BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN007N04

Length=427
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004232589.1|  PREDICTED: RNA polymerase I-specific transcr...    196   5e-56   Solanum lycopersicum
emb|CDP01757.1|  unnamed protein product                                195   1e-55   Coffea canephora [robusta coffee]
ref|XP_009619798.1|  PREDICTED: RNA polymerase I-specific transcr...    186   8e-53   Nicotiana tomentosiformis
ref|XP_009619796.1|  PREDICTED: RNA polymerase I-specific transcr...    186   1e-52   Nicotiana tomentosiformis
ref|XP_009618724.1|  PREDICTED: RNA polymerase I-specific transcr...    187   1e-52   
ref|XP_006364840.1|  PREDICTED: RNA polymerase I-specific transcr...    186   2e-52   Solanum tuberosum [potatoes]
ref|XP_009777635.1|  PREDICTED: RNA polymerase I-specific transcr...    183   8e-52   Nicotiana sylvestris
ref|XP_009777634.1|  PREDICTED: RNA polymerase I-specific transcr...    184   9e-52   Nicotiana sylvestris
ref|XP_009773556.1|  PREDICTED: RNA polymerase I-specific transcr...    179   1e-49   Nicotiana sylvestris
ref|XP_011087416.1|  PREDICTED: RNA polymerase I-specific transcr...    177   3e-49   Sesamum indicum [beniseed]
gb|KDO67466.1|  hypothetical protein CISIN_1g0074032mg                  170   7e-49   Citrus sinensis [apfelsine]
gb|KDO67298.1|  hypothetical protein CISIN_1g0416052mg                  169   8e-49   Citrus sinensis [apfelsine]
emb|CBI37506.3|  unnamed protein product                                176   9e-49   Vitis vinifera
ref|XP_010649342.1|  PREDICTED: RNA polymerase I-specific transcr...    176   9e-49   Vitis vinifera
ref|XP_010272854.1|  PREDICTED: RNA polymerase I-specific transcr...    176   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_004155826.1|  PREDICTED: RNA polymerase I-specific transcr...    175   2e-48   
ref|XP_004133864.1|  PREDICTED: RNA polymerase I-specific transcr...    175   2e-48   Cucumis sativus [cucumbers]
ref|XP_006483734.1|  PREDICTED: RNA polymerase I-specific transcr...    169   3e-48   Citrus sinensis [apfelsine]
ref|XP_006483467.1|  PREDICTED: RNA polymerase I-specific transcr...    172   1e-47   
ref|XP_008438040.1|  PREDICTED: RNA polymerase I-specific transcr...    172   1e-47   Cucumis melo [Oriental melon]
ref|XP_006483560.1|  PREDICTED: RNA polymerase I-specific transcr...    171   2e-47   Citrus sinensis [apfelsine]
gb|KCW53303.1|  hypothetical protein EUGRSUZ_J02557                     172   2e-47   Eucalyptus grandis [rose gum]
ref|XP_006483466.1|  PREDICTED: RNA polymerase I-specific transcr...    172   2e-47   Citrus sinensis [apfelsine]
ref|XP_006483559.1|  PREDICTED: RNA polymerase I-specific transcr...    172   3e-47   Citrus sinensis [apfelsine]
gb|KCW53301.1|  hypothetical protein EUGRSUZ_J02557                     172   3e-47   Eucalyptus grandis [rose gum]
ref|XP_010033606.1|  PREDICTED: RNA polymerase I-specific transcr...    172   3e-47   Eucalyptus grandis [rose gum]
ref|XP_010272853.1|  PREDICTED: RNA polymerase I-specific transcr...    171   7e-47   Nelumbo nucifera [Indian lotus]
gb|EYU37427.1|  hypothetical protein MIMGU_mgv1a004171mg                166   1e-45   Erythranthe guttata [common monkey flower]
gb|KDP41755.1|  hypothetical protein JCGZ_26773                         165   5e-45   Jatropha curcas
ref|XP_007134114.1|  hypothetical protein PHAVU_010G020100g             165   7e-45   Phaseolus vulgaris [French bean]
ref|XP_004508346.1|  PREDICTED: RNA polymerase I-specific transcr...    163   4e-44   Cicer arietinum [garbanzo]
gb|KJB18645.1|  hypothetical protein B456_003G064600                    161   2e-43   Gossypium raimondii
ref|XP_007046443.1|  Major facilitator superfamily protein isoform 1    160   3e-43   
ref|XP_010674318.1|  PREDICTED: RNA polymerase I-specific transcr...    160   3e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006415449.1|  hypothetical protein EUTSA_v10007103mg             159   6e-43   Eutrema salsugineum [saltwater cress]
gb|ACJ85821.1|  unknown                                                 153   1e-42   Medicago truncatula
ref|XP_003547884.1|  PREDICTED: RNA polymerase I-specific transcr...    158   2e-42   Glycine max [soybeans]
ref|XP_003534228.1|  PREDICTED: RNA polymerase I-specific transcr...    157   5e-42   Glycine max [soybeans]
gb|KEH32234.1|  transcription initiation factor ia protein, putative    157   5e-42   Medicago truncatula
gb|KHN38852.1|  RNA polymerase I-specific transcription initiatio...    156   9e-42   Glycine soja [wild soybean]
ref|XP_002524432.1|  transcription initiation factor ia, putative       155   1e-41   Ricinus communis
ref|XP_002307198.2|  RNA polymerase 1 specific transcription init...    155   2e-41   Populus trichocarpa [western balsam poplar]
dbj|BAF01881.1|  hypothetical protein                                   153   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008681385.1|  PREDICTED: uncharacterized protein LOC100272...    154   4e-41   
ref|XP_011022128.1|  PREDICTED: RNA polymerase I-specific transcr...    154   5e-41   Populus euphratica
gb|AFW69235.1|  hypothetical protein ZEAMMB73_457339                    154   5e-41   
ref|XP_008392869.1|  PREDICTED: RNA polymerase I-specific transcr...    153   7e-41   
ref|XP_010540653.1|  PREDICTED: RNA polymerase I-specific transcr...    154   7e-41   Tarenaya hassleriana [spider flower]
gb|AAC16259.1|  unknown protein                                         153   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850236.1|  RNA polymerase I specific transcription initiat...    153   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008354575.1|  PREDICTED: RNA polymerase I-specific transcr...    153   1e-40   Malus domestica [apple tree]
ref|XP_009369775.1|  PREDICTED: RNA polymerase I-specific transcr...    153   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_010088711.1|  hypothetical protein L484_016497                   152   3e-40   Morus notabilis
gb|KDO71565.1|  hypothetical protein CISIN_1g0157611mg                  144   4e-40   Citrus sinensis [apfelsine]
ref|XP_007204094.1|  hypothetical protein PRUPE_ppa002914mg             151   6e-40   Prunus persica
ref|XP_002437492.1|  hypothetical protein SORBIDRAFT_10g028030          150   9e-40   
ref|XP_010913887.1|  PREDICTED: RNA polymerase I-specific transcr...    150   1e-39   
ref|XP_008242108.1|  PREDICTED: RNA polymerase I-specific transcr...    150   1e-39   Prunus mume [ume]
ref|XP_010913886.1|  PREDICTED: RNA polymerase I-specific transcr...    150   1e-39   
ref|XP_010913884.1|  PREDICTED: RNA polymerase I-specific transcr...    150   2e-39   
emb|CDY43658.1|  BnaA04g20330D                                          149   2e-39   Brassica napus [oilseed rape]
gb|KFK44868.1|  hypothetical protein AALP_AA1G312900                    149   2e-39   Arabis alpina [alpine rockcress]
emb|CDX84629.1|  BnaA03g16010D                                          149   3e-39   
ref|XP_009133000.1|  PREDICTED: RNA polymerase I-specific transcr...    149   3e-39   Brassica rapa
ref|XP_004966190.1|  PREDICTED: RNA polymerase I-specific transcr...    149   4e-39   Setaria italica
ref|XP_008805454.1|  PREDICTED: RNA polymerase I-specific transcr...    149   4e-39   Phoenix dactylifera
ref|XP_004966189.1|  PREDICTED: RNA polymerase I-specific transcr...    148   6e-39   
ref|XP_009141397.1|  PREDICTED: RNA polymerase I-specific transcr...    148   6e-39   Brassica rapa
ref|XP_006410626.1|  hypothetical protein EUTSA_v10016395mg             148   8e-39   Eutrema salsugineum [saltwater cress]
gb|KDO67467.1|  hypothetical protein CISIN_1g0074032mg                  140   1e-38   Citrus sinensis [apfelsine]
emb|CDX79576.1|  BnaC03g19120D                                          147   2e-38   
ref|XP_010928803.1|  PREDICTED: RNA polymerase I-specific transcr...    146   3e-38   Elaeis guineensis
dbj|BAD45609.1|  RNA polymerase I specific transcription initiati...    142   3e-38   Oryza sativa Japonica Group [Japonica rice]
ref|NP_174347.1|  RNA polymerase I specific transcription initiat...    145   4e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAD25746.1|AC007060_4  EST gb|Z37678 comes from this gene            146   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928802.1|  PREDICTED: RNA polymerase I-specific transcr...    146   5e-38   Elaeis guineensis
ref|XP_006467185.1|  PREDICTED: RNA polymerase I-specific transcr...    145   6e-38   
gb|EEC81212.1|  hypothetical protein OsI_24246                          142   6e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_001058413.2|  Os06g0688100                                       142   6e-37   
ref|XP_009411620.1|  PREDICTED: RNA polymerase I-specific transcr...    142   9e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391870.1|  PREDICTED: RNA polymerase I-specific transcr...    141   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002881355.1|  RNA polymerase I specific transcription init...    141   2e-36   
ref|XP_006296428.1|  hypothetical protein CARUB_v10025608mg             141   2e-36   
ref|XP_006483561.1|  PREDICTED: RNA polymerase I-specific transcr...    140   3e-36   Citrus sinensis [apfelsine]
ref|XP_010516632.1|  PREDICTED: RNA polymerase I-specific transcr...    140   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010509710.1|  PREDICTED: RNA polymerase I-specific transcr...    140   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008782843.1|  PREDICTED: RNA polymerase I-specific transcr...    138   1e-35   
ref|XP_010504951.1|  PREDICTED: RNA polymerase I-specific transcr...    139   1e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001140484.1|  uncharacterized protein LOC100272544               132   2e-35   
