnaA02g04810D [Brassica napus]
Length=244

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 179/206 (87%), Gaps = 8/206 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  19   MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  78

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  79   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  138

Query  398  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  553
            ++GRKKK A      E             A EE KKSNHVQRK+E RQ+ R LDSH+E+Q
Sbjct  139  EVGRKKKTAPSAAKKEGEDGEEAAPAAAAAPEEVKKSNHVQRKIESRQEGRSLDSHIEDQ  198

Query  554  FGSGRLMACISSRPGQCGRADGYILE  631
            F SGRL+ACISSRPGQCGRADGYILE
Sbjct  199  FASGRLLACISSRPGQCGRADGYILE  224



>ref|XP_007211997.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 ref|XP_007211998.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13196.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13197.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
Length=225

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 180/204 (88%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeet------egvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  559
            +IGRKKK AA  +   E           AEE KKSNHV RKLEKRQ+ R LD H+EEQFG
Sbjct  121  EIGRKKKTAAAAKKEGEEGDAAAAPAAVAEEVKKSNHVVRKLEKRQQSRTLDQHIEEQFG  180

Query  560  SGRLMACISSRPGQCGRADGYILE  631
             GRL+ACISSRPGQCGR+DGYILE
Sbjct  181  GGRLLACISSRPGQCGRSDGYILE  204



>ref|XP_009602561.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=224

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 181/200 (91%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DI--GRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            DI   +K  A  +     E    AAEETKKSNHV RKLEKRQK+RKLD+HLEEQFG+GRL
Sbjct  121  DIGRKKKGAAKKETAEEGEGAAAAAEETKKSNHVARKLEKRQKDRKLDAHLEEQFGAGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>ref|XP_010541736.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=222

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeete----gvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  565
            +IGRKKK  A     E  E      A EETKKSNHV RKLEKRQK R LDSH+E+QF SG
Sbjct  121  EIGRKKKTPATSGKKEGEEGEDGAAAPEETKKSNHVLRKLEKRQKNRALDSHIEDQFASG  180

Query  566  RLMACISSRPGQCGRADGYILE  631
            RL+ACISSRPGQCGRADGYILE
Sbjct  181  RLLACISSRPGQCGRADGYILE  202



>ref|XP_009770276.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=220

 Score =   262 bits (670),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGNYSWGSEA+TRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAITRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            VDIGR  K        E  E  A  E KKSNHVQRKL+KRQ++RK+D H+EEQF  GRL+
Sbjct  121  VDIGR--KKKTAASKKEGEEAEAVPEEKKSNHVQRKLQKRQQDRKIDPHIEEQFAGGRLL  178

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  179  AAISSRPGQCGRADGYILE  197



>gb|EYU27406.1| hypothetical protein MIMGU_mgv1a013520mg [Erythranthe guttata]
Length=218

 Score =   262 bits (670),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKMKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR KK AA K+  EETE  AAEE KKS HV RKLEKRQ+ER +D H+EEQFG GRL+A
Sbjct  121  EIGR-KKKAAAKKEGEETEAAAAEEVKKSKHVLRKLEKRQEERTIDQHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  180  AISSRPGQCGRADGYILE  197



>ref|XP_006856815.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
 gb|ERN18282.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
Length=218

 Score =   262 bits (669),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN SWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNCSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            D+G KKK A+  +   E    A EE KKS+HV+RKLEKR +  KLD H+EEQFG GRL+A
Sbjct  121  DLG-KKKKASATKKEGEEAEGATEEVKKSDHVKRKLEKRLEGHKLDPHIEEQFGGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGY+LE
Sbjct  180  CISSRPGQCGRADGYVLE  197



>emb|CDP03936.1| unnamed protein product [Coffea canephora]
Length=213

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV+YNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVMYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR KK    K+ A E     AEET
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKGPAKKDATEDGEATAEET  138

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILE
Sbjct  139  KKSNHVVRKLEKRQQGRTLDPHIEEQFGGGRLLACISSRPGQCGRADGYILE  190



>gb|KFK26269.1| hypothetical protein AALP_AA8G225000 [Arabis alpina]
Length=223

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 182/203 (90%), Gaps = 5/203 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLS NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  398  DIGRkkkaaakketae-----etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGS  562
            ++GRKKKAA      E     E    AAEETKKSNHV RK+++RQ++R LDSH+E+QF S
Sbjct  121  EVGRKKKAAVSATKKEGEDVEEAPPAAAEETKKSNHVLRKIKERQEDRNLDSHIEDQFSS  180

Query  563  GRLMACISSRPGQCGRADGYILE  631
            GRL+ACISSRPGQCGRADGYILE
Sbjct  181  GRLLACISSRPGQCGRADGYILE  203



>ref|XP_009765854.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=221

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL +N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            VDIGR KK +A K+  EE E   A E KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+
Sbjct  121  VDIGR-KKKSAAKKEGEEAETAPAAEEKKSNHVQRKLQKRQQDRKIDPHVEEQFASGRLL  179

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  180  AAISSRPGQCGRADGYILE  198



>ref|XP_009120819.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=227

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 181/207 (87%), Gaps = 9/207 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaee---------tegvaaeetkkSNHVqrklekrqkerklDSHLEE  550
            ++GRKKK AA     +E             A EE KKSNHVQRK+E RQ+ R LDSH+E+
Sbjct  121  EVGRKKKNAAASAAKKEGEDGEDAAPAAAAAPEEVKKSNHVQRKIESRQEGRTLDSHIED  180

Query  551  QFGSGRLMACISSRPGQCGRADGYILE  631
            QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  181  QFASGRLLACISSRPGQCGRADGYILE  207



>ref|XP_010235437.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Brachypodium 
distachyon]
Length=226

 Score =   262 bits (669),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 181/205 (88%), Gaps = 7/205 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketaeet-------egvaaeetkkSNHVqrklekrqkerklDSHLEEQF  556
            DIGRKKK  A  +               AAEETKKSN+VQRKLEKRQ+ R LD H+EEQF
Sbjct  121  DIGRKKKTPAATKKDATEDGDAAAPAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIEEQF  180

Query  557  GSGRLMACISSRPGQCGRADGYILE  631
             SGRL+ACISSRPGQCGRADGYILE
Sbjct  181  SSGRLLACISSRPGQCGRADGYILE  205



>gb|ABL85034.1| ribosomal subunit 8E protein [Brachypodium sylvaticum]
Length=223

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 177/202 (88%), Gaps = 4/202 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLAHYGV  120

Query  398  DIGR----kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  565
            DIGR                +    AAEETKKSN+VQRKLEKRQ+ R LD H+EEQF SG
Sbjct  121  DIGRKKKTPAATKKDATEDGDAAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIEEQFSSG  180

Query  566  RLMACISSRPGQCGRADGYILE  631
            RL+ACISSRPGQCGRADGYILE
Sbjct  181  RLLACISSRPGQCGRADGYILE  202



>gb|KJB13806.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=212

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 155/173 (90%), Gaps = 1/173 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketae-etegvaaee  472
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD+GRKKK  A     + E     AEE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDLGRKKKTLAAATKKDGEEGETVAEE  139

Query  473  tkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
             KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  140  AKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLLACISSRPGQCGRADGYILE  192



>gb|KJB81682.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=196

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  6    YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  65

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+DIGR KK +A  +   E    A EE 
Sbjct  66   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKSAAAKKEGEEGETATEEV  124

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILE
Sbjct  125  KKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLACISSRPGQCGRADGYILE  176



>ref|XP_010535902.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=220

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 180/200 (90%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVD APFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDVAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketa--eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  571
            ++GRKKK AA       EE E  A EETKKSNHV RKLEKRQ+ R LDSH+E+QF SGRL
Sbjct  121  EVGRKKKTAATSGKKEGEEGEDAAPEETKKSNHVLRKLEKRQQNRSLDSHIEDQFASGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +ACISSRPGQCGRADGYILE
Sbjct  181  LACISSRPGQCGRADGYILE  200



>emb|CDY35814.1| BnaC09g37460D [Brassica napus]
Length=258

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 181/206 (88%), Gaps = 8/206 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  33   MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  92

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  93   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  152

Query  398  DIGRkkkaaakketaee--------tegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  553
            ++GRKKK AA     +E            A EE KKSNHVQRK+E RQ+ R LDSH+E+Q
Sbjct  153  EVGRKKKNAAASAAKKEGEDGEDAAPAAAAPEEVKKSNHVQRKIESRQEGRTLDSHIEDQ  212

Query  554  FGSGRLMACISSRPGQCGRADGYILE  631
            F SGRL+ACISSRPGQCGRADGYILE
Sbjct  213  FASGRLLACISSRPGQCGRADGYILE  238



>ref|XP_004290159.1| PREDICTED: 40S ribosomal protein S8-like [Fragaria vesca subsp. 
vesca]
Length=224

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 183/201 (91%), Gaps = 3/201 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYNV  120

Query  398  DIGRkkkaaakket---aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  568
            DIGRKKK AAKK+    A E      EETKKS ++ RKLEKRQK+R LDSH+EEQF  GR
Sbjct  121  DIGRKKKTAAKKDAKDVAAEEADGTTEETKKSGNLLRKLEKRQKDRTLDSHIEEQFSGGR  180

