BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN008A11

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007013811.1|  Cytochrome bd ubiquinol oxidase, 14kDa subunit     147   4e-41   
gb|KHG06265.1|  Cytochrome b-c1 complex subunit 7                       146   7e-41   Gossypium arboreum [tree cotton]
ref|XP_006450499.1|  hypothetical protein CICLE_v10009887mg             145   2e-40   Citrus clementina [clementine]
ref|XP_006483311.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    145   2e-40   Citrus sinensis [apfelsine]
gb|ADB02891.1|  ubiquinol-cytochrome C reductase complex 14 kDa p...    145   2e-40   Jatropha curcas
ref|XP_011026489.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    144   3e-40   Populus euphratica
gb|ABK94034.1|  unknown                                                 143   5e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010048247.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     144   7e-40   Eucalyptus grandis [rose gum]
ref|XP_010048992.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    144   7e-40   Eucalyptus grandis [rose gum]
ref|XP_006371731.1|  hypothetical protein POPTR_0018s01370g             144   8e-40   Populus trichocarpa [western balsam poplar]
gb|ABK92701.1|  unknown                                                 144   8e-40   Populus trichocarpa [western balsam poplar]
ref|XP_004291494.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     143   1e-39   Fragaria vesca subsp. vesca
gb|KJB80690.1|  hypothetical protein B456_013G110700                    143   2e-39   Gossypium raimondii
ref|XP_002308646.2|  putative ubiquinol-cytochrome c reductase fa...    142   2e-39   
ref|XP_010254318.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     142   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006858921.1|  hypothetical protein AMTR_s00068p00053420          141   8e-39   Amborella trichopoda
ref|XP_011019762.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    141   9e-39   Populus euphratica
ref|XP_011081925.1|  PREDICTED: cytochrome b-c1 complex subunit 7       141   9e-39   Sesamum indicum [beniseed]
ref|XP_002872165.1|  predicted protein                                  140   1e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_010421394.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     140   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006286400.1|  hypothetical protein CARUB_v10002241mg             140   2e-38   Capsella rubella
ref|XP_008466386.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     142   2e-38   
emb|CDY05350.1|  BnaC02g40580D                                          140   2e-38   
ref|XP_009129963.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     140   2e-38   Brassica rapa
ref|XP_011085617.1|  PREDICTED: cytochrome b-c1 complex subunit 7       140   2e-38   Sesamum indicum [beniseed]
gb|KCW81433.1|  hypothetical protein EUGRSUZ_C02813                     139   2e-38   Eucalyptus grandis [rose gum]
ref|XP_009601498.1|  PREDICTED: cytochrome b-c1 complex subunit 7       140   2e-38   Nicotiana tomentosiformis
ref|XP_008802707.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    141   3e-38   
ref|XP_004136342.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    139   4e-38   Cucumis sativus [cucumbers]
ref|NP_001274887.1|  cytochrome b-c1 complex subunit 7                  139   4e-38   Solanum tuberosum [potatoes]
ref|XP_010249976.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    139   4e-38   Nelumbo nucifera [Indian lotus]
gb|ADY38691.1|  ubiquinol-cytochrome C reductase complex                139   5e-38   Camellia sinensis [black tea]
ref|XP_010110339.1|  Cytochrome b-c1 complex subunit 7                  139   5e-38   Morus notabilis
ref|XP_007225830.1|  hypothetical protein PRUPE_ppa013437mg             139   6e-38   Prunus persica
ref|XP_006394798.1|  hypothetical protein EUTSA_v10005137mg             139   7e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010526201.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    139   8e-38   Tarenaya hassleriana [spider flower]
ref|XP_010526202.1|  PREDICTED: cytochrome b-c1 complex subunit 7-1     137   1e-37   
ref|XP_010923367.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    138   1e-37   Elaeis guineensis
ref|NP_197927.1|  cytochrome bd ubiquinol oxidase                       138   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934817.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    137   2e-37   Elaeis guineensis
gb|EYU21947.1|  hypothetical protein MIMGU_mgv1a016385mg                137   3e-37   Erythranthe guttata [common monkey flower]
ref|XP_009334780.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     136   5e-37   Pyrus x bretschneideri [bai li]
ref|XP_010454872.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    136   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009403163.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    136   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY39888.1|  BnaC03g67290D                                          136   6e-37   Brassica napus [oilseed rape]
ref|XP_010432714.1|  PREDICTED: cytochrome b-c1 complex subunit 7-1     136   6e-37   Camelina sativa [gold-of-pleasure]
gb|AFK42990.1|  unknown                                                 136   6e-37   Lotus japonicus
ref|XP_008392137.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    136   6e-37   
gb|AEI83504.1|  ubiquinol-cytochrome C reductase complex 14kD sub...    136   6e-37   Wolffia arrhiza
ref|XP_004245191.1|  PREDICTED: cytochrome b-c1 complex subunit 7       136   7e-37   Solanum lycopersicum
ref|XP_004955785.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    136   8e-37   Setaria italica
ref|XP_009108873.1|  PREDICTED: cytochrome b-c1 complex subunit 7-1     135   9e-37   Brassica rapa
ref|XP_002459526.1|  hypothetical protein SORBIDRAFT_02g006120          135   1e-36   Sorghum bicolor [broomcorn]
gb|EYU29236.1|  hypothetical protein MIMGU_mgv1a016394mg                135   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_006392333.1|  hypothetical protein EUTSA_v10023759mg             135   1e-36   Eutrema salsugineum [saltwater cress]
emb|CDX68850.1|  BnaC01g06030D                                          135   1e-36   
ref|XP_006657543.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    135   2e-36   Oryza brachyantha
ref|XP_003588718.1|  Cytochrome b-c1 complex subunit                    135   2e-36   Medicago truncatula
gb|ACG38382.1|  ubiquinol-cytochrome c reductase complex 14 kDa p...    134   3e-36   Zea mays [maize]
ref|XP_010447382.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    134   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002867242.1|  hypothetical protein ARALYDRAFT_913201             134   3e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_002284960.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     134   3e-36   Vitis vinifera
ref|NP_194973.1|  Cytochrome bd ubiquinol oxidase                       134   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981358.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    134   4e-36   Setaria italica
ref|XP_004981353.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    134   4e-36   Setaria italica
ref|XP_009125952.1|  PREDICTED: cytochrome b-c1 complex subunit 7-1     134   5e-36   Brassica rapa
ref|XP_008671592.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    135   6e-36   
gb|EPS66003.1|  hypothetical protein M569_08777                         134   6e-36   Genlisea aurea
gb|ACZ54008.1|  ubiquinol-cytochrome C reductase complex 14kD sub...    133   8e-36   Wolffia arrhiza
ref|XP_003557405.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    133   8e-36   Brachypodium distachyon [annual false brome]
ref|XP_003564131.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    133   9e-36   Brachypodium distachyon [annual false brome]
ref|XP_008394045.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    132   1e-35   
ref|XP_006412471.1|  hypothetical protein EUTSA_v10026575mg             132   2e-35   Eutrema salsugineum [saltwater cress]
gb|EEC81709.1|  hypothetical protein OsI_25318                          132   2e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_006284767.1|  hypothetical protein CARUB_v10006035mg             132   2e-35   Capsella rubella
ref|NP_001059146.1|  Os07g0205000                                       134   2e-35   
ref|XP_010670700.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     132   3e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG26525.1|  ubiquinol-cytochrome c reductase complex 14 kDa p...    131   4e-35   Zea mays [maize]
emb|CDP04801.1|  unnamed protein product                                131   4e-35   Coffea canephora [robusta coffee]
ref|NP_001237139.1|  uncharacterized protein LOC100499867               131   5e-35   Glycine max [soybeans]
ref|XP_008644048.1|  PREDICTED: hypothetical protein isoform X1         131   7e-35   Zea mays [maize]
ref|XP_007162074.1|  hypothetical protein PHAVU_001G121500g             130   8e-35   Phaseolus vulgaris [French bean]
ref|XP_006600154.1|  PREDICTED: uncharacterized protein LOC100527...    130   9e-35   Glycine max [soybeans]
ref|XP_002324279.1|  putative ubiquinol-cytochrome c reductase fa...    130   9e-35   
ref|XP_004498653.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    130   1e-34   Cicer arietinum [garbanzo]
gb|ACN36794.1|  unknown                                                 129   2e-34   Zea mays [maize]
ref|XP_009416641.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    129   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK29857.1|  hypothetical protein AALP_AA7G187900                    129   3e-34   Arabis alpina [alpine rockcress]
ref|XP_006650761.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    129   5e-34   Oryza brachyantha
ref|NP_001170375.1|  ubiquinol-cytochrome c reductase complex pro...    128   8e-34   Zea mays [maize]
gb|ACG47614.1|  ubiquinol-cytochrome c reductase complex 14 kDa p...    128   1e-33   Zea mays [maize]
gb|EMT14168.1|  Cytochrome b-c1 complex subunit 7                       122   2e-31   
gb|ABQ42066.1|  ubiquinol-cytochrome C reductase complex 14 kDa p...    119   9e-31   Sonneratia caseolaris
gb|ABQ42065.1|  ubiquinol-cytochrome C reductase complex 14 kDa p...    119   1e-30   Sonneratia alba
ref|NP_001051639.1|  Os03g0806900                                       120   2e-30   
gb|ABK22110.1|  unknown                                                 119   3e-30   Picea sitchensis
gb|ACS68687.1|  ubiquinol-cytochrome C reductase complex 14 kDa p...    115   3e-29   Sonneratia alba
ref|XP_011026490.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    107   5e-26   Populus euphratica
gb|KDO61658.1|  hypothetical protein CISIN_1g033311mg                   107   7e-26   Citrus sinensis [apfelsine]
ref|XP_006450500.1|  hypothetical protein CICLE_v10009887mg             107   1e-25   
ref|XP_002515558.1|  Ubiquinol-cytochrome c reductase complex 14 ...    105   5e-25   
gb|KJB80691.1|  hypothetical protein B456_013G110700                    102   3e-24   Gossypium raimondii
gb|KJB80692.1|  hypothetical protein B456_013G110700                    103   4e-24   Gossypium raimondii
emb|CDY70525.1|  BnaAnng34010D                                          102   1e-23   Brassica napus [oilseed rape]
ref|NP_849484.1|  Cytochrome bd ubiquinol oxidase                       100   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KDD73783.1|  hypothetical protein H632_c1840p0                       100   4e-23   Helicosporidium sp. ATCC 50920
ref|NP_001190394.1|  cytochrome bd ubiquinol oxidase                  99.8    5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403171.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  99.0    9e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003588719.1|  Cytochrome b-c1 complex subunit                  98.6    1e-22   
ref|NP_001235489.1|  uncharacterized protein LOC100527652             98.2    2e-22   Glycine max [soybeans]
ref|XP_004981357.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  98.2    4e-22   
ref|XP_001777123.1|  predicted protein                                97.1    9e-22   
ref|XP_001754627.1|  predicted protein                                95.9    2e-21   
ref|XP_008779665.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  92.8    8e-21   
ref|NP_001169405.1|  hypothetical protein                             94.7    9e-21   Zea mays [maize]
ref|XP_005645464.1|  14 kDa subunit of cytochrome bd ubiquinol ox...  92.4    4e-20   Coccomyxa subellipsoidea C-169
gb|EMS59356.1|  Cytochrome b-c1 complex subunit 7                     92.4    8e-20   Triticum urartu
ref|XP_001782160.1|  predicted protein                                89.7    4e-19   
ref|XP_005851167.1|  hypothetical protein CHLNCDRAFT_33822            87.4    3e-18   Chlorella variabilis
ref|XP_002986903.1|  hypothetical protein SELMODRAFT_235141           87.0    4e-18   Selaginella moellendorffii
ref|XP_002977783.1|  hypothetical protein SELMODRAFT_228505           87.0    5e-18   Selaginella moellendorffii
ref|XP_003081235.1|  ubiquinol-cytochrome C reductase complex 14 ...  82.0    3e-16   Ostreococcus tauri
ref|XP_007510445.1|  predicted protein                                81.3    5e-16   Bathycoccus prasinos
ref|NP_001061357.1|  Os08g0246400                                     81.3    7e-16   
gb|EEC83182.1|  hypothetical protein OsI_28424                        80.9    8e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002502572.1|  mitochondrial tRNA import complex                80.9    8e-16   Micromonas commoda
ref|XP_001419785.1|  predicted protein                                79.0    4e-15   Ostreococcus lucimarinus CCE9901
ref|XP_010255680.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  78.2    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_011398978.1|  Cytochrome b-c1 complex subunit 7                75.9    5e-14   Auxenochlorella protothecoides
ref|XP_003059247.1|  mitochondrial tRNA import complex                75.9    5e-14   Micromonas pusilla CCMP1545
gb|KDO61659.1|  hypothetical protein CISIN_1g033311mg                 75.5    6e-14   Citrus sinensis [apfelsine]
ref|XP_010493801.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  74.7    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002945797.1|  hypothetical protein VOLCADRAFT_78796            74.3    2e-13   Volvox carteri f. nagariensis
ref|XP_001696308.1|  ubiquinol:cytochrome c oxidoreductase 14 kDa...  72.8    6e-13   Chlamydomonas reinhardtii
ref|XP_010107306.1|  Cytochrome b-c1 complex subunit 7                71.2    1e-12   
ref|XP_010494051.1|  PREDICTED: uncharacterized protein LOC104771252  71.6    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_008354902.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  70.1    4e-12   
gb|AFW67282.1|  hypothetical protein ZEAMMB73_980436                  70.1    5e-12   
ref|XP_009769317.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  65.5    1e-10   Nicotiana sylvestris
ref|XP_009605812.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  65.1    1e-10   Nicotiana tomentosiformis
gb|EEE68322.1|  hypothetical protein OsJ_26597                        62.4    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009636648.1|  PREDICTED: cytochrome b-c1 complex subunit 7     55.5    4e-07   Egretta garzetta
gb|KFP15525.1|  Cytochrome b-c1 complex subunit 7                     55.1    8e-07   Egretta garzetta
ref|XP_009556309.1|  PREDICTED: cytochrome b-c1 complex subunit 7     54.7    8e-07   Cuculus canorus
ref|XP_005027050.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  54.3    1e-06   
ref|XP_010195129.1|  PREDICTED: cytochrome b-c1 complex subunit 7     54.3    1e-06   Colius striatus
gb|KFO74045.1|  Cytochrome b-c1 complex subunit 7                     54.7    1e-06   Cuculus canorus
ref|XP_009467582.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.9    1e-06   Nipponia nippon
gb|EOA96045.1|  Cytochrome b-c1 complex subunit 7                     54.3    2e-06   Anas platyrhynchos [duck]
gb|EMC90685.1|  Cytochrome b-c1 complex subunit 7                     53.9    2e-06   
ref|XP_009505978.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.5    2e-06   Phalacrocorax carbo [common cormorant]
ref|XP_005499486.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  53.9    2e-06   
ref|XP_009085276.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.5    2e-06   
gb|KFR01718.1|  Cytochrome b-c1 complex subunit 7                     53.9    2e-06   Nipponia nippon
ref|XP_008937646.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.9    2e-06   Merops nubicus
gb|KFZ54353.1|  Cytochrome b-c1 complex subunit 7                     53.9    2e-06   Podiceps cristatus
gb|KGL98728.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Charadrius vociferus
ref|XP_010575383.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  53.1    3e-06   Haliaeetus leucocephalus
ref|XP_005231059.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  53.1    3e-06   Falco peregrinus [peregrine]
gb|KFO92935.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Buceros rhinoceros silvestris
gb|KFZ54545.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Antrostomus carolinensis
gb|KFM04960.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Aptenodytes forsteri
ref|XP_009273783.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.5    3e-06   
ref|XP_009489537.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.8    3e-06   Pelecanus crispus
ref|XP_010403256.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    3e-06   Corvus cornix cornix
gb|KFQ81797.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Phoenicopterus ruber ruber
gb|KFO10749.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Balearica regulorum gibbericeps
gb|KFO56846.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Corvus brachyrhynchos
ref|XP_009693581.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.8    4e-06   Cariama cristata
ref|XP_010004743.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    4e-06   Chaetura pelagica
ref|XP_010292664.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    4e-06   Phaethon lepturus
ref|NP_001232783.1|  cytochrome b-c1 complex subunit 7-like           53.1    4e-06   Taeniopygia guttata
gb|KFV69193.1|  Cytochrome b-c1 complex subunit 7                     53.1    4e-06   Picoides pubescens
ref|XP_005042381.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  52.4    5e-06   Ficedula albicollis
ref|XP_009890227.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    5e-06   Charadrius vociferus
ref|XP_005422967.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  52.4    5e-06   Geospiza fortis
gb|KFQ66398.1|  Cytochrome b-c1 complex subunit 7                     52.8    5e-06   Pelecanus crispus
gb|KFU96249.1|  Cytochrome b-c1 complex subunit 7                     52.8    5e-06   Chaetura pelagica
gb|EWM28744.1|  mitochondrial trna import complex                     53.5    5e-06   Nannochloropsis gaditana
ref|XP_010128833.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.4    5e-06   Chlamydotis macqueenii
ref|XP_005479545.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  52.4    6e-06   
ref|XP_009901258.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.8    6e-06   Picoides pubescens
ref|XP_008628958.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    6e-06   Corvus brachyrhynchos
gb|KFP62603.1|  Cytochrome b-c1 complex subunit 7                     52.8    6e-06   Cariama cristata
gb|KFQ33774.1|  Cytochrome b-c1 complex subunit 7                     52.8    7e-06   Mesitornis unicolor
ref|XP_009977162.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.4    8e-06   Tauraco erythrolophus
ref|XP_008608179.1|  hypothetical protein SDRG_04290                  52.4    8e-06   Saprolegnia diclina VS20
gb|KFV10010.1|  Cytochrome b-c1 complex subunit 7                     52.4    8e-06   Tauraco erythrolophus
ref|XP_008862571.1|  hypothetical protein H310_01284                  52.4    8e-06   Aphanomyces invadans
ref|XP_010180848.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.4    9e-06   Mesitornis unicolor
gb|KFP92467.1|  Cytochrome b-c1 complex subunit 7                     52.0    1e-05   Apaloderma vittatum
ref|XP_009875125.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.0    1e-05   Apaloderma vittatum
gb|KDO27696.1|  hypothetical protein SPRG_07325                       51.6    1e-05   Saprolegnia parasitica CBS 223.65
ref|XP_005517066.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  51.6    1e-05   Pseudopodoces humilis [Tibetan ground-jay]
dbj|BAN20761.1|  ubiquinol-cytochrome c reductase complex 14 kd p...  51.6    2e-05   Riptortus pedestris
pdb|3CWB|F  Chain F, Chicken Cytochrome Bc1 Complex Inhibited By ...  51.6    2e-05   Gallus gallus [bantam]
gb|KFW81092.1|  Cytochrome b-c1 complex subunit 7                     51.2    2e-05   Manacus vitellinus
ref|XP_008922299.1|  PREDICTED: cytochrome b-c1 complex subunit 7     51.2    3e-05   Manacus vitellinus
ref|XP_004940015.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.8    3e-05   
ref|XP_004940014.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.4    4e-05   
pdb|3H1H|F  Chain F, Cytochrome Bc1 Complex From Chicken              50.4    4e-05   Gallus gallus [bantam]
ref|XP_010707455.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.4    4e-05   
ref|XP_007547796.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.4    4e-05   Poecilia formosa
ref|XP_009674294.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.1    4e-05   Struthio camelus australis
ref|XP_005760154.1|  ubiquinol-cytochrome C reductase complex 14k...  50.4    5e-05   Emiliania huxleyi CCMP1516
gb|EHB12641.1|  Cytochrome b-c1 complex subunit 7                     50.4    5e-05   Heterocephalus glaber [naked mole rat]
ref|XP_009816014.1|  PREDICTED: cytochrome b-c1 complex subunit 7     49.7    6e-05   Gavia stellata
ref|XP_003386823.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.1    6e-05   Amphimedon queenslandica
gb|EDM07587.1|  rCG63535                                              49.3    6e-05   Rattus norvegicus [brown rat]
ref|XP_004645372.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.1    7e-05   
ref|XP_009821544.1|  hypothetical protein H257_00515                  49.7    7e-05   Aphanomyces astaci
gb|KFQ41982.1|  Cytochrome b-c1 complex subunit 7                     49.7    7e-05   Nestor notabilis
gb|KFP84293.1|  Cytochrome b-c1 complex subunit 7                     49.7    7e-05   Acanthisitta chloris
ref|XP_010009436.1|  PREDICTED: cytochrome b-c1 complex subunit 7     49.7    7e-05   Nestor notabilis
ref|XP_009076930.1|  PREDICTED: cytochrome b-c1 complex subunit 7     49.7    7e-05   Acanthisitta chloris
gb|KFV81894.1|  Cytochrome b-c1 complex subunit 7                     49.7    7e-05   Struthio camelus australis
ref|XP_004631617.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  49.7    8e-05   
ref|XP_418347.4|  PREDICTED: cytochrome b-c1 complex subunit 7-li...  50.4    8e-05   
gb|KFV45193.1|  Cytochrome b-c1 complex subunit 7                     49.7    9e-05   Gavia stellata
gb|AAB30496.1|  cytochrome-c reductase 14 kda subunit {P1 peptide...  48.1    1e-04   Solanum tuberosum [potatoes]
ref|XP_005150932.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  49.7    1e-04   
ref|XP_004995655.1|  ubiquinol-cytochrome C reductase                 49.3    1e-04   Salpingoeca rosetta
ref|XP_005797417.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  49.3    1e-04   Xiphophorus maculatus
ref|XP_004638531.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  49.3    1e-04   
ref|XP_005181276.1|  PREDICTED: cytochrome b-c1 complex subunit 7     48.9    1e-04   Musca domestica
ref|NP_001121025.1|  cytochrome b-c1 complex subunit 7                48.9    1e-04   Rattus norvegicus [brown rat]
ref|NP_080495.1|  cytochrome b-c1 complex subunit 7                   48.9    1e-04   Mus musculus [mouse]
ref|NP_001019613.1|  cytochrome b-c1 complex subunit 7                48.9    1e-04   Danio rerio [leopard danio]
ref|XP_009037032.1|  hypothetical protein AURANDRAFT_26379            48.5    1e-04   Aureococcus anophagefferens
gb|AAH31607.1|  Ubiquinol-cytochrome c reductase binding protein      48.9    2e-04   Mus musculus [mouse]
sp|Q9D855.3|QCR7_MOUSE  RecName: Full=Cytochrome b-c1 complex sub...  48.9    2e-04   Mus musculus [mouse]
ref|XP_002112931.1|  expressed hypothetical protein                   48.9    2e-04   Trichoplax adhaerens
ref|XP_004635428.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.5    2e-04   
ref|XP_003479958.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.5    2e-04   Cavia porcellus [guinea pig]
ref|XP_004474746.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.5    2e-04   Dasypus novemcinctus
ref|XP_004627307.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.5    3e-04   
gb|KFP07518.1|  Cytochrome b-c1 complex subunit 7                     47.8    3e-04   Calypte anna
ref|XP_006273293.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.8    3e-04   
ref|XP_004639579.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.1    3e-04   
emb|CDW54961.1|  cytochrome b c1 complex subunit 7                    48.1    3e-04   Trichuris trichiura
gb|EHH64317.1|  Ubiquinol-cytochrome c reductase complex 14 kDa p...  48.1    3e-04   Macaca fascicularis [crab eating macaque]
ref|XP_002160238.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.1    3e-04   Hydra vulgaris
ref|XP_004580673.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.1    3e-04   Ochotona princeps [southern American pika]
ref|XP_008500690.1|  PREDICTED: cytochrome b-c1 complex subunit 7     48.1    3e-04   
ref|XP_006130634.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.4    4e-04   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006130633.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.8    5e-04   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001505521.2|  PREDICTED: cytochrome b-c1 complex subunit 7     47.0    5e-04   
ref|XP_006727830.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    5e-04   Leptonychotes weddellii
ref|XP_002414334.1|  ubiquinol cytochrome C reductase, subunit QC...  47.0    5e-04   
pdb|1QCR|F  Chain F, Crystal Structure Of Bovine Mitochondrial Cy...  47.4    5e-04   Bos taurus [bovine]
gb|ACO13731.1|  Cytochrome b-c1 complex subunit 7                     47.4    5e-04   Esox lucius
pdb|1SQP|F  Chain F, Crystal Structure Analysis Of Bovine Bc1 Wit...  47.4    5e-04   Bos taurus [bovine]
ref|XP_007886092.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    6e-04   Callorhinchus milii [Australian ghost shark]
pdb|4D6T|F  Chain F, Cytochrome Bc1 Bound To The 4(1h)-pyridone G...  47.4    6e-04   Bos taurus [bovine]
gb|KFO35256.1|  Cytochrome b-c1 complex subunit 7                     47.4    6e-04   Fukomys damarensis [Damara mole rat]
pdb|1BGY|F  Chain F, Cytochrome Bc1 Complex From Bovine               47.4    6e-04   Bos taurus [bovine]
ref|XP_004529599.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.4    6e-04   Ceratitis capitata [medfly]
gb|EDL39149.1|  mCG8638                                               47.4    6e-04   Mus musculus [mouse]
ref|XP_003408450.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    6e-04   Loxodonta africana [African bush elephant]
ref|XP_010617892.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    7e-04   Fukomys damarensis [Damara mole rat]
ref|XP_003938798.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    7e-04   Saimiri boliviensis boliviensis
ref|XP_010373371.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  46.6    7e-04   Rhinopithecus roxellana
ref|XP_006037455.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    7e-04   Alligator sinensis
ref|XP_002732317.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    7e-04   Saccoglossus kowalevskii
ref|XP_002098712.1|  GE23784                                          47.0    7e-04   Drosophila yakuba
ref|XP_011138061.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    7e-04   Harpegnathos saltator
dbj|BAE01955.1|  unnamed protein product                              46.6    8e-04   Macaca fascicularis [crab eating macaque]
ref|XP_010902314.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.0    8e-04   Esox lucius
ref|XP_009066148.1|  hypothetical protein LOTGIDRAFT_197554           47.4    8e-04   Lottia gigantea
gb|EFN85398.1|  Cytochrome b-c1 complex subunit 7                     46.6    8e-04   Harpegnathos saltator
ref|XP_011198166.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.0    8e-04   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002060147.1|  GJ18506                                          47.0    9e-04   Drosophila virilis
gb|EHJ73854.1|  ubiquinol-cytochrome C reductase complex 14kD sub...  47.0    0.001   
ref|XP_007620668.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  46.2    0.001   