ref|XP_002893635.1|  predicted protein                                  139   2e-35   
ref|XP_008782841.1|  PREDICTED: RNA polymerase I-specific transcr...    138   3e-35   Phoenix dactylifera
ref|XP_006656405.1|  PREDICTED: RNA polymerase I-specific transcr...    137   6e-35   Oryza brachyantha
ref|XP_006656406.1|  PREDICTED: RNA polymerase I-specific transcr...    137   6e-35   Oryza brachyantha
gb|KHF98889.1|  RNA polymerase I-specific transcription initiatio...    136   7e-35   Gossypium arboreum [tree cotton]
ref|XP_003563455.1|  PREDICTED: RNA polymerase I-specific transcr...    137   7e-35   Brachypodium distachyon [annual false brome]
ref|XP_010227381.1|  PREDICTED: RNA polymerase I-specific transcr...    136   1e-34   Brachypodium distachyon [annual false brome]
ref|XP_008242159.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...    137   2e-34   
gb|EMS63005.1|  hypothetical protein TRIUR3_02342                       135   3e-34   Triticum urartu
ref|XP_006307098.1|  hypothetical protein CARUB_v10008684mg             134   7e-34   Capsella rubella
ref|XP_009143744.1|  PREDICTED: RNA polymerase I-specific transcr...    133   2e-33   Brassica rapa
ref|XP_007204151.1|  hypothetical protein PRUPE_ppa019726mg             132   2e-33   
ref|XP_004287706.1|  PREDICTED: RNA polymerase I-specific transcr...    131   1e-32   Fragaria vesca subsp. vesca
ref|XP_010460864.1|  PREDICTED: RNA polymerase I-specific transcr...    130   2e-32   
emb|CDY31637.1|  BnaA05g09100D                                          129   3e-32   Brassica napus [oilseed rape]
ref|XP_010552505.1|  PREDICTED: RNA polymerase I-specific transcr...    128   9e-32   Tarenaya hassleriana [spider flower]
gb|KDO71567.1|  hypothetical protein CISIN_1g0157611mg                  119   3e-31   Citrus sinensis [apfelsine]
gb|EMT22842.1|  hypothetical protein F775_01666                         127   3e-31   
ref|XP_006849976.1|  hypothetical protein AMTR_s00022p00154500          126   4e-31   
ref|XP_010519059.1|  PREDICTED: RNA polymerase I-specific transcr...    125   8e-31   Tarenaya hassleriana [spider flower]
emb|CDY71933.1|  BnaCnng75170D                                          118   6e-29   Brassica napus [oilseed rape]
ref|XP_010478481.1|  PREDICTED: RNA polymerase I-specific transcr...    120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002967968.1|  hypothetical protein SELMODRAFT_440149             120   1e-28   Selaginella moellendorffii
gb|KHN03116.1|  RNA polymerase I-specific transcription initiatio...    114   2e-28   Glycine soja [wild soybean]
ref|XP_002963952.1|  hypothetical protein SELMODRAFT_405493             118   8e-28   Selaginella moellendorffii
ref|XP_010460863.1|  PREDICTED: RNA polymerase I-specific transcr...    116   1e-27   Camelina sativa [gold-of-pleasure]
emb|CDX84284.1|  BnaC04g10460D                                          116   2e-27   
ref|XP_001771048.1|  predicted protein                                  115   4e-27   
ref|XP_001775034.1|  predicted protein                                  115   6e-27   
gb|AAC28984.1|  unknown protein                                         104   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181457.2|  RNA polymerase I specific transcription initiat...    104   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293892.1|  hypothetical protein CARUB_v10022885mg             104   6e-23   
ref|XP_010499599.1|  PREDICTED: RNA polymerase I-specific transcr...    103   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010499598.1|  PREDICTED: RNA polymerase I-specific transcr...    103   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002879723.1|  hypothetical protein ARALYDRAFT_902994           99.8    1e-21   
ref|XP_009359751.1|  PREDICTED: uncharacterized protein LOC103950283  87.4    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_002881638.1|  hypothetical protein ARALYDRAFT_321615           86.7    9e-17   
ref|XP_002310691.1|  RNA polymerase 1 specific transcription init...  80.5    3e-15   
ref|XP_001693305.1|  predicted protein                                76.6    3e-14   Chlamydomonas reinhardtii
gb|ERE89854.1|  RNA polymerase I-specific transcription initiatio...  71.6    9e-13   Cricetulus griseus [Chinese hamsters]
gb|AAH55781.1|  Rrn3 protein                                          72.0    1e-12   Mus musculus [mouse]
gb|EGV93005.1|  RNA polymerase I-specific transcription initiatio...  72.0    1e-12   Cricetulus griseus [Chinese hamsters]
gb|EAW54752.1|  hCG1786665, isoform CRA_c                             71.2    3e-12   Homo sapiens [man]
ref|XP_007087397.1|  PREDICTED: RNA polymerase I-specific transcr...  73.6    3e-12   Panthera tigris altaica
ref|XP_011288882.1|  PREDICTED: RNA polymerase I-specific transcr...  73.6    3e-12   
ref|XP_007087398.1|  PREDICTED: RNA polymerase I-specific transcr...  73.6    3e-12   Panthera tigris altaica
ref|XP_008558356.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    4e-12   
ref|XP_002826374.1|  PREDICTED: RNA polymerase I-specific transcr...  70.9    4e-12   
ref|XP_004998396.1|  hypothetical protein PTSG_00924                  73.6    5e-12   Salpingoeca rosetta
ref|XP_004335689.1|  RNA polymerase I specific transcription init...  72.8    5e-12   Acanthamoeba castellanii str. Neff
ref|XP_005077486.1|  PREDICTED: RNA polymerase I-specific transcr...  72.8    6e-12   
ref|XP_006212139.1|  PREDICTED: RNA polymerase I-specific transcr...  72.8    7e-12   Vicugna pacos
ref|XP_010381980.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    7e-12   Rhinopithecus roxellana
ref|XP_006179131.1|  PREDICTED: RNA polymerase I-specific transcr...  72.4    7e-12   Camelus ferus
ref|XP_010959410.1|  PREDICTED: RNA polymerase I-specific transcr...  72.4    7e-12   Camelus bactrianus [camel]
ref|XP_010981170.1|  PREDICTED: RNA polymerase I-specific transcr...  72.4    8e-12   Camelus dromedarius [camel]
ref|XP_004057477.1|  PREDICTED: RNA polymerase I-specific transcr...  70.1    9e-12   
gb|EAW54750.1|  hCG1786665, isoform CRA_a                             70.9    1e-11   Homo sapiens [man]
gb|AAH34110.1|  Rrn3 protein                                          71.6    1e-11   Mus musculus [mouse]
ref|XP_007984556.1|  PREDICTED: RNA polymerase I-specific transcr...  72.0    1e-11   Chlorocebus sabaeus
ref|NP_001034610.1|  RNA polymerase I-specific transcription init...  72.0    1e-11   Mus musculus [mouse]
ref|XP_636150.1|  hypothetical protein DDB_G0289587                   72.0    1e-11   Dictyostelium discoideum AX4
ref|XP_007633999.1|  PREDICTED: RNA polymerase I-specific transcr...  72.0    1e-11   
ref|XP_003502804.2|  PREDICTED: RNA polymerase I-specific transcr...  72.0    1e-11   Cricetulus griseus [Chinese hamsters]
gb|EDL96183.1|  rCG49762                                              69.7    1e-11   Rattus norvegicus [brown rat]
ref|XP_003362032.1|  PREDICTED: RNA polymerase I-specific transcr...  71.2    1e-11   
ref|XP_003269358.1|  PREDICTED: RNA polymerase I-specific transcr...  71.6    1e-11   
dbj|BAG64459.1|  unnamed protein product                              71.2    1e-11   Homo sapiens [man]
ref|XP_004604384.1|  PREDICTED: RNA polymerase I-specific transcr...  71.6    1e-11   Sorex araneus [Eurasian shrew]
gb|AAH71868.1|  RRN3 protein                                          70.9    1e-11   Homo sapiens [man]
ref|XP_005255433.1|  PREDICTED: RNA polymerase I-specific transcr...  70.9    1e-11   
dbj|BAG58409.1|  unnamed protein product                              71.2    2e-11   Homo sapiens [man]
dbj|BAH14891.1|  unnamed protein product                              71.2    2e-11   Homo sapiens [man]
ref|XP_003916620.1|  PREDICTED: RNA polymerase I-specific transcr...  71.2    2e-11   Papio anubis [baboon]
ref|XP_001143837.3|  PREDICTED: RNA polymerase I-specific transcr...  71.2    2e-11   Pan troglodytes
ref|NP_060897.3|  RNA polymerase I-specific transcription initiat...  71.2    2e-11   Homo sapiens [man]
ref|NP_001287993.1|  RNA polymerase I-specific transcription init...  71.2    2e-11   Homo sapiens [man]
ref|NP_001244593.1|  RNA polymerase I-specific transcription init...  71.2    2e-11   Macaca mulatta [rhesus macaque]
dbj|BAG62018.1|  unnamed protein product                              71.2    2e-11   Homo sapiens [man]
ref|XP_002755948.1|  PREDICTED: RNA polymerase I-specific transcr...  71.2    2e-11   Callithrix jacchus [common marmoset]
ref|XP_003291243.1|  hypothetical protein DICPUDRAFT_81920            71.2    2e-11   Dictyostelium purpureum
dbj|BAG64131.1|  unnamed protein product                              70.9    2e-11   Homo sapiens [man]
dbj|BAG65594.1|  unnamed protein product                              71.2    2e-11   Homo sapiens [man]
ref|XP_004057298.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  70.9    2e-11   
ref|XP_005350399.1|  PREDICTED: RNA polymerase I-specific transcr...  71.2    2e-11   Microtus ochrogaster [prairie voles]
ref|XP_006872017.1|  PREDICTED: RNA polymerase I-specific transcr...  71.2    2e-11   Chrysochloris asiatica
emb|CAC07955.1|  transcription initiation factor IA protein           71.2    2e-11   Homo sapiens [man]
ref|XP_001488975.2|  PREDICTED: RNA polymerase I-specific transcr...  70.9    2e-11   Equus caballus [domestic horse]
ref|XP_010337746.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  70.9    2e-11   Saimiri boliviensis boliviensis
ref|XP_006049819.1|  PREDICTED: RNA polymerase I-specific transcr...  70.9    3e-11   Bubalus bubalis [domestic water buffalo]
ref|XP_006983942.1|  PREDICTED: RNA polymerase I-specific transcr...  70.9    3e-11   Peromyscus maniculatus bairdii