Query  569  LMACISSRPGQCGRADGYILE  631
            L+ACISSRPGQCGRADGYILE
Sbjct  181  LLACISSRPGQCGRADGYILE  201



>emb|CBI39377.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK  AKKET EE EG A EET
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTTAKKETTEEGEGGATEET  139

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSNHV RKLEKRQ++ +LD H+EEQFGSGRL+A ISSRPGQCGRADGYILE
Sbjct  140  KKSNHVLRKLEKRQQDHRLDPHIEEQFGSGRLLASISSRPGQCGRADGYILE  191



>ref|XP_003557224.1| PREDICTED: 40S ribosomal protein S8 [Brachypodium distachyon]
Length=226

 Score =   261 bits (666),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 180/205 (88%), Gaps = 7/205 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketaeet-------egvaaeetkkSNHVqrklekrqkerklDSHLEEQF  556
            DIGRKKK  A  +               AAEE KKSN+VQRKLEKRQ+ R LD H+EEQF
Sbjct  121  DIGRKKKTPAATKKDATEDGDAAAPAAAAAEEAKKSNNVQRKLEKRQQGRTLDPHIEEQF  180

Query  557  GSGRLMACISSRPGQCGRADGYILE  631
             SGRL+ACISSRPGQCGRADGYILE
Sbjct  181  SSGRLLACISSRPGQCGRADGYILE  205



>ref|XP_003574981.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 181/208 (87%), Gaps = 10/208 (5%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGRkkkaaakketaeetegv----------aaeetkkSNHVqrklekrqkerklDSHLE  547
            DIGRKKK  A  +                  AAEETKKSN+VQRKLEKRQ+ R LD H+E
Sbjct  121  DIGRKKKTPAATKKDATETLQDGDAAAPAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIE  180

Query  548  EQFGSGRLMACISSRPGQCGRADGYILE  631
            EQF SGRL+ACISSRPGQCGRADGYILE
Sbjct  181  EQFSSGRLLACISSRPGQCGRADGYILE  208



>ref|XP_002864608.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40867.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   260 bits (664),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 173/198 (87%), Gaps = 10/198 (5%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDV YNASNNELVRTQTLVKSAIV VDAAPFKQ YLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVLVDAAPFKQGYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR           ++ + V  EE KKSNH+QRKLE RQ+ R LDSHLEEQF SGRL+A
Sbjct  121  DIGR----------KKKGDAVTTEEVKKSNHIQRKLEMRQEGRALDSHLEEQFSSGRLLA  170

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQ GRADGYILE
Sbjct  171  CIASRPGQSGRADGYILE  188



>ref|XP_006652189.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=214

 Score =   260 bits (664),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 158/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakket--aeetegvaae  469
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKKA A K+     +    AAE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAVEGQEGEAAAE  139

Query  470  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            ETKKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILE
Sbjct  140  ETKKSNHVVRKLEKRQQGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYILE  193



>ref|XP_009594581.1| PREDICTED: 40S ribosomal protein S8-2-like [Nicotiana tomentosiformis]
Length=221

 Score =   260 bits (664),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL +N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            VDIGR KK +A K+  EE E   A E KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+
Sbjct  121  VDIGR-KKKSATKKEGEEAEAAPAAEEKKSNHVQRKLQKRQQDRKIDPHVEEQFASGRLL  179

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  180  AAISSRPGQCGRADGYILE  198



>gb|KHG14255.1| 40S ribosomal S8 [Gossypium arboreum]
Length=210

 Score =   259 bits (663),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+DIGR KK +A  +   E    A EE 
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKSAAAKKEGEEGETATEEV  138

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILE
Sbjct  139  KKSNHVLRKLEKRQQNRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYILE  190



>emb|CDX92472.1| BnaA10g15110D [Brassica napus]
Length=246

 Score =   261 bits (667),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 181/207 (87%), Gaps = 9/207 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  20   MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  79

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  80   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  139

Query  398  DIGRkkkaaakketaee---------tegvaaeetkkSNHVqrklekrqkerklDSHLEE  550
            ++GRKKK AA     +E             A EE KKSNHVQRK+E RQ+ R LDSH+E+
Sbjct  140  EVGRKKKNAAASAAKKEGEDGEDAAPAAAAAPEEVKKSNHVQRKIESRQEGRTLDSHIED  199

Query  551  QFGSGRLMACISSRPGQCGRADGYILE  631
            QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  200  QFASGRLLACISSRPGQCGRADGYILE  226



>ref|XP_010097296.1| 40S ribosomal protein S8 [Morus notabilis]
 gb|EXB67448.1| 40S ribosomal protein S8 [Morus notabilis]
Length=215

 Score =   260 bits (664),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 154/176 (88%), Gaps = 4/176 (2%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQ ANTKLSS+KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQSANTKLSSDKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaee----tegva  463
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK +A    A          A
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTSAAAAAAAAQEGDAAAAA  139

Query  464  aeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
             EE KKS+HV RKLEKRQ+ R LD+H+EEQF SGRL+ACISSRPGQCGRADGYILE
Sbjct  140  TEEAKKSSHVLRKLEKRQQNRVLDAHIEEQFSSGRLLACISSRPGQCGRADGYILE  195



>emb|CBI26725.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPASTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+DIGRKKKA+A  +   E     AEET
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGLDIGRKKKASATAKKEGEEGDGPAEET  139

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSNHV RKLEKRQ+E KLD H+EEQFGSGRL+A ISSRPGQCGRADGYILE
Sbjct  140  KKSNHVVRKLEKRQQEHKLDPHIEEQFGSGRLLAAISSRPGQCGRADGYILE  191



>ref|XP_011461093.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
 ref|XP_011461096.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
Length=225

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 177/204 (87%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY  HYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYSTHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeet------kkSNHVqrklekrqkerklDSHLEEQFG  559
            +IGRKKK AA  +   E    A          KKS HV+RKLEKRQ+ R LD H+EEQFG
Sbjct  121  EIGRKKKTAAAIKKEAEDGEAATAAAAAAEEVKKSKHVERKLEKRQQTRVLDHHIEEQFG  180

Query  560  SGRLMACISSRPGQCGRADGYILE  631
             GRL+ACISSRPGQCGRADGYILE
Sbjct  181  GGRLLACISSRPGQCGRADGYILE  204



>emb|CDX88842.1| BnaA03g08070D [Brassica napus]
Length=239

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 180/207 (87%), Gaps = 9/207 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            +GISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  13   LGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  72

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  73   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  132

Query  398  DIGRkkkaa---------akketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEE  550
            ++GRKKK A          ++         A EETKKSNHV RK+E RQ+ R LDSH+E+
Sbjct  133  EVGRKKKNASAAAAAKKDGEEGEEAAPAAAAPEETKKSNHVLRKIESRQEGRSLDSHIED  192

Query  551  QFGSGRLMACISSRPGQCGRADGYILE  631
            QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  193  QFASGRLLACISSRPGQCGRADGYILE  219



>gb|EYU39184.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=218

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKL + NKTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RL+TGNYSWGSEA+TRKTR+LDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRVLDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            VDIGR KK     +  E  EG AA+E KKS+HV RK+EKRQ ERKLD H+EEQF SGRL+
Sbjct  121  VDIGR-KKKGGADKKEETEEGEAAQEAKKSSHVLRKIEKRQAERKLDPHVEEQFSSGRLL  179

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  180  ACISSRPGQCGRADGYILE  198



>gb|EMT18438.1| 40S ribosomal protein S8 [Aegilops tauschii]
Length=225

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGR------kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  559
            +IGR        K  A +    E    A EE KKSN+VQRKLEKRQ+ R LDSH+EEQF 
Sbjct  121  EIGRKKKAAAAAKKEAAEGQEAEVAAAATEEAKKSNNVQRKLEKRQQGRTLDSHIEEQFS  180

Query  560  SGRLMACISSRPGQCGRADGYILE  631
             GRL+ACISSRPGQCGRADGYILE
Sbjct  181  GGRLLACISSRPGQCGRADGYILE  204



>gb|KJB22660.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=212

 Score =   258 bits (659),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQP NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE+VTRKTRILDVVYNA
Sbjct  20   YELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+DIGR KK  A K+ A E    AAEET
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGR-KKKMASKKEATEEPEGAAEET  138

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            K+S HV RKLEKRQK+RKLD H+EEQFG GRL+ACISSRPGQCGRADGYILE
Sbjct  139  KRSKHVARKLEKRQKDRKLDPHVEEQFGGGRLLACISSRPGQCGRADGYILE  190



>ref|XP_006648644.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=213

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 156/173 (90%), Gaps = 1/173 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketae-etegvaaee  472
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKKA A K+ AE +      EE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAEGQDAEATTEE  139

Query  473  tkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
             KKSNHV RK+EKRQ+ R LD H+EEQF SGRL+ACISSRPGQCGRADGYILE
Sbjct  140  AKKSNHVIRKIEKRQEGRTLDPHIEEQFSSGRLLACISSRPGQCGRADGYILE  192



>ref|XP_003626942.1| Ribosomal protein S8 [Medicago truncatula]
Length=605

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 178/198 (90%), Gaps = 3/198 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  391  MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  450

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  451  LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  510

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIGR           EE    A EE KKS HVQRKLE+RQKER+LD+H+EEQFG GRL+A
Sbjct  511  DIGR---KKKNVSKKEEEAEAATEEVKKSAHVQRKLEQRQKERQLDAHIEEQFGGGRLLA  567