>ref|XP_007013811.1| Cytochrome bd ubiquinol oxidase, 14kDa subunit [Theobroma cacao]
 gb|EOY31430.1| Cytochrome bd ubiquinol oxidase, 14kDa subunit [Theobroma cacao]
Length=122

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/76 (95%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLP+DLQAMQTPFR+YLQDMLA+VKKERA
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHKYLPKDLQAMQTPFRSYLQDMLALVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>gb|KHG06265.1| Cytochrome b-c1 complex subunit 7 [Gossypium arboreum]
 gb|KJB83334.1| hypothetical protein B456_013G241600 [Gossypium raimondii]
Length=122

 Score =   146 bits (369),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/76 (95%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQ MQTPFR+YLQDMLA+VKKERA
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQKMQTPFRSYLQDMLALVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_006450499.1| hypothetical protein CICLE_v10009887mg [Citrus clementina]
 gb|ESR63739.1| hypothetical protein CICLE_v10009887mg [Citrus clementina]
Length=122

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+VK+E+A
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLALVKREKA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_006483311.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Citrus sinensis]
 gb|KDO61657.1| hypothetical protein CISIN_1g033311mg [Citrus sinensis]
Length=122

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFRNYLQDMLA+VK+E+A
Sbjct  47   IKEALDRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRNYLQDMLALVKREKA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>gb|ADB02891.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Jatropha 
curcas]
 gb|KDP33618.1| hypothetical protein JCGZ_07189 [Jatropha curcas]
Length=122

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/76 (95%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQA QTPFRNYLQDMLA+VK+ERA
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQARQTPFRNYLQDMLALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_011026489.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 isoform X1 [Populus 
euphratica]
Length=122

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +VKKERA
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLTLVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>gb|ABK94034.1| unknown [Populus trichocarpa]
Length=102

 Score =   143 bits (361),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +VKKERA
Sbjct  27   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLTLVKKERA  86

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  87   EREALGALPLYQRTIP  102



>ref|XP_010048247.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Eucalyptus grandis]
 gb|KCW80449.1| hypothetical protein EUGRSUZ_C01792 [Eucalyptus grandis]
 gb|KCW80450.1| hypothetical protein EUGRSUZ_C01792 [Eucalyptus grandis]
Length=122

 Score =   144 bits (362),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRLKRAMDLSMKH YLPE+LQAMQTPFR+YLQDMLA+VKKE++
Sbjct  47   VKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPENLQAMQTPFRSYLQDMLALVKKEKS  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_010048992.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Eucalyptus 
grandis]
 gb|KCW81434.1| hypothetical protein EUGRSUZ_C02813 [Eucalyptus grandis]
Length=122