ref|XP_003421933.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    3e-11   Loxodonta africana [African bush elephant]
ref|XP_008828116.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    3e-11   
ref|XP_008828114.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    3e-11   Nannospalax galili
ref|XP_007529594.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    3e-11   Erinaceus europaeus [common hedgehog]
ref|XP_006105278.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    3e-11   
ref|XP_008139788.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    3e-11   Eptesicus fuscus
ref|NP_001129318.1|  RNA polymerase I-specific transcription init...  70.5    3e-11   Rattus norvegicus [brown rat]
ref|XP_005323746.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    3e-11   Ictidomys tridecemlineatus
ref|XP_008765680.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    4e-11   Rattus norvegicus [brown rat]
ref|XP_008828115.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    4e-11   Nannospalax galili
ref|XP_006105277.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    4e-11   Myotis lucifugus
ref|XP_007954667.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    4e-11   Orycteropus afer afer
ref|XP_004587152.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    4e-11   Ochotona princeps [southern American pika]
ref|XP_319773.4|  AGAP009024-PA                                       70.1    4e-11   Anopheles gambiae str. PEST
ref|XP_006759742.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    4e-11   Myotis davidii
gb|ELW67674.1|  RNA polymerase I-specific transcription initiatio...  69.3    4e-11   Tupaia chinensis
ref|XP_005872049.1|  PREDICTED: RNA polymerase I-specific transcr...  70.1    4e-11   Myotis brandtii
gb|ELK33281.1|  RNA polymerase I-specific transcription initiatio...  70.5    4e-11   Myotis davidii
ref|NP_001126928.1|  RNA polymerase I-specific transcription init...  70.1    4e-11   Pongo abelii [orang utan]
ref|XP_001655975.1|  AAEL012265-PA                                    70.1    5e-11   Aedes aegypti
ref|XP_004471918.1|  PREDICTED: RNA polymerase I-specific transcr...  70.1    5e-11   Dasypus novemcinctus
ref|XP_004373328.1|  PREDICTED: RNA polymerase I-specific transcr...  70.1    5e-11   
dbj|BAG60661.1|  unnamed protein product                              69.7    5e-11   Homo sapiens [man]
ref|XP_004705814.1|  PREDICTED: RNA polymerase I-specific transcr...  70.1    5e-11   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_006728703.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   Leptonychotes weddellii
ref|XP_004373327.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   
ref|XP_005697577.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   
ref|XP_004408979.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   Odobenus rosmarus divergens
ref|XP_003478235.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   Cavia porcellus [guinea pig]
ref|XP_010838185.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   Bison bison bison
ref|XP_006728702.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   Leptonychotes weddellii
ref|XP_004691805.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   
ref|XP_002711789.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    6e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007498672.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    7e-11   Monodelphis domestica
ref|XP_008256026.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    7e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006637244.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    7e-11   Lepisosteus oculatus
ref|XP_005957879.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    7e-11   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005906403.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    7e-11   Bos mutus
ref|XP_004020834.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    7e-11   Ovis aries [domestic sheep]
ref|XP_536965.3|  PREDICTED: LOW QUALITY PROTEIN: RNA polymerase ...  69.7    7e-11   
ref|NP_001179361.2|  RNA polymerase I-specific transcription init...  69.7    7e-11   Bos taurus [bovine]
ref|XP_006146663.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  69.7    7e-11   
ref|XP_006910961.1|  PREDICTED: RNA polymerase I-specific transcr...  69.7    7e-11   Pteropus alecto
ref|XP_004441907.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    8e-11   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008063048.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    8e-11   
ref|XP_004797518.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   
ref|XP_004312288.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004270208.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   Orcinus orca [Orca]
ref|XP_004652337.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   Jaculus jaculus
ref|XP_007467020.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   Lipotes vexillifer [baiji]
ref|XP_007106213.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   
ref|XP_007188417.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   Balaenoptera acutorostrata scammoni
ref|XP_004797519.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   
ref|XP_007188419.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    9e-11   Balaenoptera acutorostrata scammoni
ref|XP_004751023.1|  PREDICTED: RNA polymerase I-specific transcr...  69.3    1e-10   
ref|XP_007188418.1|  PREDICTED: RNA polymerase I-specific transcr...  68.9    1e-10   Balaenoptera acutorostrata scammoni
ref|XP_007106212.1|  PREDICTED: RNA polymerase I-specific transcr...  68.9    1e-10   
ref|XP_009439122.1|  PREDICTED: LOW QUALITY PROTEIN: putative RRN...  68.6    1e-10   
ref|XP_008695144.1|  PREDICTED: RNA polymerase I-specific transcr...  68.6    1e-10   Ursus maritimus [white bear]
ref|XP_003790776.1|  PREDICTED: RNA polymerase I-specific transcr...  68.6    1e-10   
ref|XP_003790775.1|  PREDICTED: RNA polymerase I-specific transcr...  68.6    2e-10   
ref|XP_002740429.1|  PREDICTED: RNA polymerase I-specific transcr...  68.6    2e-10   Saccoglossus kowalevskii
ref|XP_001870906.1|  RNA polymerase I-specific transcription init...  68.6    2e-10   Culex quinquefasciatus
gb|KFB38508.1|  hypothetical protein ZHAS_00005915                    68.6    2e-10   Anopheles sinensis
ref|XP_003071560.1|  RNA polymerase I-specific transcription init...  68.2    2e-10   Coccidioides posadasii C735 delta SOWgp
ref|XP_003740893.1|  PREDICTED: RNA polymerase I-specific transcr...  68.2    2e-10   Galendromus occidentalis
ref|XP_001518561.1|  PREDICTED: RNA polymerase I-specific transcr...  68.2    2e-10   
gb|EFW15337.1|  RNA polymerase I specific transcription initiatio...  68.2    2e-10   Coccidioides posadasii str. Silveira
ref|XP_001245293.1|  RNA polymerase I-specific transcription init...  67.8    3e-10   
ref|XP_005391114.1|  PREDICTED: RNA polymerase I-specific transcr...  67.8    3e-10   
gb|EAS33710.3|  RNA polymerase I-specific transcription initiatio...  67.8    3e-10   Coccidioides immitis RS
ref|XP_004085204.2|  PREDICTED: RNA polymerase I-specific transcr...  65.9    3e-10   
ref|XP_004644556.1|  PREDICTED: RNA polymerase I-specific transcr...  67.8    3e-10   Octodon degus
ref|XP_008589951.1|  PREDICTED: RNA polymerase I-specific transcr...  67.8    3e-10   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008589957.1|  PREDICTED: RNA polymerase I-specific transcr...  67.4    3e-10   Galeopterus variegatus [Malayan flying lemur]
gb|ETN66338.1|  transcription initiation factor RRN3                  67.4    3e-10   Anopheles darlingi [American malaria mosquito]
ref|XP_002918109.1|  PREDICTED: RNA polymerase I-specific transcr...  67.4    4e-10   Ailuropoda melanoleuca
ref|XP_008589947.1|  PREDICTED: RNA polymerase I-specific transcr...  67.4    4e-10   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005391113.1|  PREDICTED: RNA polymerase I-specific transcr...  67.4    4e-10   
ref|XP_005391112.1|  PREDICTED: RNA polymerase I-specific transcr...  67.4    4e-10   Chinchilla lanigera
ref|XP_005391115.1|  PREDICTED: RNA polymerase I-specific transcr...  67.4    4e-10   Chinchilla lanigera
ref|XP_002109173.1|  hypothetical protein TRIADDRAFT_52940            67.0    4e-10   Trichoplax adhaerens
ref|XP_004904200.1|  PREDICTED: RNA polymerase I-specific transcr...  67.4    4e-10   
gb|EHB15168.1|  RNA polymerase I-specific transcription initiatio...  67.0    5e-10   Heterocephalus glaber [naked mole rat]
ref|XP_004904201.1|  PREDICTED: RNA polymerase I-specific transcr...  67.0    5e-10   
gb|KJE92659.1|  hypothetical protein CAOG_003578                      67.0    6e-10   Capsaspora owczarzaki ATCC 30864
ref|XP_004363306.2|  hypothetical protein CAOG_03578                  67.0    6e-10   Capsaspora owczarzaki ATCC 30864
ref|XP_010607015.1|  PREDICTED: RNA polymerase I-specific transcr...  66.6    7e-10   Fukomys damarensis [Damara mole rat]
ref|XP_011307388.1|  PREDICTED: RNA polymerase I-specific transcr...  66.6    7e-10   Fopius arisanus
ref|XP_010607008.1|  PREDICTED: RNA polymerase I-specific transcr...  66.6    7e-10   Fukomys damarensis [Damara mole rat]
ref|XP_010872688.1|  PREDICTED: RNA polymerase I-specific transcr...  66.6    7e-10   Esox lucius
ref|XP_002484284.1|  RNA polymerase I-specific transcription init...  66.6    8e-10   Talaromyces stipitatus ATCC 10500
ref|XP_002195883.1|  PREDICTED: RNA polymerase I-specific transcr...  66.2    9e-10   Taeniopygia guttata
ref|XP_784172.3|  PREDICTED: RNA polymerase I-specific transcript...  65.1    1e-09   Strongylocentrotus purpuratus [purple urchin]