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  568  CISSRPGQCGRADGYILE  585


 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVR IRVRGGN+K RALRLDTGN SWGSEAVTRK+R+L+VVYNA
Sbjct  128  YELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLDTGNISWGSEAVTRKSRLLNVVYNA  187

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IG  KK  A K+ + +    A EET
Sbjct  188  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-NKKKTAAKQDSAKEAEAATEET  246

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSNHV RKLE R+K+R+LD+H+EEQFG GRL+ACISSRPGQCGRADGYILE
Sbjct  247  KKSNHVLRKLENREKDRQLDAHIEEQFGGGRLLACISSRPGQCGRADGYILE  298



>ref|XP_006369983.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
 gb|ERP66552.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
Length=199

 Score =   257 bits (656),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 152/172 (88%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  8    YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  67

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+DIGR KK     +   E      EE 
Sbjct  68   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKTTAAKKEGEEGEAVTEEV  126

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILE
Sbjct  127  KKSNHVLRKLEKRQQIRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILE  178



>ref|NP_197529.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
 sp|Q93VG5.1|RS81_ARATH RecName: Full=40S ribosomal protein S8-1 [Arabidopsis thaliana]
 gb|AAK93614.1| unknown protein [Arabidopsis thaliana]
 gb|AAK96530.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAL31236.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAM14111.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64526.1| 40S ribosomal protein S8-like [Arabidopsis thaliana]
 dbj|BAE98439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92825.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
Length=222

 Score =   258 bits (658),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEA TRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEATTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  398  DIGRkkkaaak----ketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  565
            ++GRKKK+A+      E  EE    A EE KKSNH+ RK+  RQ+ R LDSH+E+QF SG
Sbjct  121  ELGRKKKSASSTKKDGEEGEEAAVAAPEEVKKSNHLLRKIASRQEGRSLDSHIEDQFASG  180

Query  566  RLMACISSRPGQCGRADGYILE  631
            RL+ACISSRPGQCGRADGYILE
Sbjct  181  RLLACISSRPGQCGRADGYILE  202



>ref|XP_006346168.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=220

 Score =   257 bits (657),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 176/199 (88%), Gaps = 3/199 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            V+IGR  K        E  E  A  E KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+
Sbjct  121  VEIGR--KKKTAASKKEGEEAEAVAEEKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLL  178

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  179  AAISSRPGQCGRADGYILE  197



>dbj|BAJ89904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   257 bits (657),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 176/204 (86%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEA TRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEATTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGR------kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  559
            +IGR        K  A +    E    A EE KKSN VQRKLEKRQ+ R LDSH+EEQF 
Sbjct  121  EIGRKKKAAAAAKKDAAEGQEAEVAAAATEEAKKSNKVQRKLEKRQQGRTLDSHIEEQFS  180

Query  560  SGRLMACISSRPGQCGRADGYILE  631
             GRL+ACISSRPGQCGRADGYILE
Sbjct  181  GGRLLACISSRPGQCGRADGYILE  204



>ref|XP_010519957.1| PREDICTED: 40S ribosomal protein S8-1 [Tarenaya hassleriana]
Length=222

 Score =   257 bits (657),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 177/202 (88%), Gaps = 4/202 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYE+GR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  398  DIGRkkkaaakketae----etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  565
            ++GRKKK +A     E    E    A EETKKSNHV RKLEKRQ  R LD H+E+QF SG
Sbjct  121  EVGRKKKTSATSGKKEGDEGEDAAAAPEETKKSNHVLRKLEKRQSNRSLDPHIEDQFTSG  180

Query  566  RLMACISSRPGQCGRADGYILE  631
            RL+ACISSRPGQCGRADGYILE
Sbjct  181  RLLACISSRPGQCGRADGYILE  202



>ref|XP_010926672.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Elaeis guineensis]
Length=207

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGR+PANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  10   YELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  69

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeeteg--vaae  469
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IGRKKK  A K+ A E +    AAE
Sbjct  70   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTLAAKKEATEGQEGDGAAE  129

Query  470  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            E KKSNHV RKLEKRQ+ R+LD H+EEQFGSGRL+ACISSRPGQCGRADG ILE
Sbjct  130  EVKKSNHVLRKLEKRQQGRQLDPHIEEQFGSGRLLACISSRPGQCGRADGCILE  183



>ref|XP_010327196.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=221

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 178/199 (89%), Gaps = 3/199 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKKAWRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            V+IGR  K  +  +   E    AA E KKSNHVQRKLEKRQ++RK+D+H+EEQF SGRL+
Sbjct  121  VEIGR--KKKSAAKKEGEEVAEAAAEEKKSNHVQRKLEKRQQDRKIDAHIEEQFASGRLL  178

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  179  AAISSRPGQCGRADGYILE  197



>ref|XP_010926670.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
 ref|XP_010926671.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
Length=212

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGR+PANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  15   YELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  74

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeeteg--vaae  469
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IGRKKK  A K+ A E +    AAE
Sbjct  75   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTLAAKKEATEGQEGDGAAE  134

Query  470  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            E KKSNHV RKLEKRQ+ R+LD H+EEQFGSGRL+ACISSRPGQCGRADG ILE
Sbjct  135  EVKKSNHVLRKLEKRQQGRQLDPHIEEQFGSGRLLACISSRPGQCGRADGCILE  188



>ref|XP_004244061.1| PREDICTED: 40S ribosomal protein S8-like [Solanum lycopersicum]
Length=221

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 177/199 (89%), Gaps = 2/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            V+IGR KK  A     E  E  A  E KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+
Sbjct  121  VEIGR-KKKTAASSKKEGEEAEAVAEEKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLL  179

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  180  AAISSRPGQCGRADGYILE  198



>gb|ACI15738.1| putative 40S ribosomal protein S8-like protein [Picrorhiza kurrooa]
Length=216

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 175/198 (88%), Gaps = 2/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            M  S  SMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MSTSLLSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IGR  K     +   E   V AEE KKSNHVQRKLEKRQ+ERK+DSH+EEQF  GRL+A
Sbjct  121  EIGR--KKKTAAKKEGEEAEVVAEEVKKSNHVQRKLEKRQEERKIDSHIEEQFSGGRLLA  178

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  179  AISSRPGQCGRADGYILE  196



>ref|XP_007049645.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
 gb|EOX93802.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
Length=195

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 146/172 (85%), Gaps = 7/172 (4%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  9    YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  68

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK AAKKE  E          
Sbjct  69   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTAAKKEATEVESFFIW---  125

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
                     + +  K+ KLD+H+EEQFG+GRL+ACISSRPGQCGRADGYILE
Sbjct  126  ----QEGEGVAEETKKSKLDAHIEEQFGAGRLLACISSRPGQCGRADGYILE  173



>ref|NP_001275100.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
 gb|ABB72814.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
Length=221

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 176/199 (88%), Gaps = 3/199 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKK+WRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            V+IGR  K  +  +   E     A E KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+
Sbjct  121  VEIGR--KKKSAAKKEGEEAAEGAAEEKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLL  178

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  179  AAISSRPGQCGRADGYILE  197



>gb|EMS65111.1| 40S ribosomal protein S8 [Triticum urartu]
Length=274

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 181/203 (89%), Gaps = 6/203 (3%)
 Frame = +2

Query  41   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  220
            GISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRL
Sbjct  51   GISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRL  110

Query  221  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  400
            DTGN+SWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV+
Sbjct  111  DTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGVE  170

Query  401  IGRkkkaaakketa------eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGS  562
            IGRKKKAAA  +         E    A EE KKSN+VQRKLEKRQ+ R LDSH+EEQF  
Sbjct  171  IGRKKKAAAAAKKEPAEGQEAEVAAAATEEAKKSNNVQRKLEKRQQGRTLDSHIEEQFSG  230

Query  563  GRLMACISSRPGQCGRADGYILE  631
            GRL+ACISSRPGQCGRADGYILE
Sbjct  231  GRLLACISSRPGQCGRADGYILE  253



>ref|XP_011089042.1| PREDICTED: 40S ribosomal protein S8-like [Sesamum indicum]
Length=220

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 177/199 (89%), Gaps = 2/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKL +  KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLDTLQKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RL+TGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            VDI  +KK  A K+   E     A+ETKKSNHV RKLEKRQ  RKLD H+EEQF SGRL+
Sbjct  121  VDI-GRKKKGAAKKDEAEEGEGIAQETKKSNHVLRKLEKRQAARKLDPHVEEQFSSGRLL  179

Query  575  ACISSRPGQCGRADGYILE  631
            ACISSRPGQCGRADGYILE
Sbjct  180  ACISSRPGQCGRADGYILE  198



>ref|XP_010520566.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=224

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 179/204 (88%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRLRVRGGNIKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEA TRK+RILDVVYNASNNELVRT+TLVKSAIVQ+DAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEAATRKSRILDVVYNASNNELVRTKTLVKSAIVQIDAAPFKQWYLSHYGV  120

Query  398  DIGRkkkaaakketae------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  559
            ++GRKKKA+A     E        +  A EETKKSNHV RKLEKRQ+ R LDSH+++QF 
Sbjct  121  EVGRKKKASASSGKKEEEGEDGAEKAAAPEETKKSNHVLRKLEKRQQNRALDSHIDDQFS  180