 Score =   144 bits (362),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRLKRAMDLSMKH YLPE+LQAMQTPFR+YLQDML +VKKERA
Sbjct  47   VKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPENLQAMQTPFRSYLQDMLTLVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_006371731.1| hypothetical protein POPTR_0018s01370g [Populus trichocarpa]
 gb|ERP49528.1| hypothetical protein POPTR_0018s01370g [Populus trichocarpa]
Length=122

 Score =   144 bits (362),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +VKKERA
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLTLVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>gb|ABK92701.1| unknown [Populus trichocarpa]
Length=122

 Score =   144 bits (362),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREI+DARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA VK+ERA
Sbjct  47   IKEALNRLPREIIDARNQRLKRAMDLSMKHAYLPEDLQAMQTPFRSYLQEMLAFVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_004291494.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Fragaria vesca 
subsp. vesca]
Length=122

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPR+IVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA+VK+ERA
Sbjct  47   IKEALNRLPRQIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>gb|KJB80690.1| hypothetical protein B456_013G110700 [Gossypium raimondii]
Length=122

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIV+ARNQRLKRAMDLSMKH YLPE+LQ MQTPFR+YLQDMLA+VKKERA
Sbjct  47   IKEALNRLPREIVNARNQRLKRAMDLSMKHEYLPENLQQMQTPFRSYLQDMLALVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_002308646.2| putative ubiquinol-cytochrome c reductase family protein [Populus 
trichocarpa]
 gb|EEE92169.2| putative ubiquinol-cytochrome c reductase family protein [Populus 
trichocarpa]
Length=122

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREI+DARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA VK+ERA
Sbjct  47   IKEALNRLPREIIDARNQRLKRAMDLSMKHDYLPEDLQAMQTPFRSYLQEMLAFVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_010254318.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Nelumbo nucifera]
Length=123

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPREIVDARNQRLKRAMDLS+KH YLPEDLQAMQTPFR+YLQDMLA++KKERA
Sbjct  48   IKEALARLPREIVDARNQRLKRAMDLSLKHEYLPEDLQAMQTPFRSYLQDMLALIKKERA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_006858921.1| hypothetical protein AMTR_s00068p00053420 [Amborella trichopoda]
 gb|ERN20388.1| hypothetical protein AMTR_s00068p00053420 [Amborella trichopoda]
Length=123

 Score =   141 bits (355),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLPRE+VDARNQRLKRAMDLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKERA
Sbjct  48   IKEALDRLPREVVDARNQRLKRAMDLSMKHEYLPEDLQALQTPFRSYLRDMLAVVKKERA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQR+IP
Sbjct  108  EREALGALPLYQRSIP  123



>ref|XP_011019762.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Populus 
euphratica]
Length=122

 Score =   141 bits (355),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDAR+QRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA VK+ERA
Sbjct  47   IKEALNRLPREIVDARHQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLAFVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGA+PLYQRTIP
Sbjct  107  EREALGAMPLYQRTIP  122



>ref|XP_011081925.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Sesamum indicum]
Length=123

 Score =   141 bits (355),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA+VK+E A
Sbjct  48   VKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLALVKRENA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_002872165.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48424.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=122

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLP++LQAMQTPFR+YLQD+LA+VK+ERA
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPDNLQAMQTPFRSYLQDILALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_010421394.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Camelina sativa]
Length=122

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKE+LNRLPREIVDARNQRLKRAMDLSMKH YLP DLQA+QTPFR+YLQDMLA+VK+ERA
Sbjct  47   IKESLNRLPREIVDARNQRLKRAMDLSMKHEYLPADLQAVQTPFRSYLQDMLALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_006286400.1| hypothetical protein CARUB_v10002241mg [Capsella rubella]
 gb|EOA19298.1| hypothetical protein CARUB_v10002241mg [Capsella rubella]
Length=133

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLP DLQAMQTPFR+YLQDMLA+V++ER 
Sbjct  58   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPADLQAMQTPFRSYLQDMLALVRRERV  117

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  118  EREALGALPLYQRTIP  133



>ref|XP_008466386.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Cucumis melo]
Length=175

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQ MQTPFR+YLQ+MLA+VKKERA
Sbjct  100  VKEALNRLPREVVDARNQRLKRAMDLSMKHQYLPDDLQTMQTPFRSYLQEMLALVKKERA  159

Query  241  EREALGALPLYQRTIP  288
            ERE+LGALPLYQRTIP
Sbjct  160  ERESLGALPLYQRTIP  175



>emb|CDY05350.1| BnaC02g40580D [Brassica napus]
Length=123

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+VK+ERA
Sbjct  48   IKEALNRLPREVVDARNQRLKRAMDLSMKHEYLPDDLQAVQTPFRSYLQEMLALVKRERA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_009129963.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Brassica rapa]
Length=123

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+VK+ERA
Sbjct  48   IKEALNRLPREVVDARNQRLKRAMDLSMKHEYLPDDLQAVQTPFRSYLQEMLALVKRERA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_011085617.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Sesamum indicum]
Length=123

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLP+E+VDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA++KKE A
Sbjct  48   VKEALNRLPKEVVDARNQRLKRAMDLSMKHDYLPEDLQAMQTPFRSYLQEMLALIKKENA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>gb|KCW81433.1| hypothetical protein EUGRSUZ_C02813 [Eucalyptus grandis]
Length=89

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  70   ALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAERE  249
            ALNRLPREIVDARNQRLKRAMDLSMKH YLPE+LQAMQTPFR+YLQDML +VKKERAERE
Sbjct  17   ALNRLPREIVDARNQRLKRAMDLSMKHEYLPENLQAMQTPFRSYLQDMLTLVKKERAERE  76

Query  250  ALGALPLYQRTIP  288
            ALGALPLYQRTIP
Sbjct  77   ALGALPLYQRTIP  89



>ref|XP_009601498.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nicotiana tomentosiformis]
 ref|XP_009781040.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nicotiana sylvestris]
 ref|XP_009781041.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nicotiana sylvestris]
Length=123

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDAR QRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA+VK+ERA
Sbjct  48   VKEALNRLPREIVDARIQRLKRAMDLSMKHQYLPEDLQAMQTPFRSYLQEMLALVKRERA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_008802707.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like, partial 
[Phoenix dactylifera]
Length=185

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKERA
Sbjct  110  IKEALARLPREVVDARNQRLKRAMDLSMKHEYLPEDLQALQTPFRSYLKDMLALVKKERA  169

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  170  EREALGALPLYQRTIP  185



>ref|XP_004136342.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Cucumis 
sativus]
 ref|XP_004162051.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Cucumis 
sativus]
 gb|KGN60115.1| hypothetical protein Csa_3G878840 [Cucumis sativus]
Length=122

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL+RLPREIVDARNQRLKRAMDLSMKH YLP++LQAMQTPFR+YLQ+MLA+VKKERA
Sbjct  47   VKEALDRLPREIVDARNQRLKRAMDLSMKHQYLPDNLQAMQTPFRSYLQEMLALVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPL+QRTIP
Sbjct  107  EREALGALPLFQRTIP  122



>ref|NP_001274887.1| cytochrome b-c1 complex subunit 7 [Solanum tuberosum]
 sp|P48502.1|QCR7_SOLTU RecName: Full=Cytochrome b-c1 complex subunit 7; AltName: Full=CR14; 
AltName: Full=Complex III subunit 7; AltName: Full=Complex 
III subunit VII; AltName: Full=Ubiquinol-cytochrome c 
reductase complex 14 kDa protein [Solanum tuberosum]
 emb|CAA55863.1| ubiquinol--cytochrome c reductase [Solanum tuberosum]
Length=123

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRL RAMDLSMKH YLPEDLQAMQTPFRNYLQ+MLA+VK+E A
Sbjct  48   VKEALNRLPREIVDARNQRLLRAMDLSMKHQYLPEDLQAMQTPFRNYLQEMLALVKRESA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  108  EREALGALPLYQRTLP  123



>ref|XP_010249976.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Nelumbo 
nucifera]
Length=123

 Score =   139 bits (350),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPREIVDAR QRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDML +VKKERA
Sbjct  48   IKEALARLPREIVDARIQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLTLVKKERA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>gb|ADY38691.1| ubiquinol-cytochrome C reductase complex [Camellia sinensis]
Length=123

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRLKRAMDLSMKH YLPE LQAMQTP+R+YLQDMLA+VK+E A
Sbjct  48   VKEALNRLPREIVDARNQRLKRAMDLSMKHDYLPEHLQAMQTPYRSYLQDMLALVKRENA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_010110339.1| Cytochrome b-c1 complex subunit 7 [Morus notabilis]
 gb|EXC26026.1| Cytochrome b-c1 complex subunit 7 [Morus notabilis]
Length=122

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDAR+QRLKRAMDLSMKH YL EDLQAMQTPFR+YLQ+MLA+VK+ERA
Sbjct  47   VKEALNRLPREIVDARHQRLKRAMDLSMKHQYLAEDLQAMQTPFRSYLQEMLALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQR+IP
Sbjct  107  EREALGALPLYQRSIP  122



>ref|XP_007225830.1| hypothetical protein PRUPE_ppa013437mg [Prunus persica]
 ref|XP_008219895.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Prunus mume]
 gb|EMJ27029.1| hypothetical protein PRUPE_ppa013437mg [Prunus persica]
Length=122

 Score =   139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPE LQA QTPFR+YLQ+MLA+VK+E+A
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEHLQAQQTPFRSYLQEMLALVKREKA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_006394798.1| hypothetical protein EUTSA_v10005137mg [Eutrema salsugineum]
 gb|ESQ32084.1| hypothetical protein EUTSA_v10005137mg [Eutrema salsugineum]
Length=122

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRA+DLSMKH YLP++LQAMQTPFR+YLQ+MLA+VK+ERA
Sbjct  47   IKEALNRLPREIVDARNQRLKRALDLSMKHEYLPDNLQAMQTPFRSYLQEMLALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_010526201.1| PREDICTED: cytochrome b-c1 complex subunit 7-1-like [Tarenaya 
hassleriana]
Length=122

 Score =   139 bits (349),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPREI+DARNQRLKRAMDLSMKH YLP+DLQAMQTPFR+YLQ+MLA+VK+E+A
Sbjct  47   IKEAMNRLPREIIDARNQRLKRAMDLSMKHEYLPKDLQAMQTPFRSYLQEMLALVKREKA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT P
Sbjct  107  EREALGALPLYQRTFP  122



>ref|XP_010526202.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Tarenaya hassleriana]
Length=104

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPREI+DARNQRLKRAMDLSMKH YLP+DLQAMQTPFR+YLQ+MLA+VKKE+A
Sbjct  29   IKEAMNRLPREIIDARNQRLKRAMDLSMKHEYLPKDLQAMQTPFRSYLQEMLALVKKEKA  88

Query  241  EREALGALPLYQRTIP  288
            ERE LGALPLYQRT P
Sbjct  89   ERETLGALPLYQRTFP  104



>ref|XP_010923367.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Elaeis guineensis]
Length=128

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRA+DLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKERA
Sbjct  53   IKEALVRLPREVVDARNQRLKRALDLSMKHEYLPEDLQALQTPFRSYLKDMLALVKKERA  112

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  113  EREALGALPLYQRTIP  128



>ref|NP_197927.1| cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
 sp|F4JWS8.1|QCR72_ARATH RecName: Full=Cytochrome b-c1 complex subunit 7-2; AltName: Full=Complex 
III subunit VII [Arabidopsis thaliana]
 gb|AED93444.1| cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
Length=122

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRL RAMDLSMKH YLP++LQA+QTPFR+YLQDMLA+VK+ERA
Sbjct  47   IKEALNRLPREIVDARNQRLMRAMDLSMKHEYLPDNLQAVQTPFRSYLQDMLALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_010934817.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Elaeis guineensis]
Length=126

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRA+DLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKERA
Sbjct  51   IKEALARLPREVVDARNQRLKRALDLSMKHEYLPEDLQALQTPFRSYLKDMLALVKKERA  110

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQR IP
Sbjct  111  EREALGALPLYQRNIP  126



>gb|EYU21947.1| hypothetical protein MIMGU_mgv1a016385mg [Erythranthe guttata]
Length=123

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRLKRAMDLSMKH YLP DLQAMQTPFR YLQ+MLA+VK+E A
Sbjct  48   VKEALNRLPREIVDARNQRLKRAMDLSMKHDYLPADLQAMQTPFRTYLQEMLALVKRENA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  108  EREALGALPLYQRTLP  123



>ref|XP_009334780.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Pyrus x bretschneideri]
 ref|XP_009345290.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Pyrus x bretschneideri]
Length=122

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLPREIVDARNQRLKRAMDLSMKH YLP+ LQA QTPFR+YLQ+ML +VKKERA
Sbjct  47   IKEALSRLPREIVDARNQRLKRAMDLSMKHEYLPDHLQAQQTPFRSYLQEMLTLVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>ref|XP_010454872.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Camelina 
sativa]
Length=122

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKE+LNRLP+EIVDARNQRLKRAMDLSMKH YLP DLQA+QTPFR+YLQDMLA+VK+ERA
Sbjct  47   IKESLNRLPKEIVDARNQRLKRAMDLSMKHEYLPADLQAVQTPFRSYLQDMLALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQ TIP
Sbjct  107  EREALGALPLYQITIP  122



>ref|XP_009403163.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=123

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRA+DLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKE A
Sbjct  48   IKEALARLPREVVDARNQRLKRAIDLSMKHEYLPEDLQALQTPFRSYLKDMLALVKKENA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALP+YQRTIP
Sbjct  108  EREALGALPVYQRTIP  123



>emb|CDY39888.1| BnaC03g67290D [Brassica napus]
Length=122

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+V++ER 
Sbjct  47   IKEALNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRSYLQEMLALVERERK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|XP_010432714.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Camelina sativa]
 ref|XP_010437908.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Camelina sativa]
Length=122

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQAMQTPFR YLQDMLA+V++E  
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAMQTPFRGYLQDMLALVERESK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>gb|AFK42990.1| unknown [Lotus japonicus]
Length=122

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLP+E+VDAR+ RLKRA+DLSMKH YLPEDLQAMQTPFR+YLQDML  VKKERA
Sbjct  47   IKEALNRLPKEVVDARHARLKRAIDLSMKHEYLPEDLQAMQTPFRSYLQDMLTFVKKERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALG LPLYQRT+P
Sbjct  107  EREALGGLPLYQRTLP  122



>ref|XP_008392137.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Malus domestica]
 ref|XP_008392138.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Malus domestica]
Length=122