ref|XP_005943146.1|  PREDICTED: RNA polymerase I-specific transcr...  65.9    1e-09   
ref|XP_005754251.1|  PREDICTED: RNA polymerase I-specific transcr...  65.9    1e-09   Pundamilia nyererei
ref|XP_004576055.1|  PREDICTED: RNA polymerase I-specific transcr...  65.9    1e-09   
ref|XP_005754252.1|  PREDICTED: RNA polymerase I-specific transcr...  65.9    1e-09   
ref|XP_004576056.1|  PREDICTED: RNA polymerase I-specific transcr...  65.9    1e-09   
ref|XP_005809521.1|  PREDICTED: RNA polymerase I-specific transcr...  65.9    1e-09   
ref|XP_005943145.1|  PREDICTED: RNA polymerase I-specific transcr...  65.9    1e-09   
ref|XP_008327372.1|  PREDICTED: RNA polymerase I-specific transcr...  65.5    1e-09   
gb|ETE58550.1|  RNA polymerase I-specific transcription initiatio...  65.1    2e-09   
gb|KEY83331.1|  RNA polymerase I specific transcription initiatio...  65.5    2e-09   
ref|XP_007828847.1|  hypothetical protein PFICI_02075                 65.5    2e-09   
ref|XP_002595749.1|  hypothetical protein BRAFLDRAFT_260046           65.5    2e-09   
emb|CEF99449.1|  RNA polymerase I specific transcription initiati...  65.5    2e-09   
ref|XP_007568372.1|  PREDICTED: RNA polymerase I-specific transcr...  65.5    2e-09   
ref|XP_750009.1|  RNA polymerase I specific transcription initiat...  65.5    2e-09   
ref|XP_005143459.1|  PREDICTED: RNA polymerase I-specific transcr...  64.7    3e-09   
gb|EPS29634.1|  hypothetical protein PDE_04584                        64.7    3e-09   
ref|XP_010132725.1|  PREDICTED: RNA polymerase I-specific transcr...  64.3    4e-09   
ref|XP_706962.2|  PREDICTED: RNA polymerase I-specific transcript...  64.3    4e-09   
gb|KFO88672.1|  RNA polymerase I-specific transcription initiatio...  64.3    4e-09   
ref|XP_002937728.1|  PREDICTED: RNA polymerase I-specific transcr...  64.3    4e-09   
ref|XP_003459441.2|  PREDICTED: RNA polymerase I-specific transcr...  64.3    5e-09   
ref|XP_007422055.1|  PREDICTED: RNA polymerase I-specific transcr...  63.9    5e-09   
ref|XP_005464989.1|  PREDICTED: RNA polymerase I-specific transcr...  63.9    5e-09   
ref|XP_009090165.1|  PREDICTED: RNA polymerase I-specific transcr...  63.9    5e-09   
ref|XP_005487733.1|  PREDICTED: RNA polymerase I-specific transcr...  63.9    5e-09   
ref|XP_007422054.1|  PREDICTED: RNA polymerase I-specific transcr...  63.9    6e-09   
ref|XP_005645323.1|  RRN3-domain-containing protein                   63.9    6e-09   
ref|XP_009934627.1|  PREDICTED: RNA polymerase I-specific transcr...  63.9    6e-09   
gb|KGL94575.1|  RNA polymerase I-specific transcription initiatio...  63.5    6e-09   
ref|XP_009884916.1|  PREDICTED: RNA polymerase I-specific transcr...  63.5    6e-09   
ref|XP_009477503.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    6e-09   
ref|XP_006001783.1|  PREDICTED: RNA polymerase I-specific transcr...  63.9    7e-09   
gb|KFP83735.1|  RNA polymerase I-specific transcription initiatio...  62.8    7e-09   
gb|KFP81939.1|  RNA polymerase I-specific transcription initiatio...  63.5    7e-09   
ref|XP_008413443.1|  PREDICTED: RNA polymerase I-specific transcr...  63.5    7e-09   
ref|XP_009076439.1|  PREDICTED: RNA polymerase I-specific transcr...  62.8    7e-09   
ref|XP_002399771.1|  transcription initiation factor ia, putative     60.8    7e-09   
gb|KFR12075.1|  RNA polymerase I-specific transcription initiatio...  63.5    7e-09   
ref|XP_009875275.1|  PREDICTED: RNA polymerase I-specific transcr...  63.5    8e-09   
gb|KIN04833.1|  hypothetical protein OIDMADRAFT_101721                63.5    8e-09   
ref|XP_005241078.1|  PREDICTED: RNA polymerase I-specific transcr...  63.5    8e-09   
ref|XP_010014423.1|  PREDICTED: RNA polymerase I-specific transcr...  63.2    8e-09   
gb|EDP55602.1|  RNA polymerase I specific transcription initiatio...  63.5    8e-09   
gb|KFQ51037.1|  RNA polymerase I-specific transcription initiatio...  63.2    9e-09   
ref|XP_001265389.1|  RNA polymerase I-specific transcription init...  63.5    9e-09   
ref|XP_010073615.1|  PREDICTED: RNA polymerase I-specific transcr...  63.2    9e-09   
ref|XP_010294956.1|  PREDICTED: RNA polymerase I-specific transcr...  63.2    1e-08   
ref|XP_008291505.1|  PREDICTED: RNA polymerase I-specific transcr...  63.2    1e-08   
gb|KGL79342.1|  RNA polymerase I-specific transcription initiatio...  63.2    1e-08   
gb|KFQ70384.1|  RNA polymerase I-specific transcription initiatio...  63.2    1e-08   
gb|KFX90278.1|  hypothetical protein V490_06534                       63.2    1e-08   
ref|XP_010197382.1|  PREDICTED: RNA polymerase I-specific transcr...  62.8    1e-08   
gb|KFP30587.1|  RNA polymerase I-specific transcription initiatio...  62.8    1e-08   
ref|XP_010215957.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  62.8    1e-08   
gb|KFY01625.1|  hypothetical protein O988_02634                       62.8    1e-08   
ref|XP_005420469.1|  PREDICTED: RNA polymerase I-specific transcr...  62.8    1e-08   
ref|XP_005522961.1|  PREDICTED: RNA polymerase I-specific transcr...  62.8    1e-08   
ref|XP_005054100.1|  PREDICTED: RNA polymerase I-specific transcr...  62.8    1e-08   
gb|KFO58906.1|  RNA polymerase I-specific transcription initiatio...  62.8    1e-08   
gb|KFU93823.1|  RNA polymerase I-specific transcription initiatio...  62.8    1e-08   
ref|XP_008631618.1|  PREDICTED: RNA polymerase I-specific transcr...  62.8    1e-08   
ref|XP_005442584.1|  PREDICTED: RNA polymerase I-specific transcr...  62.8    1e-08   
ref|XP_008119876.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  62.8    1e-08   
gb|EMP37346.1|  RNA polymerase I-specific transcription initiatio...  62.8    2e-08   
gb|KFP60114.1|  RNA polymerase I-specific transcription initiatio...  62.4    2e-08   
ref|XP_009978077.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
gb|KFQ89128.1|  RNA polymerase I-specific transcription initiatio...  62.4    2e-08   
ref|XP_009705341.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
ref|XP_009323039.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
ref|XP_010576795.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
gb|KFW67612.1|  RNA polymerase I-specific transcription initiatio...  62.4    2e-08   
gb|KFM09127.1|  RNA polymerase I-specific transcription initiatio...  62.4    2e-08   
gb|KFW80626.1|  RNA polymerase I-specific transcription initiatio...  62.4    2e-08   
ref|XP_002161101.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
ref|XP_010390913.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
ref|XP_009919645.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
dbj|GAD92618.1|  RNA polymerase I specific transcription initiati...  62.4    2e-08   
ref|XP_003210568.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
ref|XP_009637885.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
ref|XP_006136344.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
gb|EKG22030.1|  RNA polymerase I specific transcription initiatio...  62.4    2e-08   
ref|XP_009279973.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
gb|KFV90696.1|  RNA polymerase I-specific transcription initiatio...  62.4    2e-08   
gb|KFV61539.1|  RNA polymerase I-specific transcription initiatio...  62.4    2e-08   
gb|KFP16580.1|  RNA polymerase I-specific transcription initiatio...  62.0    2e-08   
ref|XP_010001593.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
ref|XP_009897248.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
gb|EWC45222.1|  hypothetical protein DRE_05949                        62.4    2e-08   
ref|XP_003762901.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
gb|KFQ99747.1|  RNA polymerase I-specific transcription initiatio...  62.0    2e-08   
ref|XP_010739511.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
ref|XP_008921758.1|  PREDICTED: RNA polymerase I-specific transcr...  62.4    2e-08   
gb|KFO05226.1|  RNA polymerase I-specific transcription initiatio...  62.0    2e-08   
ref|XP_010302497.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
ref|XP_007235391.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
ref|XP_009572517.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
gb|KFO75735.1|  RNA polymerase I-specific transcription initiatio...  62.0    2e-08   
ref|XP_009465991.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
ref|XP_011494677.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
ref|XP_009558633.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
ref|XP_010739510.1|  PREDICTED: RNA polymerase I-specific transcr...  62.0    2e-08   
gb|EYE93649.1|  RNA polymerase I-specific transcription initiatio...  62.0    3e-08   
ref|XP_002583810.1|  conserved hypothetical protein                   62.0    3e-08   
ref|XP_008488567.1|  PREDICTED: RNA polymerase I-specific transcr...  61.6    3e-08   
ref|XP_002373003.1|  RNA polymerase I-specific transcription init...  61.6    3e-08   
ref|XP_009511565.1|  PREDICTED: RNA polymerase I-specific transcr...  61.6    3e-08   
gb|KFO98228.1|  RNA polymerase I-specific transcription initiatio...  61.6    3e-08   
gb|KDR09373.1|  hypothetical protein L798_00940                       61.6    3e-08   
dbj|BAE55848.1|  unnamed protein product                              61.6    3e-08   
ref|XP_010170058.1|  PREDICTED: RNA polymerase I-specific transcr...  61.6    3e-08   
ref|XP_001942278.1|  RNA polymerase I-specific transcription init...  61.6    3e-08   
gb|KFW95609.1|  RNA polymerase I-specific transcription initiatio...  61.6    3e-08   
gb|KFZ47827.1|  RNA polymerase I-specific transcription initiatio...  61.6    4e-08   
gb|KIW87460.1|  hypothetical protein Z519_11782                       61.6    4e-08   