Query  560  SGRLMACISSRPGQCGRADGYILE  631
            +GRL+ACISSRPGQCGRADGYILE
Sbjct  181  TGRLLACISSRPGQCGRADGYILE  204



>ref|XP_006352532.1| PREDICTED: 40S ribosomal protein S8 [Solanum tuberosum]
Length=221

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 177/199 (89%), Gaps = 3/199 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRRATGGKKKAWRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            V+IGR  K  +  +   E    AA E KKSNHVQRKLEKRQ++RK++ H+EEQF SGRL+
Sbjct  121  VEIGR--KKKSAAKKEGEEAAEAAAEEKKSNHVQRKLEKRQQDRKINPHVEEQFASGRLL  178

Query  575  ACISSRPGQCGRADGYILE  631
            A ISSRPGQCGRADGYILE
Sbjct  179  AAISSRPGQCGRADGYILE  197



>gb|EYU39185.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=194

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  214
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKL + NKTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  215  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  394
            RL+TGNYSWGSEA+TRKTR+LDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRVLDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYG  120

Query  395  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  574
            VDIGR KK     +  E  EG AA+E KKS+HV RK+EKRQ ERKLD H+EEQF SGRL+
Sbjct  121  VDIGR-KKKGGADKKEETEEGEAAQEAKKSSHVLRKIEKRQAERKLDPHVEEQFSSGRLL  179

Query  575  ACISSRPGQCGRADG  619
            ACISSRPGQCGRADG
Sbjct  180  ACISSRPGQCGRADG  194



>gb|EPS68663.1| hypothetical protein M569_06106, partial [Genlisea aurea]
Length=217

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = +2

Query  41   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKL-SSNKTVRRIRVRGGNVKWRALR  217
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL ++ KTVRR+RVRGGNVKWRALR
Sbjct  1    GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTQKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            L+TGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIV VDAAPFKQWY  HYGV
Sbjct  61   LNTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVMVDAAPFKQWYSTHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IG+ KK +  K      EG AA   K SNHV+RK +KRQ +RK+DSHLEEQF SGRL+A
Sbjct  121  EIGK-KKKSNAKRDEPTEEGDAATVGKASNHVERKRKKRQVDRKVDSHLEEQFSSGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  180  SISSRPGQCGRADGYILE  197



>gb|ABK21921.1| unknown [Picea sitchensis]
Length=221

 Score =   249 bits (637),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 176/199 (88%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrkl-ekrqkerklDSHLEEQFGSGRLM  574
            DIGRKKKAAA K+   E     AEE KK +    K  EKRQ+  KLDSHLEEQFGSGRL+
Sbjct  121  DIGRKKKAAAAKKETTEEGEATAEEEKKKSKHLLKKIEKRQEGHKLDSHLEEQFGSGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            A I+SRPGQCGRADGYILE
Sbjct  181  AAIASRPGQCGRADGYILE  199



>ref|XP_001761026.1| predicted protein [Physcomitrella patens]
 gb|EDQ74093.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 170/198 (86%), Gaps = 3/198 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AIVQVDAAPF+ WY QHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIVQVDAAPFRTWYSQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IG   K        +  +  A EE KKSNHVQ+KL KR +  KLDSHLE+QF SGRL+A
Sbjct  121  EIG---KKKKSAAKKDSEDAEATEEEKKSNHVQKKLAKRVEGHKLDSHLEDQFASGRLLA  177

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGRADGYILE
Sbjct  178  CIASRPGQCGRADGYILE  195



>gb|ABK21933.1| unknown [Picea sitchensis]
Length=221

 Score =   247 bits (631),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 175/199 (88%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqke-rklDSHLEEQFGSGRLM  574
            DIGRKKKAAA K+   E     AEE KK +    K  ++++E  KLDSHLEEQF SGRL+
Sbjct  121  DIGRKKKAAAAKKETTEEGEATAEEEKKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            A I+SRPGQCGRADGYILE
Sbjct  181  AAIASRPGQCGRADGYILE  199



>gb|ABK22298.1| unknown [Picea sitchensis]
Length=222

 Score =   247 bits (630),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 171/200 (86%), Gaps = 2/200 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqker--klDSHLEEQFGSGRL  571
            DIGRKKKAAA  +     EG A  E +K        +  +++   KLDSHLEEQF SGRL
Sbjct  121  DIGRKKKAAAAAKKETTEEGEATAEEEKKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRL  180

Query  572  MACISSRPGQCGRADGYILE  631
            +A I+SRPGQCGRADGYILE
Sbjct  181  LAAIASRPGQCGRADGYILE  200



>gb|AET01418.2| 40S ribosomal protein S8 [Medicago truncatula]
Length=288

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 172/196 (88%), Gaps = 1/196 (1%)
 Frame = +2

Query  44   ISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLD  223
            ISRDS  KR ATGGK+K   KKRKYELGRQPANTKLSSNKTVR IRVRGGN+K RALRLD
Sbjct  74   ISRDSRDKRLATGGKRKTCIKKRKYELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLD  133

Query  224  TGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDI  403
            TGN SWGSEAVTRK+R+L+VVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+I
Sbjct  134  TGNISWGSEAVTRKSRLLNVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEI  193

Query  404  GRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACI  583
            G  KK  A K+ + +    A EETKKSNHV RKLE R+K+R+LD+H+EEQFG GRL+ACI
Sbjct  194  G-NKKKTAAKQDSAKEAEAATEETKKSNHVLRKLENREKDRQLDAHIEEQFGGGRLLACI  252

Query  584  SSRPGQCGRADGYILE  631
            SSRPGQCGRADGYILE
Sbjct  253  SSRPGQCGRADGYILE  268



>gb|ABR16896.1| unknown [Picea sitchensis]
Length=221

 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEPVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqke-rklDSHLEEQFGSGRLM  574
            DIGRKKKAAA K+   E     AEE KK +    K  ++++E  KLDSHLEEQF SGRL+
Sbjct  121  DIGRKKKAAAAKKETTEEGEATAEEEKKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRLL  180

Query  575  ACISSRPGQCGRADGYILE  631
            A I+SRPGQCGRADGYILE
Sbjct  181  AAIASRPGQCGRADGYILE  199



>gb|EPS68749.1| hypothetical protein M569_06019 [Genlisea aurea]
Length=411

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 168/198 (85%), Gaps = 4/198 (2%)
 Frame = +2

Query  41   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKL-SSNKTVRRIRVRGGNVKWRALR  217
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL ++ KTVRRIRVRGGNVKWRALR
Sbjct  194  GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTTKTVRRIRVRGGNVKWRALR  253

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            L+TGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIV VDA PFKQWYL HYGV
Sbjct  254  LNTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVMVDATPFKQWYLTHYGV  313

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DIG+           ++        TK S+HV++K +KRQ +RK++ H+EEQF  GRL+A
Sbjct  314  DIGK---KRKLPAAKKDEAEEPDANTKVSHHVEKKRKKRQVDRKIEPHVEEQFAGGRLLA  370

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  371  CISSRPGQCGRADGYILE  388



>ref|XP_001773385.1| predicted protein [Physcomitrella patens]
 gb|EDQ61758.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   242 bits (617),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 169/198 (85%), Gaps = 3/198 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IG   K        EE      EE K+S+HV RK+ KR + +KLD+HLE+QF SGRL+A
Sbjct  121  EIG---KKKKAAVKKEEVAETTEEEKKQSSHVLRKIAKRAEGQKLDAHLEDQFASGRLLA  177

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR+DGYILE
Sbjct  178  CISSRPGQCGRSDGYILE  195



>ref|XP_001777587.1| predicted protein [Physcomitrella patens]
 gb|EDQ57630.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 169/198 (85%), Gaps = 3/198 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IG   K        +  +    EE KKS HVQRKL KR + +KLDSHLE+QF SGRL+A
Sbjct  121  EIG---KKKKAAAKKDTEDAETTEEEKKSAHVQRKLAKRLEGQKLDSHLEDQFASGRLLA  177

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGRADGYILE
Sbjct  178  CIASRPGQCGRADGYILE  195



>ref|XP_001780988.1| predicted protein [Physcomitrella patens]
 gb|EDQ54172.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 169/198 (85%), Gaps = 3/198 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IG   K        +E      E+TK+S HV RK+ KR + +KLDSHLE+QF SGRL+A
Sbjct  121  EIG---KKKKAAAKKDEEAEATEEQTKQSGHVLRKIAKRVEGQKLDSHLEDQFASGRLLA  177

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGRADGYILE
Sbjct  178  CIASRPGQCGRADGYILE  195



>ref|XP_001777813.1| predicted protein [Physcomitrella patens]
 gb|EDQ57351.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNFKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +IG   K        +  E  A EE KKS HV RK+ KR + +KLD+HLE+QF SGRL+A
Sbjct  121  EIG---KKKKTAAKKDAEEAEATEEEKKSKHVLRKIAKRVESQKLDAHLEDQFASGRLLA  177

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGR DGYILE
Sbjct  178  CIASRPGQCGRVDGYILE  195



>gb|AES86897.2| 40S ribosomal S8-like protein [Medicago truncatula]
Length=218

 Score =   237 bits (605),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+VVYNA
Sbjct  27   YELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNVVYNA  86