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLPREIVDARNQRLKRAMDLSMKH YLPE LQA QTPFR+YLQ+MLA+VK+ER 
Sbjct  47   IKEALSRLPREIVDARNQRLKRAMDLSMKHEYLPEHLQAQQTPFRSYLQEMLALVKRERE  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>gb|AEI83504.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Wolffia 
arrhiza]
Length=122

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPREIVDARNQRLKRAMDLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKE+A
Sbjct  47   IKEALARLPREIVDARNQRLKRAMDLSMKHDYLPEDLQALQTPFRSYLRDMLALVKKEKA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGA PLYQRTIP
Sbjct  107  EREALGAPPLYQRTIP  122



>ref|XP_004245191.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Solanum lycopersicum]
Length=123

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRL RAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +VK+E A
Sbjct  48   VKEALNRLPREIVDARNQRLLRAMDLSMKHQYLPEDLQAMQTPFRSYLQEMLTLVKRESA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  108  EREALGALPLYQRTLP  123



>ref|XP_004955785.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Setaria 
italica]
Length=123

 Score =   136 bits (342),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLPRE+VDARNQRLKRAMDLSMKH YLP+++QA+QTPFR+YL DMLA+VKKE+A
Sbjct  48   IKEALSRLPREVVDARNQRLKRAMDLSMKHKYLPDEVQAIQTPFRSYLSDMLALVKKEKA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_009108873.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Brassica rapa]
 emb|CDY23327.1| BnaA08g12190D [Brassica napus]
Length=122

 Score =   135 bits (341),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+V++ER 
Sbjct  47   IKEALNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRSYLQEMLALVERERK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|XP_002459526.1| hypothetical protein SORBIDRAFT_02g006120 [Sorghum bicolor]
 gb|EER96047.1| hypothetical protein SORBIDRAFT_02g006120 [Sorghum bicolor]
Length=123

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLP+D+QA+QTPFR+YL DMLA+VKKE A
Sbjct  48   IKEALARLPREVVDARNQRLKRAMDLSMKHKYLPDDVQAIQTPFRSYLSDMLALVKKESA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>gb|EYU29236.1| hypothetical protein MIMGU_mgv1a016394mg [Erythranthe guttata]
 gb|EYU29237.1| hypothetical protein MIMGU_mgv1a016394mg [Erythranthe guttata]
 gb|EYU29238.1| hypothetical protein MIMGU_mgv1a016394mg [Erythranthe guttata]
Length=123

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+NRLPREIVDARNQRLKRAMDLSMKH YLP+DLQ MQTPFR+YLQ+MLA VK+E+A
Sbjct  48   VKEAMNRLPREIVDARNQRLKRAMDLSMKHQYLPDDLQRMQTPFRSYLQEMLAFVKREQA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT P
Sbjct  108  EREALGALPLYQRTFP  123



>ref|XP_006392333.1| hypothetical protein EUTSA_v10023759mg [Eutrema salsugineum]
 gb|ESQ29619.1| hypothetical protein EUTSA_v10023759mg [Eutrema salsugineum]
Length=122

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQ+MLA+V++ER 
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQEMLALVERERL  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>emb|CDX68850.1| BnaC01g06030D [Brassica napus]
Length=122

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPRE+VDARNQRLKRAMDLSMKH YLPEDLQA+QTPFR YL++MLA+V++ER 
Sbjct  47   IKEALNRLPREVVDARNQRLKRAMDLSMKHEYLPEDLQAVQTPFRGYLKEMLALVERERK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|XP_006657543.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Oryza brachyantha]
Length=123

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLP D+QA+QTPFR YL DMLA+VKKE A
Sbjct  48   IKEALGRLPREVVDARNQRLKRAMDLSMKHQYLPADVQAIQTPFRGYLSDMLALVKKEAA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_003588718.1| Cytochrome b-c1 complex subunit [Medicago truncatula]
 gb|ACJ84014.1| unknown [Medicago truncatula]
 gb|AES58969.1| cytochrome B-c1 complex subunit 7 [Medicago truncatula]
 gb|AFK47778.1| unknown [Medicago truncatula]
Length=122

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLP+E+VDAR+ RLKRA+DLSMKH YLPEDLQAMQTPFR+YLQDML  VK+ERA
Sbjct  47   IKEALNRLPKEVVDARHARLKRAIDLSMKHEYLPEDLQAMQTPFRSYLQDMLTFVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALG LPLYQRT+P
Sbjct  107  EREALGGLPLYQRTLP  122



>gb|ACG38382.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
 gb|ACG46014.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
Length=123

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLP+D+QA+QTPFR+YL DMLA+VKKE A
Sbjct  48   IKEALARLPREVVDARNQRLKRAMDLSMKHQYLPDDVQAIQTPFRSYLFDMLALVKKESA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_010447382.1| PREDICTED: cytochrome b-c1 complex subunit 7-1-like [Camelina 
sativa]
Length=122

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPRE+VDARNQRLKRAMDLS+KH YLP+DLQAMQTPFR YLQDMLA+V++E  
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSVKHEYLPKDLQAMQTPFRGYLQDMLALVERESK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|XP_002867242.1| hypothetical protein ARALYDRAFT_913201 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43501.1| hypothetical protein ARALYDRAFT_913201 [Arabidopsis lyrata subsp. 
lyrata]
Length=122

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQDMLA+V++E  
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQDMLALVERESK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|XP_002284960.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Vitis vinifera]
 emb|CBI20998.3| unnamed protein product [Vitis vinifera]
Length=122

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDAR+QRLKRA+DLSMKH YL EDLQAMQTPFR+YLQ+MLA+VK+E A
Sbjct  47   IKEALNRLPREIVDARHQRLKRAIDLSMKHEYLAEDLQAMQTPFRSYLQEMLALVKRENA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|NP_194973.1| Cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
 sp|Q9SUU5.1|QCR71_ARATH RecName: Full=Cytochrome b-c1 complex subunit 7-1; AltName: Full=Complex 
III subunit VII [Arabidopsis thaliana]
 gb|AAG40060.1|AF324709_1 AT4g32470 [Arabidopsis thaliana]
 gb|AAG41456.1|AF326874_1 putative ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
 gb|AAK00377.1|AF339695_1 putative ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
 gb|AAK32851.1|AF361839_1 AT4g32470/F8B4_170 [Arabidopsis thaliana]
 emb|CAA22574.1| ubiquinol-cytochrome c reductase-like protein [Arabidopsis thaliana]
 emb|CAB79964.1| ubiquinol-cytochrome c reductase-like protein [Arabidopsis thaliana]
 gb|AAL47417.1| AT4g32470/F8B4_170 [Arabidopsis thaliana]
 gb|AAM64883.1| ubiquinol-cytochrome c reductase-like protein [Arabidopsis thaliana]
 gb|AEE86065.1| Cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
Length=122

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQDMLA+V++E  
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQDMLALVERESK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|XP_004981358.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X2 
[Setaria italica]
Length=126

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR QRLKR+MDLSMKH YLPEDLQA+QTPFR YL DMLA+VKKE A
Sbjct  51   IKEALGRLPREVVDARIQRLKRSMDLSMKHQYLPEDLQAVQTPFRGYLSDMLALVKKENA  110

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  111  EREALGALPLYQRTIP  126



>ref|XP_004981353.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Setaria italica]
Length=126

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR QRLKR+MDLSMKH YLPEDLQA+QTPFR YL DMLA+VKKE A
Sbjct  51   IKEALGRLPREVVDARIQRLKRSMDLSMKHQYLPEDLQAVQTPFRGYLSDMLALVKKENA  110

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  111  EREALGALPLYQRTIP  126



>ref|XP_009125952.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Brassica rapa]
 emb|CDX75248.1| BnaA01g04540D [Brassica napus]
Length=122

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YL++MLA+V++ER 
Sbjct  47   IKEALNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLKEMLALVERERK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|XP_008671592.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like, partial 
[Zea mays]
Length=173

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLP+D+QA+QTPFR+YL DMLA+VKKE A
Sbjct  98   IKEALARLPREVVDARNQRLKRAMDLSMKHQYLPDDVQAIQTPFRSYLFDMLALVKKESA  157

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  158  EREALGALPLYQRTIP  173



>gb|EPS66003.1| hypothetical protein M569_08777 [Genlisea aurea]
Length=123

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLP E+V ARNQRLKRAMDLSMKH YLPE+LQAMQTPFR+YLQ MLA+VK+ERA
Sbjct  48   IKEALNRLPNEVVLARNQRLKRAMDLSMKHEYLPENLQAMQTPFRSYLQPMLALVKRERA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>gb|ACZ54008.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Wolffia 
arrhiza]
Length=124

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPREIV ARNQRLKRAMDLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKE+A
Sbjct  49   IKEALARLPREIVHARNQRLKRAMDLSMKHDYLPEDLQALQTPFRSYLRDMLALVKKEKA  108

Query  241  EREALGALPLYQRTIP  288
            EREALGA PLYQRTIP
Sbjct  109  EREALGAPPLYQRTIP  124



>ref|XP_003557405.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Brachypodium 
distachyon]
Length=123

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLP+D++A+QTPFR+YL DMLA+VKKERA
Sbjct  48   IKEALARLPREVVDARNQRLKRAMDLSMKHQYLPDDVKALQTPFRSYLADMLALVKKERA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLY+RT+P
Sbjct  108  EREALGALPLYERTLP  123



>ref|XP_003564131.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Brachypodium 
distachyon]
Length=126

 Score =   133 bits (335),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR+QRLKRAMDLSMKH YLP+DLQA+QTPFR+YL DMLA+VKKE A
Sbjct  51   IKEALGRLPREVVDARHQRLKRAMDLSMKHQYLPDDLQALQTPFRSYLTDMLALVKKEAA  110

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLY+RT+P
Sbjct  111  EREALGALPLYERTLP  126



>ref|XP_008394045.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Malus domestica]
 ref|XP_008352052.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Malus domestica]
Length=122

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLPREIVDARNQRLKRAMDLSMKH YLP+ LQA QTPFR+YLQ+ML +VKKE A
Sbjct  47   IKEALSRLPREIVDARNQRLKRAMDLSMKHEYLPDHLQAQQTPFRSYLQEMLTLVKKESA  106

Query  241  EREALGALPLYQRTIP  288
            ERE LGALPLYQRTIP
Sbjct  107  EREXLGALPLYQRTIP  122



>ref|XP_006412471.1| hypothetical protein EUTSA_v10026575mg [Eutrema salsugineum]
 gb|ESQ53924.1| hypothetical protein EUTSA_v10026575mg [Eutrema salsugineum]
Length=122

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQ  QTPFR YLQ+MLA+V++ER 
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQEKQTPFRGYLQEMLALVERERK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  107  EREALGALPLYQRTIP  122



>gb|EEC81709.1| hypothetical protein OsI_25318 [Oryza sativa Indica Group]
 gb|EEE66772.1| hypothetical protein OsJ_23497 [Oryza sativa Japonica Group]
Length=123

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLP D QA QTPFR YL DMLA+VKKE A
Sbjct  48   IKEALARLPREVVDARNQRLKRAMDLSMKHQYLPADAQAKQTPFRGYLSDMLALVKKESA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  108  EREALGALPLYQRTIP  123



>ref|XP_006284767.1| hypothetical protein CARUB_v10006035mg [Capsella rubella]
 gb|EOA17665.1| hypothetical protein CARUB_v10006035mg [Capsella rubella]
Length=122

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQ+MLA+V++E  
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQEMLALVERESK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|NP_001059146.1| Os07g0205000 [Oryza sativa Japonica Group]
 dbj|BAF21060.1| Os07g0205000 [Oryza sativa Japonica Group]
Length=175

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLP D QA QTPFR YL DMLA+VKKE A
Sbjct  100  IKEALARLPREVVDARNQRLKRAMDLSMKHQYLPADAQAKQTPFRGYLSDMLALVKKESA  159

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  160  EREALGALPLYQRTIP  175



>ref|XP_010670700.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Beta vulgaris 
subsp. vulgaris]
Length=128

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLPREIVDARNQRLKRA+DLSMKH YL +DLQAMQTPFR+Y+Q+MLA+VK+ER 
Sbjct  53   IKEALDRLPREIVDARNQRLKRAIDLSMKHEYLTDDLQAMQTPFRSYIQEMLALVKRERE  112

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQR+IP
Sbjct  113  EREALGALPLYQRSIP  128



>gb|ACG26525.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
Length=123

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLP+D+QA+QTPFR+YL DMLA+VKKE A
Sbjct  48   IKEALARLPREVVDARNQRLKRAMDLSMKHQYLPDDVQAIQTPFRSYLFDMLALVKKESA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQ TIP
Sbjct  108  EREALGALPLYQITIP  123



>emb|CDP04801.1| unnamed protein product [Coffea canephora]
Length=122

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPR IVDARNQRLKRAMDLS+KH YLPEDLQ  QTPFR+YLQ+MLA+VK+ERA
Sbjct  47   IKEALNRLPRPIVDARNQRLKRAMDLSLKHQYLPEDLQVQQTPFRSYLQEMLALVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGA PLYQRT+P
Sbjct  107  EREALGAQPLYQRTLP  122



>ref|NP_001237139.1| uncharacterized protein LOC100499867 [Glycine max]
 gb|ACU13972.1| unknown [Glycine max]
Length=122

 Score =   131 bits (330),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLP+E+VDAR+ RLKRA+DLSMKH YLP++LQAMQTPFR YLQDML +VK+ERA
Sbjct  47   VKEALNRLPKEVVDARHARLKRAIDLSMKHEYLPDNLQAMQTPFRGYLQDMLTLVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALG LPLYQR+IP
Sbjct  107  EREALGGLPLYQRSIP  122



>ref|XP_008644048.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG46882.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
 gb|AFW67284.1| ubiquinol-cytochrome c reductase complex protein [Zea mays]
Length=126

 Score =   131 bits (329),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+VKKE A
Sbjct  51   IKEALGRLPREVVDARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLSDMLALVKKENA  110

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  111  EREALGALPLYQRTLP  126



>ref|XP_007162074.1| hypothetical protein PHAVU_001G121500g [Phaseolus vulgaris]
 gb|ESW34068.1| hypothetical protein PHAVU_001G121500g [Phaseolus vulgaris]
Length=122

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLP+E+VDAR+ RLKRA+DLSMKH YLP+DLQAMQTPFR YLQDML +VK+ERA
Sbjct  47   VKEALNRLPKEVVDARHARLKRAIDLSMKHQYLPDDLQAMQTPFRGYLQDMLTLVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            ER ALG LPLYQR+IP
Sbjct  107  ERVALGGLPLYQRSIP  122