ref|XP_007058202.1|  PREDICTED: RNA polymerase I-specific transcr...  61.2    4e-08   
ref|XP_005307634.1|  PREDICTED: RNA polymerase I-specific transcr...  61.2    4e-08   
gb|EKC34325.1|  RNA polymerase I-specific transcription initiatio...  61.2    4e-08   
emb|CAK43728.1|  unnamed protein product                              61.2    4e-08   
ref|XP_009495733.1|  hypothetical protein H696_03588                  61.2    5e-08   
ref|XP_011447139.1|  PREDICTED: RNA polymerase I-specific transcr...  61.2    5e-08   
gb|EOB02008.1|  RNA polymerase I-specific transcription initiatio...  60.8    5e-08   
ref|XP_003964421.1|  PREDICTED: RNA polymerase I-specific transcr...  60.8    5e-08   
ref|XP_005018605.1|  PREDICTED: RNA polymerase I-specific transcr...  61.2    5e-08   
ref|XP_007891899.1|  PREDICTED: RNA polymerase I-specific transcr...  60.8    6e-08   
gb|KFY84499.1|  hypothetical protein V500_09292                       60.8    6e-08   
gb|KFZ18819.1|  hypothetical protein V502_03969                       60.8    6e-08   
gb|KFX42414.1|  RNA polymerase I-specific transcription initiatio...  60.8    6e-08   
gb|KFX42415.1|  RNA polymerase I-specific transcription initiatio...  60.8    6e-08   
gb|AAH73661.1|  LOC443681 protein                                     60.8    6e-08   
ref|XP_002149987.1|  RNA polymerase I-specific transcription init...  60.8    7e-08   
ref|XP_005506998.1|  PREDICTED: RNA polymerase I-specific transcr...  60.8    7e-08   
ref|NP_001107876.1|  RRN3 RNA polymerase I transcription factor h...  60.5    7e-08   
gb|EMC85593.1|  RNA polymerase I-specific transcription initiatio...  60.5    7e-08   
ref|XP_002841823.1|  hypothetical protein                             60.5    8e-08   
ref|XP_005092621.1|  PREDICTED: RNA polymerase I-specific transcr...  60.5    8e-08   
emb|CCX31891.1|  Similar to RNA polymerase I-specific transcripti...  60.5    9e-08   
ref|XP_010157605.1|  PREDICTED: RNA polymerase I-specific transcr...  60.1    1e-07   
ref|XP_002552932.1|  KLTH0D04840p                                     60.1    1e-07   
gb|EFX05561.1|  RNA polymerase 1 specific transcription initiatio...  60.1    1e-07   
gb|KFW12420.1|  RNA polymerase I-specific transcription initiatio...  60.1    1e-07   
emb|CDF89002.1|  ZYBA0S03-06854g1_1                                   60.1    1e-07   
ref|XP_002023097.1|  GL21145                                          60.1    1e-07   
ref|XP_001602153.1|  PREDICTED: RNA polymerase I-specific transcr...  60.1    1e-07   
ref|XP_001214010.1|  RNA polymerase I-specific transcription init...  60.1    1e-07   
ref|XP_001356293.2|  GA17133                                          59.7    1e-07   
ref|XP_002950319.1|  hypothetical protein VOLCADRAFT_120872           60.1    1e-07   
emb|CDY36511.1|  BnaC03g48700D                                        58.2    1e-07   
dbj|GAM37881.1|  hypothetical protein TCE0_033f08174                  59.7    1e-07   
ref|XP_007740293.1|  hypothetical protein A1O5_01487                  59.7    2e-07   
gb|EHA26477.1|  hypothetical protein ASPNIDRAFT_172112                59.3    2e-07   
ref|XP_008716755.1|  hypothetical protein HMPREF1541_04187            59.3    2e-07   
gb|KIY01098.1|  hypothetical protein Z520_02650                       59.3    2e-07   
dbj|GAA83499.1|  RNA polymerase I specific transcription initiati...  59.3    2e-07   
ref|XP_001388984.2|  RNA polymerase I-specific transcription init...  59.3    2e-07   
gb|KEF54013.1|  hypothetical protein A1O9_09808                       59.3    2e-07   
ref|XP_003852621.1|  hypothetical protein MYCGRDRAFT_59030            58.9    3e-07   
ref|XP_001420013.1|  predicted protein                                58.9    3e-07   
gb|KIW34094.1|  hypothetical protein PV07_00893                       58.9    3e-07   
ref|XP_008948365.1|  PREDICTED: RNA polymerase I-specific transcr...  58.5    3e-07   
gb|KFY80843.1|  hypothetical protein V499_00357                       58.9    3e-07   
gb|KFQ17421.1|  RNA polymerase I-specific transcription initiatio...  58.5    3e-07   
ref|XP_007790988.1|  putative rna polymerase i-specific transcrip...  58.9    3e-07   
ref|XP_007701025.1|  hypothetical protein COCSADRAFT_37893            58.9    3e-07   
gb|KFY19290.1|  hypothetical protein V491_04509                       58.9    3e-07   
ref|XP_007711391.1|  hypothetical protein COCCADRAFT_4303             58.5    3e-07   
gb|EUN30478.1|  hypothetical protein COCVIDRAFT_23744                 58.5    3e-07   
ref|XP_001794756.1|  hypothetical protein SNOG_04337                  58.5    3e-07   
ref|XP_007682485.1|  hypothetical protein COCMIDRAFT_442              58.5    4e-07   
ref|XP_001594614.1|  hypothetical protein SS1G_04421                  58.5    4e-07   
ref|XP_006726677.1|  PREDICTED: RNA polymerase I-specific transcr...  56.2    4e-07   
emb|CDH10230.1|  probable RNA polymerase I-specific transcription...  58.2    4e-07   
ref|XP_001640055.1|  predicted protein                                58.5    4e-07   
ref|XP_009681886.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  58.2    4e-07   
ref|XP_006677699.1|  hypothetical protein BATDEDRAFT_1623             58.2    4e-07   
gb|ENI07707.1|  hypothetical protein COCC4DRAFT_79726                 58.2    5e-07   
ref|XP_005276561.1|  PREDICTED: RNA polymerase I-specific transcr...  55.8    5e-07   
ref|XP_007106215.1|  PREDICTED: RNA polymerase I-specific transcr...  57.8    5e-07   
gb|ETL48645.1|  hypothetical protein L916_01774                       58.2    5e-07   
ref|XP_009523651.1|  hypothetical protein PHYSODRAFT_328981           58.2    5e-07   
gb|KIK45936.1|  hypothetical protein CY34DRAFT_800948                 58.2    5e-07   
gb|ETK95246.1|  hypothetical protein L915_01809                       58.2    5e-07   
ref|XP_008899287.1|  hypothetical protein PPTG_06982                  58.2    5e-07   
gb|EMD93991.1|  hypothetical protein COCHEDRAFT_1201821               58.2    5e-07   
gb|ETP25265.1|  hypothetical protein F441_01846                       58.2    5e-07   
gb|ETO84187.1|  hypothetical protein F444_01889                       58.2    5e-07   
ref|XP_007106214.1|  PREDICTED: RNA polymerase I-specific transcr...  57.8    6e-07   
gb|KFY59338.1|  hypothetical protein V496_05707                       57.8    6e-07   
ref|XP_003960700.2|  PREDICTED: RNA polymerase I-specific transcr...  56.2    7e-07   
gb|KIW37848.1|  hypothetical protein PV06_09833                       57.8    7e-07   
gb|EMR86067.1|  putative rna polymerase i specific transcription ...  57.8    7e-07   
gb|EPZ31565.1|  RNA polymerase I transcription initiation factor ...  57.4    7e-07   
ref|XP_007583494.1|  putative rna polymerase i specific transcrip...  57.4    8e-07   
ref|XP_005276560.1|  PREDICTED: RNA polymerase I-specific transcr...  55.5    8e-07   
ref|XP_006261651.1|  PREDICTED: RNA polymerase I-specific transcr...  57.4    8e-07   
gb|EFB16179.1|  hypothetical protein PANDA_006503                     57.4    8e-07   
ref|XP_011191012.1|  PREDICTED: RNA polymerase I-specific transcr...  57.4    9e-07   
gb|KFY31060.1|  hypothetical protein V493_01424                       57.4    9e-07   
gb|KIW63864.1|  hypothetical protein PV04_08836                       57.4    9e-07   
ref|XP_011197220.1|  PREDICTED: RNA polymerase I-specific transcr...  57.0    9e-07   
ref|XP_006025659.1|  PREDICTED: RNA polymerase I-specific transcr...  57.0    1e-06   
emb|CAG00803.1|  unnamed protein product                              57.0    1e-06   
ref|XP_004533859.1|  PREDICTED: RNA polymerase I-specific transcr...  57.0    1e-06   
gb|KIW13677.1|  hypothetical protein PV08_08868                       57.0    1e-06   
gb|ELR05045.1|  hypothetical protein GMDG_01616                       57.0    1e-06   
gb|KIK96058.1|  hypothetical protein PAXRUDRAFT_139331                57.0    1e-06   
ref|XP_007721622.1|  hypothetical protein A1O1_02521                  57.0    1e-06   
gb|KIJ06158.1|  hypothetical protein PAXINDRAFT_103486                57.0    1e-06   
emb|CCA21261.1|  RNA polymerase Ispecific transcription initiatio...  57.0    1e-06   
ref|XP_001269873.1|  RNA polymerase I-specific transcription init...  56.6    1e-06   
gb|KIW82128.1|  hypothetical protein Z517_05155                       56.6    1e-06   
gb|ESZ97945.1|  hypothetical protein SBOR_1668                        56.6    1e-06   
gb|KFZ11906.1|  hypothetical protein V501_04482                       56.6    1e-06   
gb|KFV85710.1|  RNA polymerase I-specific transcription initiatio...  56.6    2e-06   
gb|KIJ57003.1|  hypothetical protein M422DRAFT_198368                 56.6    2e-06   
ref|XP_003838675.1|  hypothetical protein LEMA_P023480.1              56.6    2e-06   
gb|EPQ64152.1|  hypothetical protein BGT96224_76                      56.2    2e-06   
ref|XP_007290346.1|  RNA polymerase I specific transcription init...  56.2    2e-06   
gb|EKC17834.1|  RNA polymerase I-specific transcription initiatio...  56.2    2e-06   
ref|XP_007779522.1|  hypothetical protein W97_03435                   56.2    2e-06   
ref|XP_002130249.1|  PREDICTED: RNA polymerase I-specific transcr...  56.2    2e-06   
emb|CCA40374.1|  RNA polymerase I-specific transcription initiati...  56.2    2e-06   
gb|KII95045.1|  hypothetical protein PLICRDRAFT_98907                 56.2    2e-06   
gb|EWM25090.1|  rna polymerase i-specific transcription initiatio...  56.2    2e-06   
ref|XP_002494203.1|  Protein required for transcription of rDNA b...  56.2    2e-06   
ref|XP_011107330.1|  hypothetical protein H072_1338                   56.2    2e-06   