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IG   K  + K+ + E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-SAKKTSGKKDSAEESEAVTEEV  145

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSN+VQRKLE+RQK+R+LD  +E QFG GRL+ACISSRPGQCGRADGYILE
Sbjct  146  KKSNNVQRKLEQRQKDRRLDPLIEVQFGGGRLLACISSRPGQCGRADGYILE  197



>ref|XP_003604700.1| Ribosomal protein S8 [Medicago truncatula]
Length=280

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+VVYNA
Sbjct  8    YELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNVVYNA  67

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IG   K  + K+ + E      EE 
Sbjct  68   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-SAKKTSGKKDSAEESEAVTEEV  126

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KKSN+VQRKLE+RQK+R+LD  +E QFG GRL+ACISSRPGQCGRADGYILE
Sbjct  127  KKSNNVQRKLEQRQKDRRLDPLIEVQFGGGRLLACISSRPGQCGRADGYILE  178


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  542  LEEQFGSGRLMACISSRPGQCGRADGYILE  631
            +EEQ G GRL+ACISSRPGQCG ADGYIL+
Sbjct  231  IEEQLGGGRLLACISSRPGQCGTADGYILK  260



>ref|XP_004516802.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=312

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 147/172 (85%), Gaps = 5/172 (3%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQ A+TKLSSNKT+RRIRVRGGNVKWR LR DTGN+SWGSEAVTRKTR+LD+VYNA
Sbjct  21   YELGRQLASTKLSSNKTIRRIRVRGGNVKWRDLRWDTGNFSWGSEAVTRKTRLLDMVYNA  80

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRTQTLVK+AIVQVD APFKQWYLQHYGV+IGR           +    VAAEE 
Sbjct  81   SNNELVRTQTLVKNAIVQVDVAPFKQWYLQHYGVEIGR-----NITMVLKLEVEVAAEEA  135

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KK+NHVQRKLE RQK+R+LDSH+EEQFG GRL+ACI S PGQCGR DGYILE
Sbjct  136  KKNNHVQRKLENRQKDRQLDSHIEEQFGGGRLLACILSHPGQCGRLDGYILE  187



>ref|XP_008676011.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=335

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 149/174 (86%), Gaps = 2/174 (1%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSN+TVRR+ VRGGN KWRALRLDTGN SWGSEA+ RKT ILDVVYNA
Sbjct  149  YELGRQPANTKLSSNETVRRVHVRGGNAKWRALRLDTGNCSWGSEALIRKTHILDVVYNA  208

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakke--taeetegvaae  469
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK    K+  T  +      E
Sbjct  209  SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVHVAKKDDTEGQEGEAIVE  268

Query  470  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            ETKKSNHVQRK++KR + R LD+H+EE+FGSGRL+ACIS+ P QCGRADGYILE
Sbjct  269  ETKKSNHVQRKIDKRHQYRALDTHIEEKFGSGRLLACISAHPRQCGRADGYILE  322



>ref|XP_001696201.1| ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP08178.1| ribosomal protein S8 [Chlamydomonas reinhardtii]
Length=208

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 162/198 (82%), Gaps = 9/198 (5%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGG+KK WRKK+KYE+GR PANTKLS+N  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++G            +       EE K SNHV+RK+++R ++RKLDSHL EQF +GRL A
Sbjct  121  ELG---------AKNQAEIVPKPEEIKGSNHVKRKIKERLQKRKLDSHLAEQFSTGRLFA  171

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGYILE
Sbjct  172  CISSRPGQCGRCDGYILE  189



>gb|ABA01100.1| 40S ribosomal protein S8 [Chlamydomonas incerta]
Length=208

 Score =   229 bits (585),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 162/198 (82%), Gaps = 9/198 (5%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRR TGG+KK WRKK+KYE+GR PANTKLS+N  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRDTGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++G           ++       EE K SNHV+RK+++R ++RKLD+H+ EQF +GRL A
Sbjct  121  ELG---------AKSQLEVVPKPEEVKGSNHVKRKIKERLQKRKLDAHMAEQFSTGRLFA  171

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGR DGYILE
Sbjct  172  CIASRPGQCGRCDGYILE  189



>ref|XP_002963298.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
 ref|XP_002974597.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ24117.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ35169.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
Length=214

 Score =   229 bits (584),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = +2

Query  41   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  220
            GISRDS+HKRRATGGKKKAWRKKRKYELGRQPA TKL++ KTVRRIRVRGGN K RALRL
Sbjct  1    GISRDSLHKRRATGGKKKAWRKKRKYELGRQPAMTKLAA-KTVRRIRVRGGNFKLRALRL  59

Query  221  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  400
            D GNYSWG+EAV RKTRIL+VVYNASNNELVRTQTLVKSAIVQVDA PF+ WY QHYGVD
Sbjct  60   DAGNYSWGTEAVARKTRILEVVYNASNNELVRTQTLVKSAIVQVDATPFRAWYNQHYGVD  119

Query  401  IGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMAC  580
            + R  K     E   E    A EE  KS H  RKL  R +  KLD H+EEQ  SGRL+AC
Sbjct  120  LSR--KKKPSAEATTEAGPAAEEEKPKSKHTLRKLANRAEGHKLDPHIEEQMASGRLLAC  177

Query  581  ISSRPGQCGRADGYILE  631
            I+SRPGQCGRADGYILE
Sbjct  178  IASRPGQCGRADGYILE  194



>ref|XP_002945874.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52869.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=209

 Score =   229 bits (583),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 162/198 (82%), Gaps = 8/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGG+KK WRKK+KYE+GR PANTKLSSN  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSSNVAVRTVRVRGGHTKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA  FKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATQFKQWYQKHYNV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++G         +  +       EE + SNHV+RK+++R ++RKLD HL EQF +GRL A
Sbjct  121  ELG--------AKKDQPDVAPKPEEIQGSNHVKRKIKERLQKRKLDPHLAEQFTTGRLFA  172

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGRADGYILE
Sbjct  173  CIASRPGQCGRADGYILE  190



>ref|XP_010539242.1| PREDICTED: 40S ribosomal protein S8-1-like, partial [Tarenaya 
hassleriana]
Length=180

 Score =   223 bits (568),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 140/159 (88%), Gaps = 3/159 (2%)
 Frame = +2

Query  164  TVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI  343
            TVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRT+TLVKSAI
Sbjct  2    TVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTKTLVKSAI  61

Query  344  VQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeete---gvaaeetkkSNHVqrklekr  514
            VQVDAAPFKQWYLQHYGV++GRKKK AA     E  E     A EETKKSNHV RKLEKR
Sbjct  62   VQVDAAPFKQWYLQHYGVEVGRKKKTAATAGKKEGEEGEDTAALEETKKSNHVLRKLEKR  121

Query  515  qkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            Q+ R LD H+E+QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  122  QQNRNLDPHIEDQFASGRLLACISSRPGQCGRADGYILE  160



>gb|EYU33690.1| hypothetical protein MIMGU_mgv1a013952mg [Erythranthe guttata]
Length=205

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            DI R KK AA K+  EE E  A EE KKSNHV RK+EKRQ+ERK+++H+EEQF SGRL+A
Sbjct  121  DISR-KKKAAVKKEGEEAEAAATEEAKKSNHVHRKIEKRQEERKINTHIEEQFCSGRLLA  179

Query  578  C  580
             
Sbjct  180  L  180



>gb|AFW66128.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66141.1| putative ribosomal protein S8e family protein [Zea mays]
Length=153

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGR  409
            DIGR
Sbjct  121  DIGR  124



>emb|CCA22399.1| 40S ribosomal protein S82 putative [Albugo laibachii Nc14]
Length=206

 Score =   216 bits (550),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 155/198 (78%), Gaps = 10/198 (5%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL   K V R+RVRGG+ K+RALR
Sbjct  1    MGISRDSRHKRRDTGGKRKQYRKKRKFELGRQPANTKLG-GKRVHRVRVRGGHFKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            L+TGN+SWGSEAV+RKTRILDVVYNASNNELVRT+TLVKSAIV +DA PF+QWY  HYGV
Sbjct  60   LETGNFSWGSEAVSRKTRILDVVYNASNNELVRTKTLVKSAIVSIDATPFRQWYETHYGV  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             IG+                   E+ KKS+HV RKL +RQ+ R  D  L+EQF SGR++A
Sbjct  120  KIGQ---------KKNAETTEKVEQEKKSDHVMRKLAQRQRGRIFDPKLDEQFTSGRILA  170

Query  578  CISSRPGQCGRADGYILE  631
            C+SSRPGQ GRADGYILE
Sbjct  171  CVSSRPGQSGRADGYILE  188



>gb|KDD75705.1| ribosomal protein S8e [Helicosporidium sp. ATCC 50920]
Length=353

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 148/198 (75%), Gaps = 13/198 (7%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRA+G +   WRKKRK+ELGRQPANTKLSSN TVR +R RGGN+K+RALR
Sbjct  1    MGISRDSIHKRRASGARPNIWRKKRKFELGRQPANTKLSSNVTVRPVRCRGGNMKYRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD+GN+SWGSEA TR+TRIL V YNASNNELVRTQTLVKSAIVQVDAAPFK WY Q YG 
Sbjct  61   LDSGNFSWGSEATTRRTRILSVSYNASNNELVRTQTLVKSAIVQVDAAPFKAWYSQRYGT  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++GR              +    E+   S  V +K   R K   LDS LE+QF  GRL A
Sbjct  121  ELGR-------------KKAAEEEKEPVSERVAKKQAARAKNHSLDSLLEDQFSVGRLYA  167