>ref|XP_006600154.1| PREDICTED: uncharacterized protein LOC100527652 isoform X1 [Glycine 
max]
 gb|KHN06657.1| Cytochrome b-c1 complex subunit 7 [Glycine soja]
Length=122

 Score =   130 bits (328),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLP+E+VDAR+ RLKRA+DLSMKH YLP++LQ+MQTPFR YLQDML +VK+ERA
Sbjct  47   VKEALNRLPKEVVDARHARLKRAIDLSMKHEYLPDNLQSMQTPFRGYLQDMLTLVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            EREALG LPLYQR+IP
Sbjct  107  EREALGGLPLYQRSIP  122



>ref|XP_002324279.1| putative ubiquinol-cytochrome c reductase family protein [Populus 
trichocarpa]
 gb|EEF02844.1| putative ubiquinol-cytochrome c reductase family protein [Populus 
trichocarpa]
Length=118

 Score =   130 bits (327),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 4/76 (5%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +    RA
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLTL----RA  102

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  103  EREALGALPLYQRTIP  118



>ref|XP_004498653.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Cicer arietinum]
Length=122

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLP+E+VDAR+ RLKRA+DLS+KH YLPEDLQAMQTPFR YLQ+ML  VK+E+A
Sbjct  47   IKEALNRLPKEVVDARHARLKRAIDLSLKHEYLPEDLQAMQTPFRGYLQEMLTFVKREKA  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT P
Sbjct  107  EREALGALPLYQRTFP  122



>gb|ACN36794.1| unknown [Zea mays]
Length=102

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+VKKE A
Sbjct  27   IKEALGRLPREVVDARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLSDMLALVKKESA  86

Query  241  EREALGALPLYQRTIP  288
            ER++LGALPLYQRT+P
Sbjct  87   ERQSLGALPLYQRTLP  102



>ref|XP_009416641.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Musa acuminata 
subsp. malaccensis]
Length=123

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IK AL RLPRE+VDARNQRLKRA+DLS KH YLPEDLQA+QTPFR+YL+DMLA+VKKE A
Sbjct  48   IKVALARLPREVVDARNQRLKRAIDLSTKHEYLPEDLQALQTPFRSYLKDMLALVKKENA  107

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQR+ P
Sbjct  108  EREALGALPLYQRSFP  123



>gb|KFK29857.1| hypothetical protein AALP_AA7G187900 [Arabis alpina]
Length=122

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEA+NRLPRE+VDARNQRLKRAMDLSMKH YL +DLQA+QTPFR YLQ+MLA+V++E  
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLSKDLQAVQTPFRGYLQEMLALVQREAK  106

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRT+P
Sbjct  107  EREALGALPLYQRTLP  122



>ref|XP_006650761.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Oryza brachyantha]
Length=126

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDARNQRLKRAMDLSMKH YLPED QA+QTPFR YL DM+ +VKKER 
Sbjct  51   IKEALERLPREVVDARNQRLKRAMDLSMKHQYLPEDFQAVQTPFRGYLSDMMDLVKKERL  110

Query  241  EREALGALPLYQRTIP  288
            ERE LGALPL+QRT+P
Sbjct  111  EREELGALPLHQRTLP  126



>ref|NP_001170375.1| ubiquinol-cytochrome c reductase complex protein [Zea mays]
 gb|ACG35659.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
 tpg|DAA52033.1| TPA: ubiquinol-cytochrome c reductase complex protein [Zea mays]
Length=126

 Score =   128 bits (322),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+VKKE A
Sbjct  51   IKEALGRLPREVVDARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLGDMLALVKKESA  110

Query  241  EREALGALPLYQRTIP  288
            ER++LGALPLYQRT+P
Sbjct  111  ERQSLGALPLYQRTLP  126



>gb|ACG47614.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
Length=123

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+VKKE A
Sbjct  48   IKEALGRLPREVVDARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLGDMLALVKKESA  107

Query  241  EREALGALPLYQRTIP  288
            ER++LGALPLYQRT+P
Sbjct  108  ERQSLGALPLYQRTLP  123



>gb|EMT14168.1| Cytochrome b-c1 complex subunit 7 [Aegilops tauschii]
Length=126

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+ DAR+ RLKRAMDLSMKH YLP+D++A+QTPF++YL DMLA+VKKE A
Sbjct  51   IKEALGRLPREVGDARHPRLKRAMDLSMKHQYLPDDVRALQTPFKSYLSDMLALVKKEAA  110

Query  241  EREALGALPLYQRTIP  288
            ER+ALGALPLY+RT+P
Sbjct  111  ERKALGALPLYERTLP  126



>gb|ABQ42066.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
caseolaris]
Length=92

 Score =   119 bits (299),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+VKKERA
Sbjct  31   VKEALNRLPREIVDARNQRLKRAMDLSMKHQYLPEDLQAMQTPFRSYLQDMLALVKKERA  90

Query  241  ER  246
            ER
Sbjct  91   ER  92



>gb|ABQ42065.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
alba]
 gb|ABQ42067.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
ovata]
 gb|ABQ42068.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
apetala]
Length=92

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+VKKERA
Sbjct  31   VKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLALVKKERA  90

Query  241  ER  246
            ER
Sbjct  91   ER  92



>ref|NP_001051639.1| Os03g0806900 [Oryza sativa Japonica Group]
 gb|AAP21435.1| putative ubiquinol-cytochrome c reductase [Oryza sativa Japonica 
Group]
 gb|ABF99449.1| Ubiquinol-cytochrome c reductase complex 14 kDa protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13553.1| Os03g0806900 [Oryza sativa Japonica Group]
 gb|EAY92265.1| hypothetical protein OsI_13986 [Oryza sativa Indica Group]
 gb|EAZ28987.1| hypothetical protein OsJ_13033 [Oryza sativa Japonica Group]
 dbj|BAH00617.1| unnamed protein product [Oryza sativa Japonica Group]
Length=126

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR+QRLKRAMDLSMKH YL E+ QA QTPFR YL DM+ +VKKER 
Sbjct  51   IKEALERLPREVVDARHQRLKRAMDLSMKHQYLSENDQAQQTPFRGYLSDMMDLVKKERL  110

Query  241  EREALGALPLYQRTIP  288
            ERE LGALPL+QRT+P
Sbjct  111  EREELGALPLHQRTLP  126



>gb|ABK22110.1| unknown [Picea sitchensis]
 gb|ABK23193.1| unknown [Picea sitchensis]
Length=127

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EALNRLP E+VDARNQR+KRAMDLSMKH YLP++LQA+QTPFR+YLQDML +V  ER 
Sbjct  52   VDEALNRLPPEVVDARNQRIKRAMDLSMKHDYLPKELQAVQTPFRSYLQDMLELVIAERK  111

Query  241  EREALGALPLYQRTIP  288
            EREALGA PL++R++P
Sbjct  112  EREALGATPLHERSLP  127



>gb|ACS68687.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
alba]
 gb|ACS68758.1| ubiquinol-cytochrome C reductase complex 14 kDa protein, partial 
[Sonneratia alba]
Length=88

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+VKKERA
Sbjct  29   VKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLALVKKERA  88



>ref|XP_011026490.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 isoform X2 [Populus 
euphratica]
Length=106

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 59/76 (78%), Gaps = 16/76 (21%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQ                VKKERA
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQ----------------VKKERA  90

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  91   EREALGALPLYQRTIP  106



>gb|KDO61658.1| hypothetical protein CISIN_1g033311mg [Citrus sinensis]
Length=119

 Score =   107 bits (267),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVK  228
            IKEAL+RLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFRNYLQDMLA+V 
Sbjct  47   IKEALDRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRNYLQDMLALVS  102



>ref|XP_006450500.1| hypothetical protein CICLE_v10009887mg [Citrus clementina]
 gb|ESR63740.1| hypothetical protein CICLE_v10009887mg [Citrus clementina]
Length=129

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVK  228
            IKEALNRLPREIVDARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+V 
Sbjct  47   IKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLALVS  102



>ref|XP_002515558.1| Ubiquinol-cytochrome c reductase complex 14 kDa protein, putative 
[Ricinus communis]
 gb|EEF47007.1| Ubiquinol-cytochrome c reductase complex 14 kDa protein, putative 
[Ricinus communis]
Length=126

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDAR QRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+V+    
Sbjct  47   IKEALNRLPREIVDARVQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLALVRNIFF  106

Query  241  EREALGALPLYQRTIP*C  294
              +   +LP  Q   P C
Sbjct  107  NYKFSYSLPDLQIDSPSC  124



>gb|KJB80691.1| hypothetical protein B456_013G110700 [Gossypium raimondii]
Length=103

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIV  225
            IKEALNRLPREIV+ARNQRLKRAMDLSMKH YLPE+LQ MQTPFR+YLQDMLA+V
Sbjct  47   IKEALNRLPREIVNARNQRLKRAMDLSMKHEYLPENLQQMQTPFRSYLQDMLALV  101



>gb|KJB80692.1| hypothetical protein B456_013G110700 [Gossypium raimondii]
Length=125

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIV  225
            IKEALNRLPREIV+ARNQRLKRAMDLSMKH YLPE+LQ MQTPFR+YLQDMLA+V
Sbjct  47   IKEALNRLPREIVNARNQRLKRAMDLSMKHEYLPENLQQMQTPFRSYLQDMLALV  101



>emb|CDY70525.1| BnaAnng34010D [Brassica napus]
 emb|CDY05492.1| BnaA02g31990D [Brassica napus]
Length=139

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKK  231
            IKEALNRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+V +
Sbjct  48   IKEALNRLPREVVDARNQRLKRAMDLSMKHEYLPDDLQAVQTPFRSYLQEMLALVSR  104



>ref|NP_849484.1| Cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
 gb|AEE86066.1| Cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
Length=101

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAI  222
            IKEA+NRLPRE+VDARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQDMLA+
Sbjct  47   IKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQDMLAL  100



>gb|KDD73783.1| hypothetical protein H632_c1840p0 [Helicosporidium sp. ATCC 50920]
Length=124

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RLP+++VDARNQR+KRA+DLSMKH  LP++LQA+QTPF +YLQ  L +V+ ERA
Sbjct  49   VNEALRRLPQDVVDARNQRIKRALDLSMKHAELPKELQAVQTPFESYLQATLDVVRAERA  108

Query  241  EREALGALPLYQRTIP  288
            EREALGA   Y R +P
Sbjct  109  EREALGAPMPYDRQLP  124



>ref|NP_001190394.1| cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
 gb|AED93445.1| cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
Length=106

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 58/76 (76%), Gaps = 16/76 (21%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEALNRLPREIVDARNQRL RAMDLSMKH YLP++LQ                VK+ERA
Sbjct  47   IKEALNRLPREIVDARNQRLMRAMDLSMKHEYLPDNLQ----------------VKRERA  90

Query  241  EREALGALPLYQRTIP  288
            EREALGALPLYQRTIP
Sbjct  91   EREALGALPLYQRTIP  106



>ref|XP_009403171.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=109

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKER  237
            IKEAL RLPRE+VDARNQRLKRA+DLSMKH YLPEDLQA+QTPFR+YL+DMLA++   R
Sbjct  48   IKEALARLPREVVDARNQRLKRAIDLSMKHEYLPEDLQALQTPFRSYLKDMLALLGATR  106



>ref|XP_003588719.1| Cytochrome b-c1 complex subunit [Medicago truncatula]
 gb|AES58970.1| cytochrome B-c1 complex subunit 7 [Medicago truncatula]
Length=111

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIV  225
            IKEALNRLP+E+VDAR+ RLKRA+DLSMKH YLPEDLQAMQTPFR+YLQDML  V
Sbjct  47   IKEALNRLPKEVVDARHARLKRAIDLSMKHEYLPEDLQAMQTPFRSYLQDMLTFV  101



>ref|NP_001235489.1| uncharacterized protein LOC100527652 [Glycine max]
 gb|ACU16783.1| unknown [Glycine max]
Length=107

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKE  234
            +KEALNRLP+E+VDAR+ RLKRA+DLSMKH YLP++LQ+MQTPFR YLQDML +VK+E
Sbjct  47   VKEALNRLPKEVVDARHARLKRAIDLSMKHEYLPDNLQSMQTPFRGYLQDMLTLVKRE  104



>ref|XP_004981357.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X1 
[Setaria italica]
Length=130

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 55/78 (71%), Gaps = 7/78 (9%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR QRLKR+MDLSMKH YLPEDLQA+QTPFR YL DMLA+V     
Sbjct  51   IKEALGRLPREVVDARIQRLKRSMDLSMKHQYLPEDLQAVQTPFRGYLSDMLALV-----  105

Query  241  EREALGALPLYQRTIP*C  294
                  A  L   T P C
Sbjct  106  --SIFSAACLCHFTCPKC  121



>ref|XP_001777123.1| predicted protein [Physcomitrella patens]
 gb|EDQ58116.1| predicted protein [Physcomitrella patens]
Length=125

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLP++ VD RNQRLKRAMD SMKH YLP+DLQA QTP+  YLQD L +VK+ER 
Sbjct  50   IKEALSRLPQQEVDLRNQRLKRAMDYSMKHQYLPKDLQAKQTPYEPYLQDALQLVKEERK  109

Query  241  EREALGALPLYQRTIP  288
            E   LG+   Y R++P
Sbjct  110  EHAELGSDLPYTRSLP  125



>ref|XP_001754627.1| predicted protein [Physcomitrella patens]
 gb|EDQ80597.1| predicted protein [Physcomitrella patens]
Length=124

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL+RLP+E VD RNQRLKRAMD SMKH YLP++LQA QTP+  YLQD L +VK+ER 
Sbjct  49   IKEALSRLPQEEVDLRNQRLKRAMDYSMKHQYLPKELQAKQTPYEPYLQDALQLVKEERR  108

Query  241  EREALGALPLYQRTIP  288
            E   LG+   Y R++P
Sbjct  109  EHAELGSDLPYTRSLP  124



>ref|XP_008779665.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like, partial 
[Phoenix dactylifera]
Length=68

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAI  222
            IKEAL RLPRE+ DARNQRLKRAMDLS+KH YLPEDLQA+Q PFR+YL+DMLA+
Sbjct  15   IKEALARLPREVADARNQRLKRAMDLSLKHEYLPEDLQALQAPFRSYLKDMLAL  68



>ref|NP_001169405.1| hypothetical protein [Zea mays]
 gb|ACN33651.1| unknown [Zea mays]
 gb|AFW67283.1| hypothetical protein ZEAMMB73_980436 [Zea mays]
Length=143

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVK  228
            IKEAL RLPRE+VDAR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+V+
Sbjct  51   IKEALGRLPREVVDARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLSDMLALVR  106