>ref|XP_004232589.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Solanum lycopersicum]
Length=617

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK+FYAGCQA+MY++CFR  S+ ++ RI+S + +  IEDILRH L PLMVCLPSIV
Sbjct  411  NPKAHKEFYAGCQALMYVLCFRMRSMLAIPRIRSRISK-HIEDILRHPLSPLMVCLPSIV  469

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR+A+ T L   P+N   + S LLESE+SMAFGG +RLDTFFPFDPCLL KSDRFIR
Sbjct  470  EEFLRLAKVTHL-DVPDN--VVSSNLLESELSMAFGGRERLDTFFPFDPCLLMKSDRFIR  526

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMVRN+YD  +DD
Sbjct  527  PNFVYWSMVRNSYDNDDDD  545



>emb|CDP01757.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            + NP+AH+ FY+GCQAIMY++CFR  SI ++ R++S L  +RI+DILRH L PL VCLPS
Sbjct  410  DSNPKAHQVFYSGCQAIMYVLCFRMRSIVAIPRLRSQLFLLRIDDILRHPLNPLKVCLPS  469

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            IVEEFLRVA+++ LF+ P+N   +  GLLESE+SM FGG +RLD FFPFDPCLLKKSDRF
Sbjct  470  IVEEFLRVAKSSHLFNVPQNF--VSDGLLESELSMTFGGLERLDMFFPFDPCLLKKSDRF  527

Query  364  IRPNFIYWSMVRNTY  408
            IRPNF+YWSMVR+TY
Sbjct  528  IRPNFVYWSMVRSTY  542



>ref|XP_009619798.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Nicotiana tomentosiformis]
Length=570

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 116/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK+FYAGCQA+MYI+CFR  S+ ++ RI+S L +  IEDILRH L PLMVCLPS+V
Sbjct  363  NPKAHKEFYAGCQAMMYILCFRMRSMLAIPRIRSRLSK-HIEDILRHPLRPLMVCLPSVV  421

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR+A+ T L   P+N   + SGLLE+++S++FGG +RLDTFFPFDPCLL +SDRFIR
Sbjct  422  KEFLRLAKVTNL-DVPDNF--VSSGLLEADLSISFGGRERLDTFFPFDPCLLLRSDRFIR  478

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMVR++YD  +DD
Sbjct  479  PNFVYWSMVRSSYDNDKDD  497



>ref|XP_009619796.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009619797.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Nicotiana tomentosiformis]
Length=620

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 116/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK+FYAGCQA+MYI+CFR  S+ ++ RI+S L +  IEDILRH L PLMVCLPS+V
Sbjct  413  NPKAHKEFYAGCQAMMYILCFRMRSMLAIPRIRSRLSK-HIEDILRHPLRPLMVCLPSVV  471

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR+A+ T L   P+N   + SGLLE+++S++FGG +RLDTFFPFDPCLL +SDRFIR
Sbjct  472  KEFLRLAKVTNL-DVPDNF--VSSGLLEADLSISFGGRERLDTFFPFDPCLLLRSDRFIR  528

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMVR++YD  +DD
Sbjct  529  PNFVYWSMVRSSYDNDKDD  547



>ref|XP_009618724.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nicotiana tomentosiformis]
Length=690

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK+FYAGCQA+MYI+CFR  S+ ++ RI+S L +  IEDILRH L PLMVCLPS+V
Sbjct  482  NPKAHKEFYAGCQAMMYILCFRMRSMLAIPRIRSRLSK-HIEDILRHPLSPLMVCLPSVV  540

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR+A+ T L   P+N   + SG+LES++S++FGG +RLD FFPFDPCLL +SDRFIR
Sbjct  541  KEFLRLAKVTNL-DVPDNF--VSSGVLESDLSVSFGGRERLDMFFPFDPCLLLRSDRFIR  597

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMVR++YD  EDD
Sbjct  598  PNFVYWSMVRSSYDNDEDD  616



>ref|XP_006364840.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Solanum tuberosum]
Length=618

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 111/133 (83%), Gaps = 4/133 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK+FYAGCQA+MY++CFR  S+ ++ RI+S + +  IEDILRH L PLMVCLPSIV
Sbjct  411  NPKAHKEFYAGCQAMMYVLCFRMRSMLAIPRIRSRISK-HIEDILRHPLSPLMVCLPSIV  469

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR+A+ T L   P+N   + S LLESE+SMAFGG +RLDTFFPFDPCLL KSDRFIR
Sbjct  470  EEFLRLAKVTHL-DVPDNF--VSSNLLESELSMAFGGRERLDTFFPFDPCLLMKSDRFIR  526

Query  370  PNFIYWSMVRNTY  408
            PNF+YWSMVR++Y
Sbjct  527  PNFVYWSMVRSSY  539



>ref|XP_009777635.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Nicotiana sylvestris]
 ref|XP_009777636.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Nicotiana sylvestris]
Length=569

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 114/139 (82%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK+FYAGCQA+MYI+CFR  S+ +  RI+S L +  IEDILRH L PLMVCLPS+V
Sbjct  363  NPKAHKEFYAGCQAMMYILCFRMRSMLAYPRIRSRLSK-HIEDILRHPLSPLMVCLPSVV  421

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR+A+ T L   P+N   + SGLLES++S++FGG +RLD FFPFDPCLL +SDRFIR
Sbjct  422  KEFLRLAKVTNL-DVPDNF--VSSGLLESDLSISFGGRERLDMFFPFDPCLLLRSDRFIR  478

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMVR++YD  +D+
Sbjct  479  PNFVYWSMVRSSYDNDDDE  497



>ref|XP_009777634.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Nicotiana sylvestris]
Length=619

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 114/139 (82%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK+FYAGCQA+MYI+CFR  S+ +  RI+S L +  IEDILRH L PLMVCLPS+V
Sbjct  413  NPKAHKEFYAGCQAMMYILCFRMRSMLAYPRIRSRLSK-HIEDILRHPLSPLMVCLPSVV  471

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR+A+ T L   P+N   + SGLLES++S++FGG +RLD FFPFDPCLL +SDRFIR
Sbjct  472  KEFLRLAKVTNL-DVPDNF--VSSGLLESDLSISFGGRERLDMFFPFDPCLLLRSDRFIR  528

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMVR++YD  +D+
Sbjct  529  PNFVYWSMVRSSYDNDDDE  547



>ref|XP_009773556.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nicotiana sylvestris]
Length=801

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 111/133 (83%), Gaps = 4/133 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK+FYAGCQA+MYI+CFR  S+ ++ RI+S L +  IEDILRH L PLMVCLPS+V
Sbjct  593  NPKAHKEFYAGCQAMMYILCFRMRSMLAIPRIRSRLSK-HIEDILRHPLSPLMVCLPSVV  651