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGRADGYILE
Sbjct  168  LISSRPGQCGRADGYILE  185



>ref|XP_011397165.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
 gb|KFM24278.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
Length=191

 Score =   215 bits (548),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 158/198 (80%), Gaps = 27/198 (14%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+KAWRKKRKYELGRQPANTKLSSN TVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNVTVRRVRVRGGNSKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD+GN+SWGSEA TRKTRILDV YNASNNELVRTQTLVK+AI+Q+DAAPFKQWY QHYGV
Sbjct  61   LDSGNFSWGSEATTRKTRILDVSYNASNNELVRTQTLVKNAIIQIDAAPFKQWYQQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            +                           S+HVQRKL+ R K+R LD  L+EQF  GRL A
Sbjct  121  E---------------------------SDHVQRKLKLRNKDRTLDPLLDEQFSVGRLYA  153

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  154  CISSRPGQCGRADGYILE  171



>emb|CEG02139.1| Ribosomal protein S8e/ribosomal biogenesis NSA2 [Ostreococcus 
tauri]
Length=217

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 153/198 (77%), Gaps = 7/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSN TVR++R RGGNVK RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNVKHRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSE  TRKTRILDVVYNASNNELVRT+TLVKSA+V VDAAPF+ WY QHYG 
Sbjct  61   LDTGNYSWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGK  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             IG        K            + K+S  V  KL +R ++  ++S ++ QF +GRL+A
Sbjct  121  KIG-------IKVKNGAKVEEEDIDEKRSKSVTMKLRRRNRDHAVESAIDAQFSTGRLLA  173

Query  578  CISSRPGQCGRADGYILE  631
             ++SRPGQCGR DGYILE
Sbjct  174  IVTSRPGQCGRCDGYILE  191



>gb|KJB81680.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=155

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  398  DIGR  409
            DIGR
Sbjct  121  DIGR  124



>gb|EPZ31448.1| 40S ribosomal protein S8-B [Rozella allomycis CSF55]
Length=205

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 156/198 (79%), Gaps = 8/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKR  TG K+  +RKKRK+ELGRQPANTKL + K +  +RVRGGN K+RA+R
Sbjct  1    MGISRDSRHKRSHTGAKRAQYRKKRKFELGRQPANTKLGA-KRIHPVRVRGGNTKFRAMR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEA+TRKTRI+DVVYNASNNELVRT+TLVKSAIVQ+DA PF+QWY  HYG 
Sbjct  60   LDTGNFSWGSEAITRKTRIIDVVYNASNNELVRTKTLVKSAIVQIDATPFRQWYEAHYGS  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             +G+       K+ A+     A +  KKSNHVQRK+E R+K+  +D  L++QF +GRL A
Sbjct  120  LLGK-------KKLAKAASTEAGDAEKKSNHVQRKIESRKKDAHVDQALDDQFSTGRLYA  172

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQ GR DGYILE
Sbjct  173  CISSRPGQSGRCDGYILE  190



>ref|XP_001422585.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP00902.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=220

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 153/198 (77%), Gaps = 7/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSN TVR++R RGGN+K RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNIKHRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN++WGSE  TRKTRILDVVYNASNNELVRT+TLVKSA++ VDAAPF+ WY QHYG 
Sbjct  61   LDTGNFAWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAVIAVDAAPFRAWYAQHYGK  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             IG        K            E K+S  V  KL  R ++ ++   ++EQF +GRL+A
Sbjct  121  KIG-------IKVKNGAKVESEDIEEKRSKSVTMKLRSRNQKHEVAKAIDEQFATGRLLA  173

Query  578  CISSRPGQCGRADGYILE  631
             I+SRPGQCGRADGY+LE
Sbjct  174  IITSRPGQCGRADGYVLE  191



>ref|XP_005648786.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
 gb|EIE24242.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
Length=214

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRR TGGK+K WRKKRK+ELGRQPANTKLSSN TVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRLTGGKQKTWRKKRKFELGRQPANTKLSSNVTVRRVRVRGGNFKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD+GN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDA PFKQ+Y QHYGV
Sbjct  61   LDSGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDATPFKQFYTQHYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            + G  KK +     AEE +    E  K SNHV RKL+ R +  KLD  L+ QF  GRL+A
Sbjct  121  EAG-LKKKSGAAAAAEEEKKAGEEAKKTSNHVDRKLKLRNQNHKLDEVLDAQFAGGRLLA  179

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQCGR DGYILE
Sbjct  180  AISSRPGQCGRVDGYILE  197



>gb|KHG09566.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=163

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRR+TGGK+KAWRKKRK+ELGRQP NTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKHELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSE+VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGI  120

Query  398  DIGR  409
            DIGR
Sbjct  121  DIGR  124



>ref|XP_008799563.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=146

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  398  DIGR  409
            +IGR
Sbjct  121  EIGR  124



>ref|XP_005844426.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
 gb|EFN52324.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
Length=233

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 161/197 (82%), Gaps = 2/197 (1%)
 Frame = +2

Query  41   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  220
            GISRDS+HKRRATGGK+K WRKKRKYELGRQPA TKLSSN  VRR+RVRGGN K+RALRL
Sbjct  19   GISRDSLHKRRATGGKQKPWRKKRKYELGRQPAMTKLSSNVCVRRVRVRGGNSKFRALRL  78

Query  221  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  400
            D GN+SWGSEAVTRK RILDV YNASNNELVRTQTLVKSAI+Q+DAAPFKQWY QHYG++
Sbjct  79   DHGNFSWGSEAVTRKVRILDVSYNASNNELVRTQTLVKSAIIQIDAAPFKQWYQQHYGLE  138

Query  401  IGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMAC  580
            +G+  K  +    A            +SNHV+RKL++R + RKLD HL++QF +GRL A 
Sbjct  139  VGQ--KKKSAAAAAAAAAEGEEAAAPQSNHVKRKLKQRNQGRKLDQHLDDQFATGRLYAA  196

Query  581  ISSRPGQCGRADGYILE  631
            ISSRPGQCGR DGYILE
Sbjct  197  ISSRPGQCGRCDGYILE  213



>gb|KJB81681.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=153

 Score =   209 bits (533),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  398  DI  403
            DI
Sbjct  121  DI  122



>gb|KDO22073.1| 40S ribosomal protein S8 [Saprolegnia parasitica CBS 223.65]
Length=202

 Score =   211 bits (537),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 14/198 (7%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTK+ + K V  +RVRGGN+K+RALR
Sbjct  1    MGISRDSKHKRRETGGKRKFFRKKRKFELGRQPANTKMGA-KRVSTVRVRGGNLKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            L+TGN+SWG+E   RKTR+LDV+YNASNNELVRT+TLVK+AI+QVDA PF+QWY  HYGV
Sbjct  60   LETGNFSWGTEVTARKTRVLDVLYNASNNELVRTKTLVKNAIIQVDATPFRQWYEAHYGV  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             +G+              +    E  KKSNHV+RK   R + + LD  +EEQF SGRL+A
Sbjct  120  KLGK-------------VKADDEEAAKKSNHVERKQAARARAQVLDPKIEEQFNSGRLLA  166

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQ GR DGYILE
Sbjct  167  CISSRPGQSGRCDGYILE  184



>gb|AGE46026.1| 40S ribosomal protein S8, partial [Elaeis guineensis]
Length=173

 Score =   210 bits (534),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 131/150 (87%), Gaps = 3/150 (2%)
 Frame = +2

Query  191  GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFK  370
            GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFK
Sbjct  1    GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFK  60

Query  371  QWYLQHYGVDIGRkkkaaakketaeetegv---aaeetkkSNHVqrklekrqkerklDSH  541
            QWYLQHYGV+IGRKKKA A  +           A EE KKSNHV RKLEKRQ+ RKLD H
Sbjct  61   QWYLQHYGVEIGRKKKAPAATKKEATEGQEGEGATEEPKKSNHVLRKLEKRQQGRKLDPH  120

Query  542  LEEQFGSGRLMACISSRPGQCGRADGYILE  631
            +EEQFGSGRL+ACISSRPGQCGRADGYILE
Sbjct  121  IEEQFGSGRLLACISSRPGQCGRADGYILE  150



>ref|XP_008608971.1| 40S ribosomal protein S8 [Saprolegnia diclina VS20]
 gb|EQC37451.1| 40S ribosomal protein S8 [Saprolegnia diclina VS20]
Length=202

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 152/198 (77%), Gaps = 14/198 (7%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTK+ + K V  +RVRGGN+K+RALR
Sbjct  1    MGISRDSKHKRRETGGKRKFFRKKRKFELGRQPANTKMGA-KRVSTVRVRGGNLKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            L+TGN+SWG+E   RKTR+LDV+YNASNNELVRT+TLVK+AI+Q+DA PF+QWY  HYGV
Sbjct  60   LETGNFSWGTEVTARKTRVLDVLYNASNNELVRTKTLVKNAIIQIDATPFRQWYEAHYGV  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             +G+              +    E  KKSNHV+RK   R + + LD  +EEQF SGRL+A
Sbjct  120  KLGK-------------VKADDEEAAKKSNHVERKQAARARVQVLDPKIEEQFNSGRLLA  166