>ref|XP_005645464.1| 14 kDa subunit of cytochrome bd ubiquinol oxidase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE20920.1| 14 kDa subunit of cytochrome bd ubiquinol oxidase [Coccomyxa 
subellipsoidea C-169]
Length=123

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RLP+E VDAR QRLKRAMDLS+KH+YLP++LQA+QTP+ +Y+ D++  V+ E  
Sbjct  48   VDEALKRLPQEEVDARTQRLKRAMDLSLKHVYLPKELQAVQTPYNSYVMDVIEQVEAENK  107

Query  241  EREALGALPLYQRTIP  288
            E+  LG    Y R+IP
Sbjct  108  EKAQLGTGTTYDRSIP  123



>gb|EMS59356.1| Cytochrome b-c1 complex subunit 7 [Triticum urartu]
Length=152

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 7/72 (10%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDAR+QRLKRAMDLSMKH YLP+D++A+QTPF++YL DMLA+      
Sbjct  48   IKEALCRLPREVVDARHQRLKRAMDLSMKHQYLPDDVRALQTPFKSYLSDMLALAPY---  104

Query  241  EREALGALPLYQ  276
                +G LP ++
Sbjct  105  ----IGGLPGHE  112



>ref|XP_001782160.1| predicted protein [Physcomitrella patens]
 gb|EDQ53054.1| predicted protein [Physcomitrella patens]
Length=112

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            I EAL+RLP ++ D R QRLKRAMD   KH YL + +QA QTPF  YLQD LA VK+ER 
Sbjct  37   IMEALHRLPTQVTDYRYQRLKRAMDCGFKHKYLDKKMQAKQTPFEFYLQDTLAQVKRERI  96

Query  241  EREALGALPLYQRTIP  288
            EREA G+   YQR +P
Sbjct  97   EREAQGSAMPYQREMP  112



>ref|XP_005851167.1| hypothetical protein CHLNCDRAFT_33822 [Chlorella variabilis]
 gb|EFN59065.1| hypothetical protein CHLNCDRAFT_33822 [Chlorella variabilis]
Length=125

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RLP++++DARNQRLKRA DL+MKH  LP+DLQ +QTP+  YL+D L +V+ E  
Sbjct  50   VDEALKRLPQDVLDARNQRLKRAHDLNMKHSELPKDLQQLQTPYSFYLKDALELVRLESD  109

Query  241  EREALGALPLYQRTIP  288
            ER ALGA   Y+R  P
Sbjct  110  ERLALGAGKPYERHFP  125



>ref|XP_002986903.1| hypothetical protein SELMODRAFT_235141 [Selaginella moellendorffii]
 gb|EFJ11985.1| hypothetical protein SELMODRAFT_235141 [Selaginella moellendorffii]
Length=120

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            ++EAL+RLP+  +D RNQRLKRAMDLSMKH +L +++QA QTPF  Y+QD L  V+ ER 
Sbjct  46   LEEALSRLPQHELDFRNQRLKRAMDLSMKHTHLSKEMQAKQTPFLPYVQDQLQQVRAERK  105

Query  241  EREALGALPLYQRTI  285
            EREALG+   Y R I
Sbjct  106  EREALGSDVPYTRAI  120



>ref|XP_002977783.1| hypothetical protein SELMODRAFT_228505 [Selaginella moellendorffii]
 gb|EFJ21121.1| hypothetical protein SELMODRAFT_228505 [Selaginella moellendorffii]
Length=120

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            ++EAL+RLP+  +D RNQRLKRAMDLSMKH +L +++QA QTPF  Y+QD L  V+ ER 
Sbjct  46   LEEALSRLPQHELDLRNQRLKRAMDLSMKHTHLSKEMQAKQTPFLPYVQDQLQQVRAERK  105

Query  241  EREALGALPLYQRTI  285
            EREALG+   Y R I
Sbjct  106  EREALGSDVPYTRAI  120



>ref|XP_003081235.1| ubiquinol-cytochrome C reductase complex 14 kDa protein, putative 
(ISS) [Ostreococcus tauri]
 emb|CAL55404.1| Cytochrome b-c1 complex subunit 7 [Ostreococcus tauri]
Length=122

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RL  E  D R QRLKRA+DLSMKH YL ++ QA+QTPF  YL  ++A VK+ERA
Sbjct  47   VGEALKRLTPEARDMRAQRLKRAIDLSMKHAYLSKEEQALQTPFDFYLTPIVAQVKRERA  106

Query  241  EREALGALPLYQRTIP  288
            ER ALG    Y R IP
Sbjct  107  ERAALGQGQPYNRQIP  122



>ref|XP_007510445.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17978.1| predicted protein [Bathycoccus prasinos]
Length=122

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            ++EAL+RLP+E  + R QRLKRAMDLSMKH+YL ++    QTPF +YL  +LA V+ E++
Sbjct  47   VQEALDRLPKEEREMRTQRLKRAMDLSMKHIYLDKETMEKQTPFDHYLSPVLAEVEAEKS  106

Query  241  EREALGALPLYQRTIP  288
            E+ ALG+   Y R IP
Sbjct  107  EKVALGSDVSYNRQIP  122



>ref|NP_001061357.1| Os08g0246400 [Oryza sativa Japonica Group]
 dbj|BAF23271.1| Os08g0246400 [Oryza sativa Japonica Group]
 dbj|BAG89888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=127

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDA NQRLKR MDLS KH YLP D QAMQT  R YL D  A +   R 
Sbjct  50   IKEALARLPREVVDAHNQRLKRTMDLSTKHQYLPADEQAMQTTLRGYLSD--AYLSSHRV  107

Query  241  ERE  249
             RE
Sbjct  108  WRE  110



>gb|EEC83182.1| hypothetical protein OsI_28424 [Oryza sativa Indica Group]
Length=119

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            IKEAL RLPRE+VDA NQRLKR MDLS KH YLP D QAMQT  R YL +  +IV    +
Sbjct  50   IKEALARLPREVVDAHNQRLKRTMDLSTKHQYLPTDEQAMQTTLRGYLSEKQSIVTGTSS  109

Query  241  E  243
            +
Sbjct  110  Q  110



>ref|XP_002502572.1| mitochondrial tRNA import complex [Micromonas sp. RCC299]
 gb|ACO63830.1| mitochondrial tRNA import complex [Micromonas sp. RCC299]
Length=122

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RLP+E  D R QRLKRAMDLSMKH+YL  ++Q  QTPF+ Y++ +L  V+ ER 
Sbjct  47   VAEALKRLPQEERDLRMQRLKRAMDLSMKHVYLDAEMQKKQTPFKWYIKPVLEEVEAERD  106

Query  241  EREALGALPLYQRTIP  288
            ER ALG    Y R IP
Sbjct  107  ERAALGTGQPYNRQIP  122



>ref|XP_001419785.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98078.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=122

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RL  E  D R QRLKRA+DLSMKH YL ++ QA QTPF  YL  ++  VK ERA
Sbjct  47   VGEALKRLTAEERDMRAQRLKRAIDLSMKHSYLTKEEQATQTPFDFYLTPIVERVKAERA  106

Query  241  EREALGALPLYQRTIP  288
            ER ALG    Y R IP
Sbjct  107  ERTALGGSQPYNRQIP  122



>ref|XP_010255680.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Nelumbo 
nucifera]
Length=155

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            I++A+ RLP E VDA NQRLK A+DL +KH YLP+DLQAM+T FR YLQD +   K+ + 
Sbjct  47   IRKAMARLPCETVDATNQRLKDAVDLLVKHKYLPDDLQAMKTSFRKYLQD-VGSCKEGKG  105

Query  241  EREALGA  261
             R+ LGA
Sbjct  106  IRKTLGA  112



>ref|XP_011398978.1| Cytochrome b-c1 complex subunit 7 [Auxenochlorella protothecoides]
 gb|KFM26082.1| Cytochrome b-c1 complex subunit 7 [Auxenochlorella protothecoides]
Length=126

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +1

Query  67   EALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAER  246
            EAL RL  + V ARNQRLKR MD+SMKH  LP ++Q  QTPF  YL + LA VK E  ER
Sbjct  53   EALRRLSPDEVHARNQRLKRGMDMSMKHSELPHEIQEQQTPFNFYLDETLAQVKAENEER  112

Query  247  EALGALPLYQRTIP  288
            + LG+   Y R +P
Sbjct  113  KQLGSGRPYDRHLP  126



>ref|XP_003059247.1| mitochondrial tRNA import complex [Micromonas pusilla CCMP1545]
 gb|EEH56379.1| mitochondrial tRNA import complex [Micromonas pusilla CCMP1545]
Length=121

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RLP+E  D R QRLKRAMDLSMKH+ L ++ QA QTPF  Y+  +L  V+ ER 
Sbjct  46   VAEALKRLPQEERDLRMQRLKRAMDLSMKHINLSKEEQAKQTPFLWYVTPVLREVEAERD  105

Query  241  EREALGALPLYQRTIP  288
            ER ALG    Y R IP
Sbjct  106  ERAALGTGQPYNRQIP  121



>gb|KDO61659.1| hypothetical protein CISIN_1g033311mg [Citrus sinensis]
Length=114

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQT  186
            IKEAL+RLPREIVDARNQRLKRAMDLSMKH YLPEDLQ + +
Sbjct  47   IKEALDRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQVLVS  88



>ref|XP_010493801.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Camelina 
sativa]
Length=94

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTP  189
            IKE+LNRLPREIVDARNQRLKRAMDLSMKH YLP DLQ   +P
Sbjct  47   IKESLNRLPREIVDARNQRLKRAMDLSMKHEYLPADLQVCMSP  89



>ref|XP_002945797.1| hypothetical protein VOLCADRAFT_78796 [Volvox carteri f. nagariensis]
 gb|EFJ52792.1| hypothetical protein VOLCADRAFT_78796 [Volvox carteri f. nagariensis]
Length=123

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RLP ++V ARN RL+RA+DLS+KH  LP DL A QTP  +Y+Q++LA V+ ER 
Sbjct  47   VAEALRRLPPDVVVARNCRLRRALDLSLKHEGLPADLLAKQTPELSYMQEVLAEVRAERR  106

Query  241  EREALGALPLYQR  279
            ER  LGA   Y R
Sbjct  107  ERAQLGAPAPYTR  119



>ref|XP_001696308.1| ubiquinol:cytochrome c oxidoreductase 14 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP08285.1| ubiquinol:cytochrome c oxidoreductase 14 kDa subunit [Chlamydomonas 
reinhardtii]
Length=123

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + EAL RLP ++V ARN RL+RA+DLS KH  LP+DL   QTP  +YLQD+L  V+ ER 
Sbjct  47   VAEALRRLPPDVVVARNCRLRRALDLSCKHEALPKDLLEKQTPELSYLQDVLNEVRAERR  106

Query  241  EREALGALPLYQR  279
            ER  LGA   Y R
Sbjct  107  ERAQLGAPAPYTR  119



>ref|XP_010107306.1| Cytochrome b-c1 complex subunit 7 [Morus notabilis]
 gb|EXC14786.1| Cytochrome b-c1 complex subunit 7 [Morus notabilis]
Length=97

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYL  204
            +KEALNRLPR+IVDAR+QRLKRAMDLSMKH YLP DLQ        +L
Sbjct  47   VKEALNRLPRQIVDARHQRLKRAMDLSMKHQYLPNDLQVYCFSISTFL  94



>ref|XP_010494051.1| PREDICTED: uncharacterized protein LOC104771252 [Camelina sativa]
Length=105

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  160  PEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  288
            P + +AMQTPFR YLQDMLA+V++E  EREALGALPLYQRT+P
Sbjct  63   PTNQRAMQTPFRGYLQDMLALVERESKEREALGALPLYQRTLP  105



>ref|XP_008354902.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like, partial 
[Malus domestica]
Length=99

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPF  192
            IKEAL+RLPREIVDARNQRLKRAMDLSMKH YLP+ L   Q PF
Sbjct  42   IKEALSRLPREIVDARNQRLKRAMDLSMKHEYLPDHL---QVPF  82



>gb|AFW67282.1| hypothetical protein ZEAMMB73_980436 [Zea mays]
Length=109

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPF  192
            IKEAL RLPRE+VDAR QRLKRAMDLSMKH YLPEDLQ     F
Sbjct  51   IKEALGRLPREVVDARIQRLKRAMDLSMKHQYLPEDLQVRAPSF  94



>ref|XP_009769317.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Nicotiana 
sylvestris]
Length=87

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQA  177
            IKEAL RLPRE+VDAR+QRL RAMDLSMKH YLP+DLQ 
Sbjct  49   IKEALRRLPREVVDARHQRLLRAMDLSMKHQYLPDDLQV  87



>ref|XP_009605812.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Nicotiana 
tomentosiformis]
Length=87

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQA  177
            IKEAL RLPRE+VDAR+QRL RAMDLSMKH YLP+D+Q 
Sbjct  49   IKEALRRLPREVVDARHQRLLRAMDLSMKHQYLPDDIQV  87



>gb|EEE68322.1| hypothetical protein OsJ_26597 [Oryza sativa Japonica Group]
Length=93

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQ  174
            IKEAL RLPRE+VDA NQRLKR MDLS KH YLP D Q
Sbjct  49   IKEALARLPREVVDAHNQRLKRTMDLSTKHQYLPADEQ  86



>ref|XP_009636648.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Egretta garzetta]
Length=79

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP +I + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEDIYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>gb|KFP15525.1| Cytochrome b-c1 complex subunit 7, partial [Egretta garzetta]
Length=105

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP +I + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEDIYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>ref|XP_009556309.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Cuculus canorus]
Length=79

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEDVYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_005027050.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Anas platyrhynchos]
Length=79

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEDLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_010195129.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Colius striatus]
Length=79

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERH  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>gb|KFO74045.1| Cytochrome b-c1 complex subunit 7, partial [Cuculus canorus]
Length=108

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEDVYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_009467582.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nipponia nippon]
Length=79

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEDLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>gb|EOA96045.1| Cytochrome b-c1 complex subunit 7, partial [Anas platyrhynchos]
Length=108

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEDLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>gb|EMC90685.1| Cytochrome b-c1 complex subunit 7, partial [Columba livia]
Length=104

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  37   VKEALKRLPEHVYNERMFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  96

Query  241  EREAL  255
            EREA 
Sbjct  97   EREAW  101



>ref|XP_009505978.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Phalacrocorax carbo]
 ref|XP_009576015.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Fulmarus glacialis]
 ref|XP_009910888.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Haliaeetus albicilla]
 ref|XP_009941836.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Opisthocomus hoazin]
 ref|XP_009949556.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Leptosomus discolor]
 ref|XP_009960875.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Tyto alba]
 ref|XP_010139607.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Buceros rhinoceros 
silvestris]
 ref|XP_010162268.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Caprimulgus carolinensis]
 ref|XP_010300455.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Balearica regulorum 
gibbericeps]
 ref|XP_010575384.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X3 [Haliaeetus 
leucocephalus]
Length=79