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR+A+ T L   P+N   + SGLLES++S++FGG +RLD FFPFDPCLL +SDRFIR
Sbjct  652  KEFLRLAKVTNL-DVPDNF--VSSGLLESDLSISFGGRERLDMFFPFDPCLLLRSDRFIR  708

Query  370  PNFIYWSMVRNTY  408
            PNF+YWSMVR++Y
Sbjct  709  PNFVYWSMVRSSY  721



>ref|XP_011087416.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Sesamum indicum]
Length=626

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK FYAGCQA MY++CFR   +  + R+KS L  MRIEDIL H L PL VCLPSIV
Sbjct  410  NPKAHKVFYAGCQATMYVLCFRMRQMLVIPRLKSQLCLMRIEDILGHPLKPLQVCLPSIV  469

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR+ +   +FS P++   +  G+LESE S AFGG +R D FFPFDPCLL+K D +IR
Sbjct  470  EEFLRLVKANHVFSLPQSF--VEYGMLESENSRAFGGMERFDMFFPFDPCLLRKCDSYIR  527

Query  370  PNFIYWSMVRNTYDE  414
            PN++YWSMVR+TYDE
Sbjct  528  PNYVYWSMVRSTYDE  542



>gb|KDO67466.1| hypothetical protein CISIN_1g0074032mg, partial [Citrus sinensis]
Length=292

 Score =   170 bits (430),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 2/139 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H L PL VCLPS+V
Sbjct  81   NPKAHRVFYSGCQAIMYVLCFRMRSIMDIPRLKSQLLLMPLETVLKHDLNPLKVCLPSVV  140

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ ++   LF+  E    + + LLESE+S AFGG +RLD FFPFDPCLLKKSD FIR
Sbjct  141  SEFLQQSKAARLFTVSETF--VFNDLLESELSRAFGGLERLDMFFPFDPCLLKKSDSFIR  198

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMV+  Y   E+D
Sbjct  199  PNFVYWSMVKTAYHGDEED  217



>gb|KDO67298.1| hypothetical protein CISIN_1g0416052mg, partial [Citrus sinensis]
Length=292

 Score =   169 bits (429),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 2/141 (1%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H+L PL VCLPS
Sbjct  79   NINPKAHRVFYSGCQAIMYVLCFRMRSIMDVPRLKSQLLLMPLETVLKHNLNPLKVCLPS  138

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V EFL+ ++   LF+  E    I + LLESE+S  FGG +RLD FFPFDPCLLKKSD F
Sbjct  139  VVSEFLQQSKAARLFTVSETF--IFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDSF  196

Query  364  IRPNFIYWSMVRNTYDEAEDD  426
            IRPNFIYWSMV+  Y   E+D
Sbjct  197  IRPNFIYWSMVKTAYHGDEED  217



>emb|CBI37506.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAIMY++CFR  S+ ++  ++S LL + +E IL+H L PL VCLPSIV
Sbjct  414  NPKAHQVFYSGCQAIMYVLCFRMRSMMNVPHLRSQLLLLPLETILKHPLSPLKVCLPSIV  473

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR A+   LF+  E    I S LLESE+S AFGG +RLD FFPFDPCLLKK DRFIR
Sbjct  474  EEFLRQAKAARLFTVSETF--IFSDLLESELSRAFGGIERLDMFFPFDPCLLKKCDRFIR  531

Query  370  PNFIYWSMVRNTYDEAED  423
            PNF+YWSM+R TYD+ ED
Sbjct  532  PNFVYWSMIRTTYDDGED  549



>ref|XP_010649342.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3 [Vitis vinifera]
Length=627

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAIMY++CFR  S+ ++  ++S LL + +E IL+H L PL VCLPSIV
Sbjct  414  NPKAHQVFYSGCQAIMYVLCFRMRSMMNVPHLRSQLLLLPLETILKHPLSPLKVCLPSIV  473

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR A+   LF+  E    I S LLESE+S AFGG +RLD FFPFDPCLLKK DRFIR
Sbjct  474  EEFLRQAKAARLFTVSETF--IFSDLLESELSRAFGGIERLDMFFPFDPCLLKKCDRFIR  531

Query  370  PNFIYWSMVRNTYDEAED  423
            PNF+YWSM+R TYD+ ED
Sbjct  532  PNFVYWSMIRTTYDDGED  549



>ref|XP_010272854.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nelumbo nucifera]
 ref|XP_010272855.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nelumbo nucifera]
Length=631

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 102/137 (74%), Gaps = 2/137 (1%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P  H+ FY+GCQAIMY++CFR  S+    R+KS LL M +E I RH L PL VCLPSIVE
Sbjct  418  PETHRVFYSGCQAIMYVLCFRMRSMMDSHRLKSQLLHMPLEPIFRHQLDPLKVCLPSIVE  477

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A+   LF+  E    + + LLES++S AFGG +RLD FFPFDPCLLKK DRFIRP
Sbjct  478  EFLRQAKAAHLFTVSETF--LFNNLLESDLSKAFGGMERLDMFFPFDPCLLKKCDRFIRP  535

Query  373  NFIYWSMVRNTYDEAED  423
            +F+YWSMV+ TYDE ED
Sbjct  536  SFVYWSMVKTTYDEGED  552



>ref|XP_004155826.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Cucumis sativus]
Length=625

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            ++PNP+AHK FY+GCQAIMY++CFR  SI  + R+KS LL M I  +L H L PL VCLP
Sbjct  410  VDPNPKAHKVFYSGCQAIMYVLCFRMRSILEIPRLKSQLLLMPIGPLLTHRLSPLKVCLP  469

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            SIVEEFLR A+   LF+  EN   I +GLLES+ S +FGG +RLD FFPFDPCLLKK DR
Sbjct  470  SIVEEFLRQAKVANLFTPSENF--IFNGLLESDYSRSFGGLERLDMFFPFDPCLLKKCDR  527

Query  361  FIRPNFIYWSMVRNTY  408
            ++RP+F+YWSMVR TY
Sbjct  528  YLRPHFVYWSMVRPTY  543



>ref|XP_004133864.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Cucumis sativus]
 gb|KGN56512.1| hypothetical protein Csa_3G122360 [Cucumis sativus]
Length=626

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            ++PNP+AHK FY+GCQAIMY++CFR  SI  + R+KS LL M I  +L H L PL VCLP
Sbjct  410  VDPNPKAHKVFYSGCQAIMYVLCFRMRSILEIPRLKSQLLLMPIGPLLTHRLSPLKVCLP  469

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            SIVEEFLR A+   LF+  EN   I +GLLES+ S +FGG +RLD FFPFDPCLLKK DR
Sbjct  470  SIVEEFLRQAKVANLFTPSENF--IFNGLLESDYSRSFGGLERLDMFFPFDPCLLKKCDR  527

Query  361  FIRPNFIYWSMVRNTY  408
            ++RP+F+YWSMVR TY
Sbjct  528  YLRPHFVYWSMVRPTY  543



>ref|XP_006483734.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Citrus sinensis]
Length=315

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 2/141 (1%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H+L PL VCLPS
Sbjct  102  NINPKAHRVFYSGCQAIMYVLCFRMRSIMDVPRLKSQLLLMPLETVLKHNLNPLKVCLPS  161

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V EFL+ ++   LF+  E    I + LLESE+S  FGG +RLD FFPFDPCLLKKSD F
Sbjct  162  VVSEFLQQSKAARLFTVSETF--IFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDSF  219

Query  364  IRPNFIYWSMVRNTYDEAEDD  426
            IRPNFIYWSMV+  Y   E+D
Sbjct  220  IRPNFIYWSMVKTAYHGDEED  240



>ref|XP_006483467.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Citrus sinensis]
Length=535

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 2/139 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H L PL VCLPS+V
Sbjct  324  NPKAHRVFYSGCQAIMYVLCFRMRSIMDIPRLKSQLLLMPLETVLKHDLNPLKVCLPSVV  383

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ ++   LF+  E    + + LLESE+S AFGG +RLD FFPFDPCLLKKSD FIR
Sbjct  384  SEFLQQSKAARLFTVSETF--VFNDLLESELSRAFGGLERLDMFFPFDPCLLKKSDSFIR  441

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMV+  Y   E+D
Sbjct  442  PNFVYWSMVKTAYHGDEED  460



>ref|XP_008438040.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cucumis melo]
 ref|XP_008438041.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cucumis melo]
 ref|XP_008438042.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cucumis melo]
 ref|XP_008438044.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cucumis melo]
Length=625

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            ++PNP+AHK FY+GCQAIMY++CFR  SI  + R+KS LL M I  +L H L PL VCLP
Sbjct  410  VDPNPKAHKVFYSGCQAIMYVLCFRMRSILEIPRLKSQLLLMPIGPLLTHRLSPLKVCLP  469

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            SIVEEFL+ A+   LF+  E    I +GLLESE S +FGG +RLD FFPFDPCLLKK DR
Sbjct  470  SIVEEFLQQAKVANLFTPSETF--IFNGLLESEYSRSFGGLERLDMFFPFDPCLLKKCDR  527

Query  361  FIRPNFIYWSMVRNTY  408
            ++RP+F+YWSMVR TY
Sbjct  528  YLRPHFVYWSMVRPTY  543



>ref|XP_006483560.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X2 [Citrus sinensis]
Length=535

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 2/141 (1%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H+L PL VCLPS
Sbjct  322  NINPKAHRVFYSGCQAIMYVLCFRMRSIMDVPRLKSQLLLMPLETVLKHNLNPLKVCLPS  381

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V EFL+ ++   LF+  E    I + LLESE+S  FGG +RLD FFPFDPCLLKKSD F
Sbjct  382  VVSEFLQQSKAARLFTVSETF--IFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDSF  439