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQ GR DGYILE
Sbjct  167  CISSRPGQSGRCDGYILE  184



>tpg|DAA53686.1| TPA: putative ribosomal protein S8e family protein, partial [Zea 
mays]
Length=296

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = +2

Query  155  SNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVK  334
            SNKTVRR+ VRGGNVKW ALRLDTGNYSWGSEA+T KT ILDVVYNASNNELVRTQTLVK
Sbjct  131  SNKTVRRVCVRGGNVKWSALRLDTGNYSWGSEALTHKTHILDVVYNASNNELVRTQTLVK  190

Query  335  SAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketae--etegvaaeetkkSNHVqrkle  508
            SAIVQVDAAPFKQWYL  YG+DIGRKKK    K+ A   +      EETKKSNHVQRK+E
Sbjct  191  SAIVQVDAAPFKQWYLTRYGMDIGRKKKVHVAKKDATEGQAGEAIVEETKKSNHVQRKIE  250

Query  509  krqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            KRQ++  LD+H+EEQFGSGRL+ACIS+ PGQCG+ADGYILE
Sbjct  251  KRQQDCALDTHIEEQFGSGRLLACISACPGQCGQADGYILE  291



>emb|CCI48864.1| unnamed protein product [Albugo candida]
Length=206

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 153/198 (77%), Gaps = 10/198 (5%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL   K V R+RVRGG+ K+RALR
Sbjct  1    MGISRDSRHKRRETGGKRKQFRKKRKFELGRQPANTKLG-GKRVHRVRVRGGHFKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            L+TGN+SWGSEAV+RKTRILDVVYNASNNELVRT+TLVKSA+V +DA PF+ WY  HYGV
Sbjct  60   LETGNFSWGSEAVSRKTRILDVVYNASNNELVRTKTLVKSAVVSIDATPFRHWYETHYGV  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             IG                    E+ KKS+HV RKL +RQ+ R  D  L++QF SGR++A
Sbjct  120  KIG---------VKKNTESTEKVEQEKKSDHVMRKLAQRQRGRIFDPKLDDQFMSGRILA  170

Query  578  CISSRPGQCGRADGYILE  631
            C+SSRPGQ GRADGYILE
Sbjct  171  CVSSRPGQSGRADGYILE  188



>gb|ABR25841.1| 40S ribosomal protein S8 [Oryza sativa Indica Group]
Length=168

 Score =   207 bits (527),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 131/147 (89%), Gaps = 2/147 (1%)
 Frame = +2

Query  197  VKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  376
            +KWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW
Sbjct  1    LKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  60

Query  377  YLQHYGVDIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEE  550
            YL HYGVDIGRKKKA A K+ A   +    A EE KKSNHV RKLEKRQ+ R LD+H+EE
Sbjct  61   YLTHYGVDIGRKKKAPAAKKDAAEGQEGEAATEEEKKSNHVVRKLEKRQQTRTLDAHIEE  120

Query  551  QFGSGRLMACISSRPGQCGRADGYILE  631
            QFGSGRL+ACISSRPGQCGRADGYILE
Sbjct  121  QFGSGRLLACISSRPGQCGRADGYILE  147



>emb|CAA03954.1| ribosomal protein S8 [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   205 bits (522),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEA TRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEATTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGR  409
            +IGR
Sbjct  121  EIGR  124



>ref|XP_005539190.1| 40S ribosomal protein S8 [Cyanidioschyzon merolae strain 10D]
 dbj|BAC67673.1| ribosomal protein S8 [Cyanidioschyzon merolae]
 dbj|BAM83154.1| 40S ribosomal protein S8 [Cyanidioschyzon merolae strain 10D]
Length=209

 Score =   206 bits (523),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 150/198 (76%), Gaps = 7/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS+HKRR TGGK+K  RKKRKYELGR PANT+L   K VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSIHKRRLTGGKRKIHRKKRKYELGRPPANTRLGP-KLVRPLRVRGGHFKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            L+ GNYSW SE VTRKTRIL VVYNASNNELVRT TLVK +IV +DA PF+ WY QHYG+
Sbjct  60   LEMGNYSWASECVTRKTRILGVVYNASNNELVRTNTLVKGSIVHIDATPFRTWYFQHYGI  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            D+G+      K  ++ +       E K+S  V  KL  RQ +R L+  LE+QF SGRL+A
Sbjct  120  DLGK------KAVSSADATDGTTTEAKRSASVLAKLAARQAKRSLEKALEDQFNSGRLLA  173

Query  578  CISSRPGQCGRADGYILE  631
            CI+SRPGQCGRADGYILE
Sbjct  174  CIASRPGQCGRADGYILE  191



>ref|XP_668115.1| ribosomal protein S8 [Cryptosporidium hominis TU502]
Length=208

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 143/198 (72%), Gaps = 8/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HK RATGG+     KKRKYE+GR  +NTKL ++  VR +R RGGN K+RALR
Sbjct  1    MGISRDSRHKHRATGGRMPIVVKKRKYEMGRPASNTKLGASPRVRVVRCRGGNKKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD+GNYSWGS+ VTRK RI++VVYNASNNELVRT+TLVK+AIV +DA PF+Q+YLQ YGV
Sbjct  61   LDSGNYSWGSQGVTRKARIMEVVYNASNNELVRTKTLVKNAIVVIDATPFRQFYLQRYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++GR            + +    +  K S H+    + R     +D  +EEQFG GRL+A
Sbjct  121  ELGR--------RKNADEKSDEKDAQKASGHLLATRKARLMNNVIDPLVEEQFGIGRLLA  172

Query  578  CISSRPGQCGRADGYILE  631
            C+SSRPGQCGR DGYILE
Sbjct  173  CVSSRPGQCGRCDGYILE  190



>ref|XP_002142692.1| 40S ribosomal protein S8 [Cryptosporidium muris RN66]
 gb|EEA08343.1| 40S ribosomal protein S8, putative [Cryptosporidium muris RN66]
Length=209

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 148/198 (75%), Gaps = 7/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HK RATGG++    KKRKYELGR  +NTKL S + +R +R RGGN K+RALR
Sbjct  1    MGISRDSRHKHRATGGRRPITVKKRKYELGRPASNTKLGSPR-IRVVRCRGGNKKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD+GNYSWGS+ ++RKTRIL+VVYNASNNELVRT+TLVK+AIV +DA PF+Q+YLQHYGV
Sbjct  60   LDSGNYSWGSQGISRKTRILEVVYNASNNELVRTKTLVKNAIVVIDATPFRQYYLQHYGV  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++GR      ++  +++     A+    S HV    + R     +D  +EEQF  GRL+A
Sbjct  120  ELGR------RRNKSDDITDSRADIQSGSRHVLATKKARLDNNVIDPLVEEQFTIGRLLA  173

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGR DGYILE
Sbjct  174  CISSRPGQCGRCDGYILE  191



>gb|EKD00868.1| 40S ribosomal protein S8 [Trichosporon asahii var. asahii CBS 
8904]
Length=207

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 11/198 (6%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKR A+G ++  +RKKRK+ELGRQ A TKL + K +  +R RGGNVK+RA+R
Sbjct  1    MGISRDSRHKRSASGARRAHYRKKRKFELGRQAAMTKLDTTKRIHTVRTRGGNVKYRAIR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWGSEA TRKTR+L+V YN++NNEL+RTQTLVKSA+V+VDA PF+QWY  HY  
Sbjct  61   LDTGNFSWGSEATTRKTRLLNVRYNSTNNELLRTQTLVKSAVVEVDATPFRQWYEAHYAQ  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             + +           +      A+E KKSNHVQR L +R+K+ K+D+HLE+QF +GRL+A
Sbjct  121  PVTK-----------KGQAEAPADEGKKSNHVQRILAERKKDAKIDNHLEQQFRTGRLLA  169

Query  578  CISSRPGQCGRADGYILE  631
             I+SRPGQ GRADGYILE
Sbjct  170  MITSRPGQSGRADGYILE  187



>ref|XP_627792.1| 40S ribosomal protein S8 [Cryptosporidium parvum Iowa II]
 emb|CAD98279.1| ribosomal protein S8, probable [Cryptosporidium parvum]
 gb|EAK90051.1| 40S ribosomal protein S8 [Cryptosporidium parvum Iowa II]
Length=208

 Score =   203 bits (517),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 143/198 (72%), Gaps = 8/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HK RATGG+     KKRKYE+GR  +NTKL ++  VR +R RGGN K+RALR
Sbjct  1    MGISRDSRHKHRATGGRMPIVVKKRKYEMGRPASNTKLGASPRVRVVRCRGGNKKFRALR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD+GNYSWGS+ ++RK RI++VVYNASNNELVRT+TLVK+AIV +DA PF+Q+YLQ YGV
Sbjct  61   LDSGNYSWGSQGISRKARIMEVVYNASNNELVRTKTLVKNAIVVIDATPFRQFYLQRYGV  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
            ++GR            + +    +  K S H+    + R     +D  +EEQFG GRL+A
Sbjct  121  ELGR--------RKNADEKSDEKDAQKASGHLLATRKARLMNNVIDPLVEEQFGIGRLLA  172