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_005499486.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Columba livia]
Length=111

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHVYNERMFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  103

Query  241  EREAL  255
            EREA 
Sbjct  104  EREAW  108



>ref|XP_009085276.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Serinus canaria]
Length=79

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERQ  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>gb|KFR01718.1| Cytochrome b-c1 complex subunit 7, partial [Nipponia nippon]
Length=108

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEDLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_008937646.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Merops 
nubicus]
 gb|KFQ18425.1| Cytochrome b-c1 complex subunit 7, partial [Merops nubicus]
Length=105

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERH  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>gb|KFZ54353.1| Cytochrome b-c1 complex subunit 7, partial [Podiceps cristatus]
Length=105

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERH  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>gb|KGL98728.1| Cytochrome b-c1 complex subunit 7, partial [Charadrius vociferus]
Length=108

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_010575383.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X2 [Haliaeetus 
leucocephalus]
Length=87

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  20   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  79

Query  241  EREALG  258
            EREA  
Sbjct  80   EREAWN  85



>ref|XP_005231059.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Falco peregrinus]
 ref|XP_005445443.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Falco cherrug]
Length=79

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>gb|KFO92935.1| Cytochrome b-c1 complex subunit 7, partial [Buceros rhinoceros 
silvestris]
Length=105

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>gb|KFZ54545.1| Cytochrome b-c1 complex subunit 7, partial [Caprimulgus carolinensis]
Length=108

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>gb|KFM04960.1| Cytochrome b-c1 complex subunit 7, partial [Aptenodytes forsteri]
 gb|KFP99216.1| Cytochrome b-c1 complex subunit 7, partial [Haliaeetus albicilla]
 gb|KFQ82165.1| Cytochrome b-c1 complex subunit 7, partial [Phaethon lepturus]
 gb|KFR17762.1| Cytochrome b-c1 complex subunit 7, partial [Opisthocomus hoazin]
 gb|KFW67371.1| Cytochrome b-c1 complex subunit 7, partial [Pygoscelis adeliae]
Length=108

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_009273783.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Aptenodytes 
forsteri]
 ref|XP_009322720.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Pygoscelis 
adeliae]
Length=107

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  40   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  99

Query  241  EREAL  255
            EREA 
Sbjct  100  EREAW  104



>ref|XP_009489537.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Pelecanus crispus]
Length=79

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_010403256.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Corvus cornix cornix]
Length=99

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  32   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERH  91

Query  241  EREALG  258
            EREA  
Sbjct  92   EREAWN  97



>gb|KFQ81797.1| Cytochrome b-c1 complex subunit 7, partial [Phoenicopterus ruber 
ruber]
Length=105

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>gb|KFO10749.1| Cytochrome b-c1 complex subunit 7, partial [Balearica regulorum 
gibbericeps]
 gb|KFQ11419.1| Cytochrome b-c1 complex subunit 7, partial [Leptosomus discolor]
 gb|KFV45916.1| Cytochrome b-c1 complex subunit 7, partial [Tyto alba]
 gb|KFV92258.1| Cytochrome b-c1 complex subunit 7, partial [Fulmarus glacialis]
 gb|KFW96839.1| Cytochrome b-c1 complex subunit 7, partial [Phalacrocorax carbo]
Length=105

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>gb|KFO56846.1| Cytochrome b-c1 complex subunit 7, partial [Corvus brachyrhynchos]
Length=108

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERH  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_009693581.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Cariama cristata]
Length=79

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKRYLEPYLKEVIRERF  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_010004743.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Chaetura pelagica]
Length=95

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  28   VKEALRRLPEHLYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  87

Query  241  EREALG  258
            EREA  
Sbjct  88   EREAWN  93



>ref|XP_010292664.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Phaethon lepturus]
 ref|XP_010575382.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X1 [Haliaeetus 
leucocephalus]
Length=111

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  103

Query  241  EREAL  255
            EREA 
Sbjct  104  EREAW  108



>ref|NP_001232783.1| cytochrome b-c1 complex subunit 7-like [Taeniopygia guttata]
 gb|ACH44435.1| putative ubiquinol-cytochrome C reductase complex variant 2 [Taeniopygia 
guttata]
 gb|ACH44436.1| putative ubiquinol-cytochrome C reductase complex variant 2 [Taeniopygia 
guttata]
Length=111

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERQ  103

Query  241  EREAL  255
            EREA 
Sbjct  104  EREAW  108



>gb|KFV69193.1| Cytochrome b-c1 complex subunit 7, partial [Picoides pubescens]
Length=108

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALRRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_005042381.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Ficedula albicollis]
Length=79

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERH  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_009890227.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Charadrius vociferus]
Length=118

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  51   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  110

Query  241  EREAL  255
            EREA 
Sbjct  111  EREAW  115



>ref|XP_005422967.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Geospiza fortis]
Length=79

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERQ  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>gb|KFQ66398.1| Cytochrome b-c1 complex subunit 7, partial [Pelecanus crispus]
Length=105

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>gb|KFU96249.1| Cytochrome b-c1 complex subunit 7, partial [Chaetura pelagica]
Length=108

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALRRLPEHLYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>gb|EWM28744.1| mitochondrial trna import complex [Nannochloropsis gaditana]
Length=143

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + +A++ L  E   AR +R+KRA+++S+K  YLP DLQ MQTP + YL   L  V+ E  
Sbjct  77   VTKAIHHLSPEEQVARERRIKRAIEISLKKKYLPADLQKMQTPLKPYLSHALDEVEAEET  136

Query  241  EREAL  255
            ER+ L
Sbjct  137  ERKLL  141



>ref|XP_010128833.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Chlamydotis macqueenii]
Length=79

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKRYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_005479545.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Zonotrichia 
albicollis]
Length=79

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERQ  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_009901258.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Picoides pubescens]
Length=113

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  46   VKEALRRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  105

Query  241  EREAL  255
            EREA 
Sbjct  106  EREAW  110



>ref|XP_008628958.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Corvus brachyrhynchos]
Length=130

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  63   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERH  122

Query  241  EREAL  255
            EREA 
Sbjct  123  EREAW  127



>gb|KFP62603.1| Cytochrome b-c1 complex subunit 7, partial [Cariama cristata]
Length=105

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKRYLEPYLKEVIRERF  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>gb|KFQ33774.1| Cytochrome b-c1 complex subunit 7, partial [Mesitornis unicolor]
Length=105

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWLKYEEDKHYLEPYLKEVIRERL  97

Query  241  EREAL  255
            EREA 
Sbjct  98   EREAW  102



>ref|XP_009977162.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Tauraco 
erythrolophus]
Length=104

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  37   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKRYLEPYLKEVIRERL  96

Query  241  EREAL  255
            EREA 
Sbjct  97   EREAW  101



>ref|XP_008608179.1| hypothetical protein SDRG_04290 [Saprolegnia diclina VS20]
 gb|EQC38587.1| hypothetical protein SDRG_04290 [Saprolegnia diclina VS20]
Length=101

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + +A++ L +E   AR +RL RA DLS K  YLPED+QA+Q P   YL D +  V+K   
Sbjct  34   VNKAVSWLGKEEKVARQRRLVRASDLSFKRAYLPEDIQAIQEPMNFYLDDKVEEVRKLGD  93

Query  241  EREAL  255
            ER  L
Sbjct  94   ERNKL  98



>gb|KFV10010.1| Cytochrome b-c1 complex subunit 7, partial [Tauraco erythrolophus]
Length=108

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKRYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_008862571.1| hypothetical protein H310_01284 [Aphanomyces invadans]
 gb|ETW08766.1| hypothetical protein H310_01284 [Aphanomyces invadans]
Length=102

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLA  219
            ++ A++ L R+   AR +RL RA DLS K  YLPE++Q +Q PF  YLQD +A
Sbjct  35   VQRAVHWLNRDQSLARTRRLSRAADLSFKRAYLPEEIQNIQEPFNFYLQDKVA  87



>ref|XP_010180848.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Mesitornis unicolor]
Length=111

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWLKYEEDKHYLEPYLKEVIRERL  103

Query  241  EREAL  255
            EREA 
Sbjct  104  EREAW  108



>gb|KFP92467.1| Cytochrome b-c1 complex subunit 7, partial [Apaloderma vittatum]
Length=108

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEAVKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_009875125.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Apaloderma 
vittatum]
Length=104

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  37   VKEAVKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  96

Query  241  EREAL  255
            EREA 
Sbjct  97   EREAW  101



>gb|KDO27696.1| hypothetical protein SPRG_07325 [Saprolegnia parasitica CBS 223.65]
Length=101

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            + +A++ L +E   AR +RL RA DLS K  YLPED+QA+Q P   YL D +  ++K   
Sbjct  34   VNKAVSWLGKEEKVARQRRLVRASDLSFKRAYLPEDIQAIQEPMNFYLDDKVEEIRKLGD  93

Query  241  EREAL  255
            ER  L
Sbjct  94   ERNKL  98



>ref|XP_005517066.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Pseudopodoces 
humilis]
Length=111

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHPYLEPYLKEVIRERH  103

Query  241  EREAL  255
            EREA 
Sbjct  104  EREAW  108



>dbj|BAN20761.1| ubiquinol-cytochrome c reductase complex 14 kd protein [Riptortus 
pedestris]
Length=112

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  I+  RN R+ RA+ LS++H YLP++          YL  ++  VKKE+A
Sbjct  44   VKEALRRLPENILHERNFRIVRAVQLSIQHDYLPKEQWTKYEEDVKYLSPIIEQVKKEKA  103

Query  241  EREALGA  261
            E+E   A
Sbjct  104  EQEEWDA  110



>pdb|3CWB|F Chain F, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated 
Analogue Of The Polyketide Crocacin-d
 pdb|3CWB|S Chain S, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated 
Analogue Of The Polyketide Crocacin-d
 pdb|3H1L|F Chain F, Chicken Cytochrome Bc1 Complex With Ascochlorin Bound 
At Qo And Qi Sites
 pdb|3H1L|S Chain S, Chicken Cytochrome Bc1 Complex With Ascochlorin Bound 
At Qo And Qi Sites
Length=110

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP+++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  43   VKEALKRLPKDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  102

Query  241  EREAL  255
            EREA 
Sbjct  103  EREAW  107



>gb|KFW81092.1| Cytochrome b-c1 complex subunit 7, partial [Manacus vitellinus]
Length=105

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDNHYLEPYLKEVIRERR  97

Query  241  EREAL  255
            E+EA 
Sbjct  98   EKEAW  102



>ref|XP_008922299.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Manacus vitellinus]
Length=111

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDNHYLEPYLKEVIRERR  103

Query  241  EREAL  255
            E+EA 
Sbjct  104  EKEAW  108



>ref|XP_004940015.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X4 
[Gallus gallus]
Length=98

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  31   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  90

Query  241  EREALG  258
            EREA  
Sbjct  91   EREAWN  96



>ref|XP_004940014.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X3 
[Gallus gallus]
Length=107

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  40   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  99

Query  241  EREAL  255
            EREA 
Sbjct  100  EREAW  104



>pdb|3H1H|F Chain F, Cytochrome Bc1 Complex From Chicken
 pdb|3H1H|S Chain S, Cytochrome Bc1 Complex From Chicken
 pdb|3H1I|F Chain F, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex 
From Chicken
 pdb|3H1I|S Chain S, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex 
From Chicken
 pdb|3H1J|F Chain F, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
 pdb|3H1J|S Chain S, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
 pdb|3H1K|F Chain F, Chicken Cytochrome Bc1 Complex With Zn++ And An Iodinated 
Derivative Of Kresoxim-Methyl Bound
 pdb|3H1K|S Chain S, Chicken Cytochrome Bc1 Complex With Zn++ And An Iodinated 
Derivative Of Kresoxim-Methyl Bound
 pdb|3L70|F Chain F, Cytochrome Bc1 Complex From Chicken With Trifloxystrobin 
Bound
 pdb|3L70|S Chain S, Cytochrome Bc1 Complex From Chicken With Trifloxystrobin 
Bound
 pdb|3L71|F Chain F, Cytochrome Bc1 Complex From Chicken With Azoxystrobin 
Bound
 pdb|3L71|S Chain S, Cytochrome Bc1 Complex From Chicken With Azoxystrobin 
Bound
 pdb|3L72|F Chain F, Chicken Cytochrome Bc1 Complex With Kresoxym-i-dimethyl 
Bound
 pdb|3L72|S Chain S, Chicken Cytochrome Bc1 Complex With Kresoxym-i-dimethyl 
Bound
 pdb|3L73|F Chain F, Cytochrome Bc1 Complex From Chicken With Triazolone 
Inhibitor
 pdb|3L73|S Chain S, Cytochrome Bc1 Complex From Chicken With Triazolone 
Inhibitor
 pdb|3L74|F Chain F, Cytochrome Bc1 Complex From Chicken With Famoxadone 
Bound
 pdb|3L74|S Chain S, Cytochrome Bc1 Complex From Chicken With Famoxadone 
Bound
 pdb|3L75|F Chain F, Cytochrome Bc1 Complex From Chicken With Fenamidone 
Bound
 pdb|3L75|S Chain S, Cytochrome Bc1 Complex From Chicken With Fenamidone 
Bound
 pdb|3TGU|F Chain F, Cytochrome Bc1 Complex From Chicken With Pfvs-Designed 
Moa Inhibitor Bound
 pdb|3TGU|S Chain S, Cytochrome Bc1 Complex From Chicken With Pfvs-Designed 
Moa Inhibitor Bound
Length=110

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  43   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  102

Query  241  EREAL  255
            EREA 
Sbjct  103  EREAW  107



>ref|XP_010707455.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Meleagris gallopavo]
Length=111

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  103

Query  241  EREAL  255
            EREA 
Sbjct  104  EREAW  108



>ref|XP_007547796.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Poecilia formosa]
Length=110

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA DLSMK   LP+D         NYL   L  V +ER 
Sbjct  43   VKEALRRLPENVYNDRTFRMKRAFDLSMKQQILPKDQWTKYEEDVNYLTPYLEEVIRERK  102

Query  241  ERE  249
            ERE
Sbjct  103  ERE  105



>ref|XP_009674294.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Struthio camelus 
australis]
Length=79