Query  578  CISSRPGQCGRADGYILE  631
            C+SSRPGQCGR DGYILE
Sbjct  173  CVSSRPGQCGRCDGYILE  190



>ref|XP_001745896.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89320.1| predicted protein [Monosiga brevicollis MX1]
Length=222

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 144/197 (73%), Gaps = 5/197 (3%)
 Frame = +2

Query  41   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  220
            GISRD  HKRR TG +    R KRKYELGR PA TKL+  K V  IR  GGN K+RALRL
Sbjct  16   GISRDKFHKRRRTGARVAPIRMKRKYELGRPPALTKLAGPKRVHEIRTMGGNRKFRALRL  75

Query  221  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  400
            +TGN+SWGSE V+RKTR++DVVYNASNNELVRT+TLVK+AI+ VDA PFKQWY  HYG+ 
Sbjct  76   ETGNFSWGSEGVSRKTRLIDVVYNASNNELVRTKTLVKNAIIVVDATPFKQWYETHYGLP  135

Query  401  IGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMAC  580
            IG+      K    +     A     +SNH++RKLE+R+   K+D HLEEQF +GRL AC
Sbjct  136  IGK-----KKGGRNQSEVDEAILNKPRSNHLKRKLEERKAGAKVDVHLEEQFAAGRLYAC  190

Query  581  ISSRPGQCGRADGYILE  631
            +SSRPGQ GR DGYILE
Sbjct  191  VSSRPGQSGRCDGYILE  207



>gb|KHG07290.1| 40S ribosomal S8 [Gossypium arboreum]
 gb|KHG09567.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=156

 Score =   200 bits (508),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            +ELGRQP NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE+VTRKTRILDVVYNA
Sbjct  20   HELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKTRILDVVYNA  79

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  409
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+DIGR
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGR  117



>ref|XP_008871313.1| 40S ribosomal protein S8 [Aphanomyces invadans]
 gb|ETW00288.1| 40S ribosomal protein S8 [Aphanomyces invadans]
Length=205

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 154/198 (78%), Gaps = 11/198 (6%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL + K V  +RVRGGN K+RALR
Sbjct  1    MGISRDSKHKRRETGGKRKFFRKKRKFELGRQPANTKLGA-KRVNAVRVRGGNQKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWG+E ++ KTRIL V+YNASNNELVRT TLVK+AI+Q+DA PF+QWY  HYGV
Sbjct  60   LDTGNFSWGTEGISHKTRILIVLYNASNNELVRTNTLVKNAIIQIDAHPFRQWYEAHYGV  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             IG            +  EG A E  K+SNHVQRKL  RQ+ R+LD  L+EQF  GRL+A
Sbjct  120  KIG----------VKKSQEGEADEAAKQSNHVQRKLANRQRTRELDPRLDEQFVQGRLLA  169

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQ GRADGYILE
Sbjct  170  AISSRPGQSGRADGYILE  187



>gb|AFW61714.1| putative ribosomal protein S8e family protein [Zea mays]
Length=154

 Score =   199 bits (507),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDSMHKR+AT GK+KAWRKKRKYELGRQPANTKLSSNKTVRR+ VRGG VKWRAL+
Sbjct  1    MGISRDSMHKRQATSGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVYVRGGYVKWRALQ  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDT NYSWGSEA+TRKT ILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTCNYSWGSEALTRKTGILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  398  DIGR  409
            DIGR
Sbjct  121  DIGR  124



>ref|XP_009831251.1| 40S ribosomal protein S8 [Aphanomyces astaci]
 gb|ETV79410.1| 40S ribosomal protein S8 [Aphanomyces astaci]
Length=205

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 154/198 (78%), Gaps = 11/198 (6%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL + K V  +RVRGGN K+RALR
Sbjct  1    MGISRDSKHKRRETGGKRKFFRKKRKFELGRQPANTKLGA-KRVNPVRVRGGNQKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWG+EA++ KTRIL V+YNASNNELVRT TLVK+AI+Q+DA PF+QWY  HYGV
Sbjct  60   LDTGNFSWGTEAISHKTRILIVLYNASNNELVRTNTLVKNAIIQIDAHPFRQWYEAHYGV  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             IG            +  EG   E  K+S+HVQRKL  RQ+ R+LD  L+EQF  GRL+A
Sbjct  120  KIG----------VKKSQEGETEEAVKQSSHVQRKLATRQRTRELDPRLDEQFVQGRLLA  169

Query  578  CISSRPGQCGRADGYILE  631
             ISSRPGQ GRADGYILE
Sbjct  170  AISSRPGQSGRADGYILE  187



>ref|XP_003083062.1| RS8_MAIZE 40S ribosomal protein S8 pir||T04088 ribosomal protein 
S8-maize (ISS) [Ostreococcus tauri]
Length=388

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 128/172 (74%), Gaps = 7/172 (4%)
 Frame = +2

Query  116  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  295
            YELGRQPANTKLSSN TVR++R RGGNVK RALRLDTGNYSWGSE  TRKTRILDVVYNA
Sbjct  33   YELGRQPANTKLSSNVTVRQVRCRGGNVKHRALRLDTGNYSWGSENCTRKTRILDVVYNA  92

Query  296  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  475
            SNNELVRT+TLVKSA+V VDAAPF+ WY QHYG  IG        K            + 
Sbjct  93   SNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGKKIG-------IKVKNGAKVEEEDIDE  145

Query  476  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  631
            K+S  V  KL +R ++  ++S ++ QF +GRL+A ++SRPGQCGR DGYILE
Sbjct  146  KRSKSVTMKLRRRNRDHAVESAIDAQFSTGRLLAIVTSRPGQCGRCDGYILE  197



>gb|KFH71035.1| 40S ribosomal protein S8 [Mortierella verticillata NRRL 6337]
Length=204

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 147/198 (74%), Gaps = 7/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKR ATG K+  +RKKRK+ELGRQ ANTKL + K +  +R RGGN K+RA+R
Sbjct  1    MGISRDSRHKRNATGAKRAQYRKKRKFELGRQAANTKLGA-KRIHEVRTRGGNRKFRAMR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LD GN+SWGSEA++RKTRI+ VVYN+SNNELVRT TLVK+AIVQ+DA PF+QWY  HY  
Sbjct  60   LDAGNFSWGSEAISRKTRIVAVVYNSSNNELVRTSTLVKNAIVQIDATPFRQWYEAHYAT  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             IG      A+K               +SNHVQRK+E R+ E K+D+ L+ QF +GRL A
Sbjct  120  PIG------ARKGKGAVKTESEEVTKARSNHVQRKIEGRKAEAKVDAALDHQFAAGRLYA  173

Query  578  CISSRPGQCGRADGYILE  631
            C+SSRPGQ GRADGYILE
Sbjct  174  CLSSRPGQSGRADGYILE  191



>gb|KIO10111.1| hypothetical protein M404DRAFT_996068 [Pisolithus tinctorius 
Marx 270]
Length=212

 Score =   201 bits (510),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 150/198 (76%), Gaps = 8/198 (4%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISR S HKR ATG ++  +RKKRK+ELGRQPANTKL   K + R+RVRGGN K+RALR
Sbjct  1    MGISRSSRHKRSATGAQRAHYRKKRKFELGRQPANTKLGP-KRIHRVRVRGGNFKFRALR  59

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN++W SE  TRKTRI+ VVYNASNNELVRT TLV+ AI+QVDA PF+QWY  HY  
Sbjct  60   LDTGNFAWASEHTTRKTRIIGVVYNASNNELVRTNTLVQGAIIQVDATPFRQWYEAHYAQ  119

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             + +       K    +      E TK+SNH+QRKLE+R+K+ KLD  LE+QF +GRL A
Sbjct  120  PVTK-------KGAKAQATASGEEPTKRSNHLQRKLEERRKDSKLDLLLEQQFVAGRLYA  172

Query  578  CISSRPGQCGRADGYILE  631
            CISSRPGQCGRADGYILE
Sbjct  173  CISSRPGQCGRADGYILE  190



>gb|EJT52835.1| 40S ribosomal protein S8 [Trichosporon asahii var. asahii CBS 
2479]
Length=207

 Score =   201 bits (510),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 151/198 (76%), Gaps = 11/198 (6%)
 Frame = +2

Query  38   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  217
            MGISRDS HKR A+G ++  +RKKRK+ELGRQ A TKL + K +  +R RGGNVK+RA+R
Sbjct  1    MGISRDSRHKRSASGARRAHYRKKRKFELGRQAAMTKLDTTKRIHTVRTRGGNVKYRAIR  60

Query  218  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  397
            LDTGN+SWG EA TRKTR+L+V YN++NNEL+RTQTLVKSA+V+VDA PF+QWY  HY  
Sbjct  61   LDTGNFSWGYEATTRKTRLLNVRYNSTNNELLRTQTLVKSAVVEVDATPFRQWYEAHYAQ  120

Query  398  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  577
             + +           +      A+E KKSNHVQR L +R+K+ K+D+HLE+QF +GRL+A
Sbjct  121  PVTK-----------KGQAEAPADEGKKSNHVQRILAERKKDAKIDNHLEQQFRTGRLLA  169

Query  578  CISSRPGQCGRADGYILE  631
             I+SRPGQ GRADGYILE
Sbjct  170  MITSRPGQSGRADGYILE  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875