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  12   VKEALKRLPEPLYNERIFRMKRALDLSLKHQILPKEQWVKYEEDKRYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_005760154.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Emiliania 
huxleyi CCMP1516]
 ref|XP_005764180.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Emiliania 
huxleyi CCMP1516]
 gb|EOD07725.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Emiliania 
huxleyi CCMP1516]
 gb|EOD11751.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Emiliania 
huxleyi CCMP1516]
Length=123

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +K AL RLP ++++AR QRLKRAM LS +   LP ++     PF +YL   L  VKKE+ 
Sbjct  58   VKLALKRLPPDVLNAREQRLKRAMVLSSQIKTLPPEVAEKLDPFESYLGPYLEQVKKEKE  117

Query  241  E  243
            E
Sbjct  118  E  118



>gb|EHB12641.1| Cytochrome b-c1 complex subunit 7 [Heterocephalus glaber]
Length=111

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSLKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  EREALG  258
            ERE  G
Sbjct  104  EREEWG  109



>ref|XP_009816014.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Gavia stellata]
Length=79

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+K   LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKRQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  241  EREALG  258
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_003386823.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Amphimedon 
queenslandica]
Length=115

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP ++++ R  R+KRA+DLSMKH  LP D          YL  ++  V KE  
Sbjct  48   VKEAVRRLPEDVMNLRQFRIKRALDLSMKHSILPRDQWTKPEEDVQYLTPLIEQVTKEFL  107

Query  241  EREAL  255
            ER+A 
Sbjct  108  ERKAW  112



>gb|EDM07587.1| rCG63535 [Rattus norvegicus]
Length=79

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLSM+H  LP+D        + YL+  L  V +ER 
Sbjct  12   VKEAIRRLPENLYNDRMFRIKRALDLSMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  71

Query  241  EREALG  258
            ERE   
Sbjct  72   EREEWA  77



>ref|XP_004645372.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++  A     + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWAKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_009821544.1| hypothetical protein H257_00515 [Aphanomyces astaci]
 gb|ETV89144.1| hypothetical protein H257_00515 [Aphanomyces astaci]
Length=102

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLA  219
            ++ A++ L R+   AR +RL RA DLS K  YLPE++Q +Q P+  YL D +A
Sbjct  35   VQRAVHWLDRDQSLARTRRLSRAADLSFKRTYLPEEIQKIQEPYNFYLHDKVA  87



>gb|KFQ41982.1| Cytochrome b-c1 complex subunit 7, partial [Nestor notabilis]
Length=108

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEAVRRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  100

Query  241  ERE  249
            ERE
Sbjct  101  ERE  103



>gb|KFP84293.1| Cytochrome b-c1 complex subunit 7, partial [Acanthisitta chloris]
Length=108

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERL  100

Query  241  ERE  249
            ERE
Sbjct  101  ERE  103



>ref|XP_010009436.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nestor notabilis]
Length=98

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  31   VKEAVRRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  90

Query  241  EREALG  258
            ERE   
Sbjct  91   EREEWN  96



>ref|XP_009076930.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Acanthisitta 
chloris]
Length=104

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  37   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERL  96

Query  241  ERE  249
            ERE
Sbjct  97   ERE  99



>gb|KFV81894.1| Cytochrome b-c1 complex subunit 7, partial [Struthio camelus 
australis]
Length=108

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  41   VKEALKRLPEPLYNERIFRMKRALDLSLKHQILPKEQWVKYEEDKRYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>ref|XP_004631617.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++   +    + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRVFRIKRALDLSMKHQILPKEQWTIYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_418347.4| PREDICTED: cytochrome b-c1 complex subunit 7-like isoformX2 [Gallus 
gallus]
Length=146

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  79   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  138

Query  241  EREAL  255
            EREA 
Sbjct  139  EREAW  143



>gb|KFV45193.1| Cytochrome b-c1 complex subunit 7, partial [Gavia stellata]
Length=108

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+K   LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKRQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  241  EREAL  255
            EREA 
Sbjct  101  EREAW  105



>gb|AAB30496.1| cytochrome-c reductase 14 kda subunit {P1 peptide} {EC 1.10.2.2.} 
[Solanum tuberosum=potatoes, cv. Hansa, Peptide Mitochondrial 
Partial, 26 aa]
Length=26

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  64   KEALNRLPREIVDARNQRLKRAMDLS  141
            KEALNRLPREIVDARNQRL RA+DLS
Sbjct  1    KEALNRLPREIVDARNQRLLRAVDLS  26



>ref|XP_005150932.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Melopsittacus 
undulatus]
Length=111

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  44   VKEAVRRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERL  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_004995655.1| ubiquinol-cytochrome C reductase [Salpingoeca rosetta]
 gb|EGD82419.1| ubiquinol-cytochrome C reductase [Salpingoeca rosetta]
Length=117

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            ++EA++RLPRE  D R  RLKRA+ LS++H YLP++        R YL  ++  V++E  
Sbjct  49   VREAISRLPREEQDLRYFRLKRALQLSVQHKYLPKEEWTTDETERYYLTPIIKQVEQELK  108

Query  241  EREAL  255
            E+E  
Sbjct  109  EKEEF  113



>ref|XP_005797417.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Xiphophorus 
maculatus]
Length=110

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLSMK   LP+D         NYL   L  V +ER 
Sbjct  43   VKEALRRLPENVGNDRVFRIKRALDLSMKQQILPKDQWTKYEEDVNYLTPYLEEVIRERK  102

Query  241  ERE  249
            ERE
Sbjct  103  ERE  105



>ref|XP_004638531.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWTKHEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_005181276.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Musca domestica]
Length=111

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLPR++ D RN R+ RA+ LSM    LP+D          YL+  L  V KER 
Sbjct  43   VKEAIRRLPRKLYDERNYRIMRALHLSMTKTILPKDQWTKYEDDVKYLEPYLNEVIKERE  102

Query  241  ERE  249
            ERE
Sbjct  103  ERE  105



>ref|NP_001121025.1| cytochrome b-c1 complex subunit 7 [Rattus norvegicus]
 gb|EDM16443.1| rCG60159 [Rattus norvegicus]
 gb|AAI66882.1| Uqcrb protein [Rattus norvegicus]
Length=111

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLSM+H  LP+D        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|NP_080495.1| cytochrome b-c1 complex subunit 7 [Mus musculus]
 dbj|BAB25983.1| unnamed protein product [Mus musculus]
 dbj|BAB31397.1| unnamed protein product [Mus musculus]
 gb|AAH86921.1| Ubiquinol-cytochrome c reductase binding protein [Mus musculus]
 gb|AAI00602.1| Ubiquinol-cytochrome c reductase binding protein [Mus musculus]
 dbj|BAE40296.1| unnamed protein product [Mus musculus]
 dbj|BAE40676.1| unnamed protein product [Mus musculus]
 gb|EDL10333.1| mCG67985 [Mus musculus]
Length=111

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP ++ + R  R+KRA+DL+M+H  LP+D        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|NP_001019613.1| cytochrome b-c1 complex subunit 7 [Danio rerio]
 ref|XP_009292718.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X1 [Danio 
rerio]
 gb|AAH95035.1| Ubiquinol-cytochrome c reductase binding protein [Danio rerio]
 gb|AAI65897.1| Ubiquinol-cytochrome c reductase binding protein [Danio rerio]
Length=111

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  RLKRAMDLSMKH  LP+D          YL+  L  V +ER 
Sbjct  44   VKEAVRRLPEPLYNERVFRLKRAMDLSMKHQILPKDQWTKFEQDVKYLEPYLQEVIRERK  103

Query  241  ERE  249
            E+E
Sbjct  104  EKE  106



>ref|XP_009037032.1| hypothetical protein AURANDRAFT_26379, partial [Aureococcus anophagefferens]
 gb|EGB08306.1| hypothetical protein AURANDRAFT_26379, partial [Aureococcus anophagefferens]
Length=89

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   EALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAER  246
            +AL R+  E V AR +R+KRA D+S K   LP DLQ +Q P   Y   ++   K  R ER
Sbjct  24   KALGRISDEEVQARARRMKRAFDISFKKKSLPADLQRLQAPLAPYATPLIDEAKARRVER  83

Query  247  EAL  255
            E L
Sbjct  84   ELL  86



>gb|AAH31607.1| Ubiquinol-cytochrome c reductase binding protein [Mus musculus]
Length=111

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP ++ + R  R+KRA+DL+M+H  LP+D        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>sp|Q9D855.3|QCR7_MOUSE RecName: Full=Cytochrome b-c1 complex subunit 7; AltName: Full=Complex 
III subunit 7; AltName: Full=Complex III subunit VII; 
AltName: Full=Ubiquinol-cytochrome c reductase complex 14 
kDa protein [Mus musculus]
 dbj|BAB25678.1| unnamed protein product [Mus musculus]
Length=111

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP ++ + R  R+KRA+DL+M+H  LP+D        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPEDLYNDRMLRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_002112931.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV25041.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=120

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            I EAL RLP +   AR  R+KRA+D S+K+ YLP +        + YL+  L +V+KE+ 
Sbjct  53   IAEALRRLPEDEYMARQWRIKRALDCSLKNTYLPREEWTKVEDDKFYLKPYLDLVEKEKT  112

Query  241  EREAL  255
            ER++ 
Sbjct  113  ERKSF  117



>ref|XP_004635428.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KR +DLSMKH  LP++  A     + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMLRIKRTLDLSMKHQILPKEQWAKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_003479958.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Cavia porcellus]
Length=111

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_004474746.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Dasypus novemcinctus]
Length=111

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DL+MKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIKRLPENVYNDRMFRIKRALDLTMKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_004627307.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>gb|KFP07518.1| Cytochrome b-c1 complex subunit 7, partial [Calypte anna]
Length=81

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  14   VKEALKRLPEHLYNERIFRIKRALDLSLKHRILPKEEWVKYEEDKPYLEPYLKEVIRERL  73

Query  241  EREALG  258
            ERE   
Sbjct  74   EREEWN  79



>ref|XP_006273293.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Alligator 
mississippiensis]
Length=79

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +K A+ RLP E+   R  R+KRA+DLSMKH  LP +        + YLQ  L  V +ER 
Sbjct  12   VKLAVKRLPPELYHERMFRIKRALDLSMKHRILPPEQWTKYEEDQRYLQPYLKEVIRERL  71

Query  241  EREAL  255
            EREA 
Sbjct  72   EREAW  76



>ref|XP_004639579.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWTKYEEDKFYLEPYLKEVIQERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>emb|CDW54961.1| cytochrome b c1 complex subunit 7 [Trichuris trichiura]
Length=95

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            ++EA+ RLP E  D R  RL RA  LS+KH YLP+           YLQ  L+ ++KE A
Sbjct  13   VEEAVRRLPAEEYDKRAFRLMRAAQLSLKHEYLPKSQWTKWEDETWYLQPQLSAIRKEYA  72

Query  241  EREALGALPLYQRT  282
            +   L  +  Y  T
Sbjct  73   DYRKLTGMKPYWAT  86



>gb|EHH64317.1| Ubiquinol-cytochrome c reductase complex 14 kDa protein [Macaca 
fascicularis]
Length=111

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DL+MKH  LP++          YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNGRVFRIKRALDLTMKHQILPKEQWTKYEEENFYLEPYLKEVIRERK  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_002160238.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Hydra vulgaris]
Length=114

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +K A+ RL  E  + R  R+KRAMDLS+KH  LP+D          YL  ++  V KER 
Sbjct  47   VKNAVQRLSEEEYNLRAFRIKRAMDLSLKHQILPKDQWTKPEEDVFYLTPLVEAVTKERK  106

Query  241  EREAL  255
            ERE+L
Sbjct  107  ERESL  111



>ref|XP_004580673.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Ochotona princeps]
Length=111

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DL+++H  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLTLRHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  241  EREALG  258
            ERE  G
Sbjct  104  EREEWG  109



>ref|XP_008500690.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Calypte 
anna]
Length=109

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  42   VKEALKRLPEHLYNERIFRIKRALDLSLKHRILPKEEWVKYEEDKPYLEPYLKEVIRERL  101

Query  241  ERE  249
            ERE
Sbjct  102  ERE  104



>ref|XP_006130634.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X2 
[Pelodiscus sinensis]
Length=79

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +K AL RLP ++ + R  R+KRA+DLSMKH  LP+D          YL+  L  V +ER 
Sbjct  12   VKAALKRLPEKMYNERLFRIKRALDLSMKHQILPKDQWMKYEEDHKYLEPYLKEVIRERL  71

Query  241  EREALG  258
            ERE   
Sbjct  72   EREEWD  77



>ref|XP_006130633.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X1 
[Pelodiscus sinensis]
Length=111

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +K AL RLP ++ + R  R+KRA+DLSMKH  LP+D          YL+  L  V +ER 
Sbjct  44   VKAALKRLPEKMYNERLFRIKRALDLSMKHQILPKDQWMKYEEDHKYLEPYLKEVIRERL  103

Query  241  ERE  249
            ERE
Sbjct  104  ERE  106



>ref|XP_001505521.2| PREDICTED: cytochrome b-c1 complex subunit 7 [Ornithorhynchus 
anatinus]
Length=79

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  12   VKEAIRRLPENLYNDRIFRIKRALDLSLKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  71

Query  241  EREALG  258
            ERE   
Sbjct  72   EREEWN  77



>ref|XP_006727830.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Leptonychotes 
weddellii]
Length=79

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + + R  R+KRA+DL+M+H  LP++        + YL+  L  V +ER 
Sbjct  12   VKEAIRRLPENLYNDRMFRIKRALDLTMRHQILPKEQWTKYEEDKFYLETYLKEVIRERK  71

Query  241  EREALG  258
            ERE   
Sbjct  72   EREEWA  77



>ref|XP_002414334.1| ubiquinol cytochrome C reductase, subunit QCR7, putative [Ixodes 
scapularis]
 gb|EEC17642.1| ubiquinol cytochrome C reductase, subunit QCR7, putative [Ixodes 
scapularis]
Length=81

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            I EA+ RLP++I+D RN RL RA+  S+ H  LP++        ++YL   +A V+KE A
Sbjct  13   IDEAVRRLPKKILDERNFRLLRAVQCSINHSILPKEQWTKMEDDKSYLDTYIAEVEKELA  72

Query  241  ER  246
            E+
Sbjct  73   EK  74



>pdb|1QCR|F Chain F, Crystal Structure Of Bovine Mitochondrial Cytochrome 
Bc1 Complex, Alpha Carbon Atoms Only
Length=103

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  240
            +KEA+ RLP  + D R  R+KRA+DLSM+   LP++        ++YL+  L  V +ER 
Sbjct  36   VKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERK  95

Query  241  EREALG  258
            ERE   
Sbjct  96   EREEWA  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950