Query  364  IRPNFIYWSMVRNTYDEAEDD  426
            IRPNFIYWSMV+  Y   E+D
Sbjct  440  IRPNFIYWSMVKTAYHGDEED  460



>gb|KCW53303.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis]
Length=609

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FYAGCQAIMY++CFR  S+ S+ R+KS L  M IE IL+H   PL VCLPS+V
Sbjct  390  NPLAHRVFYAGCQAIMYVLCFRMWSMMSIPRLKSQLFLMPIETILKHKSDPLKVCLPSVV  449

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A    LF+  + +  I   +LE+E+S AFGG +RLDTFFPFDPCLLKKSDRFIR
Sbjct  450  GEFLKQARAARLFTVSKTS--ISDDILETELSRAFGGLERLDTFFPFDPCLLKKSDRFIR  507

Query  370  PNFIYWSMVRNTY  408
            PNFI+WSMV+ TY
Sbjct  508  PNFIFWSMVKTTY  520



>ref|XP_006483466.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Citrus sinensis]
Length=628

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 2/139 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H L PL VCLPS+V
Sbjct  417  NPKAHRVFYSGCQAIMYVLCFRMRSIMDIPRLKSQLLLMPLETVLKHDLNPLKVCLPSVV  476

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ ++   LF+  E    + + LLESE+S AFGG +RLD FFPFDPCLLKKSD FIR
Sbjct  477  SEFLQQSKAARLFTVSETF--VFNDLLESELSRAFGGLERLDMFFPFDPCLLKKSDSFIR  534

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF+YWSMV+  Y   E+D
Sbjct  535  PNFVYWSMVKTAYHGDEED  553



>ref|XP_006483559.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X1 [Citrus sinensis]
Length=628

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 2/141 (1%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H+L PL VCLPS
Sbjct  415  NINPKAHRVFYSGCQAIMYVLCFRMRSIMDVPRLKSQLLLMPLETVLKHNLNPLKVCLPS  474

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V EFL+ ++   LF+  E    I + LLESE+S  FGG +RLD FFPFDPCLLKKSD F
Sbjct  475  VVSEFLQQSKAARLFTVSETF--IFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDSF  532

Query  364  IRPNFIYWSMVRNTYDEAEDD  426
            IRPNFIYWSMV+  Y   E+D
Sbjct  533  IRPNFIYWSMVKTAYHGDEED  553



>gb|KCW53301.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis]
Length=634

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FYAGCQAIMY++CFR  S+ S+ R+KS L  M IE IL+H   PL VCLPS+V
Sbjct  415  NPLAHRVFYAGCQAIMYVLCFRMWSMMSIPRLKSQLFLMPIETILKHKSDPLKVCLPSVV  474

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A    LF+  + +  I   +LE+E+S AFGG +RLDTFFPFDPCLLKKSDRFIR
Sbjct  475  GEFLKQARAARLFTVSKTS--ISDDILETELSRAFGGLERLDTFFPFDPCLLKKSDRFIR  532

Query  370  PNFIYWSMVRNTY  408
            PNFI+WSMV+ TY
Sbjct  533  PNFIFWSMVKTTY  545



>ref|XP_010033606.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3 [Eucalyptus grandis]
 gb|KCW53302.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis]
Length=633

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FYAGCQAIMY++CFR  S+ S+ R+KS L  M IE IL+H   PL VCLPS+V
Sbjct  414  NPLAHRVFYAGCQAIMYVLCFRMWSMMSIPRLKSQLFLMPIETILKHKSDPLKVCLPSVV  473

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A    LF+  + +  I   +LE+E+S AFGG +RLDTFFPFDPCLLKKSDRFIR
Sbjct  474  GEFLKQARAARLFTVSKTS--ISDDILETELSRAFGGLERLDTFFPFDPCLLKKSDRFIR  531

Query  370  PNFIYWSMVRNTY  408
            PNFI+WSMV+ TY
Sbjct  532  PNFIFWSMVKTTY  544



>ref|XP_010272853.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nelumbo nucifera]
Length=631

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            N  AH+ FY+GCQAIMY++CFR  S+    R+KS LL M +E I  H L PL VCLPSIV
Sbjct  417  NLEAHRVFYSGCQAIMYVLCFRMRSMMDSHRLKSQLLHMPLEPIFCHQLDPLKVCLPSIV  476

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR A+   LF+  E    + + LLES++S AFGG +RLD FFPFDPCLLKK DRFIR
Sbjct  477  EEFLRQAKAAHLFTVSETF--LFNNLLESDLSKAFGGMERLDMFFPFDPCLLKKCDRFIR  534

Query  370  PNFIYWSMVRNTYDEAED  423
            P+F+YWSMV+ TYD+ ED
Sbjct  535  PSFVYWSMVKTTYDDGED  552



>gb|EYU37427.1| hypothetical protein MIMGU_mgv1a004171mg [Erythranthe guttata]
Length=541

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 101/139 (73%), Gaps = 2/139 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NPR HK FYA CQAIMY++CFR   + ++ R+KS L+ MRIEDI      PL VCLPSIV
Sbjct  327  NPRVHKVFYAACQAIMYVLCFRLRQMLAVPRLKSQLVLMRIEDIFGSPFKPLQVCLPSIV  386

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR+ + + + S P++   +  GLLESE S AFGG++R D FFPFDPCLL+K D +IR
Sbjct  387  EEFLRLVKASNVISLPQSF--LDHGLLESEHSRAFGGSERFDMFFPFDPCLLRKCDSYIR  444

Query  370  PNFIYWSMVRNTYDEAEDD  426
             N++YWS VR  Y+E ED+
Sbjct  445  DNYVYWSTVRKAYEEDEDE  463



>gb|KDP41755.1| hypothetical protein JCGZ_26773 [Jatropha curcas]
Length=628

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAIMY++CFR  SI  +  +KSHLL   +E IL+H L PL VCLPSIV
Sbjct  416  NPKAHRVFYSGCQAIMYVLCFRMRSIMDVPGLKSHLLLKPMELILKHKLDPLKVCLPSIV  475

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR-FI  366
            EEFL+ A+   LF+ PE    I   LLESE S  FGG +RLD FFPFDPCLLK  DR FI
Sbjct  476  EEFLKQAKAAHLFTTPETF--ISEDLLESEFSREFGGLERLDMFFPFDPCLLKTCDRNFI  533

Query  367  RPNFIYWSMVRNTYDEAEDD  426
            RPNF+YW  VR TY   ++D
Sbjct  534  RPNFVYWKHVRTTYGSDQED  553



>ref|XP_007134114.1| hypothetical protein PHAVU_010G020100g [Phaseolus vulgaris]
 gb|ESW06108.1| hypothetical protein PHAVU_010G020100g [Phaseolus vulgaris]
Length=620

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 101/139 (73%), Gaps = 2/139 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NPRAH+ FY+GCQAIMYI+CFR  S+  + R+K  LL M +E I +H L PL VCLP++V
Sbjct  413  NPRAHQVFYSGCQAIMYIMCFRMKSLMDVPRLKLQLLNMPMEAIWKHKLSPLKVCLPTVV  472

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR A+   LF   E  + +   +LES++S AFGG  RLD FFPFDPCLLKKS+ +IR
Sbjct  473  VEFLRQAKAAKLFMASE--SFVFDDMLESDLSKAFGGMDRLDMFFPFDPCLLKKSESYIR  530

Query  370  PNFIYWSMVRNTYDEAEDD  426
            P+F+ WS VR TYDE +DD
Sbjct  531  PHFVRWSKVRTTYDEDDDD  549



>ref|XP_004508346.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Cicer arietinum]
 ref|XP_004508347.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Cicer arietinum]
 ref|XP_004508348.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X3 [Cicer arietinum]
Length=620

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 106/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            ++ NP+AH+ FY+GCQAIMY++CFR  S+  + R++  L++M +E +L+H L PL VCLP
Sbjct  412  VDMNPQAHQVFYSGCQAIMYLLCFRMRSLVDVPRLRMQLIKMPLEPMLKHKLSPLKVCLP  471

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            S+VEEFLR A+   LF   E+   + + LLES++S AFGG  RLD FFPFDPCLLKKS  
Sbjct  472  SVVEEFLRQAKAARLFMTSESF--VFNDLLESDLSKAFGGTDRLDMFFPFDPCLLKKSQS  529

Query  361  FIRPNFIYWSMVRNTYDEAEDD  426
            +++P+F++WS VR TYD  ++D
Sbjct  530  YLKPHFVHWSRVRTTYDTNDND  551



>gb|KJB18645.1| hypothetical protein B456_003G064600 [Gossypium raimondii]
 gb|KJB18646.1| hypothetical protein B456_003G064600 [Gossypium raimondii]
Length=629

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FY+GCQAIMY++CFR      + R+KS LL + +E +L+H L PL VCLPS+V
Sbjct  410  NPNAHRVFYSGCQAIMYVLCFRMKVFVDVPRLKSELL-IPLEQVLKHKLNPLKVCLPSVV  468

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR A+   LF+  +    I  GLLESE+S AFGG +RLDTFFPFDPCLLKK D FIR
Sbjct  469  EEFLRQAKAASLFTVCKTF--IFDGLLESELSRAFGGLERLDTFFPFDPCLLKKCDSFIR  526

Query  370  PNFIYWSMVRNTY  408
            P F++WSMV+ TY
Sbjct  527  PMFVFWSMVKPTY  539



>ref|XP_007046443.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046444.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046445.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90600.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90601.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90602.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=628

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FY+GCQAIMY++CFR      + R+K  LL M +E IL+H L PL VCLPS+V
Sbjct  410  NPNAHRVFYSGCQAIMYVLCFRMKVFMDVPRLKMQLL-MPMEQILKHKLNPLKVCLPSVV  468

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFLR ++  CLF+  +    +  GLLESE+S AFGG +RLDTFFPFDPCLLK+ D FIR
Sbjct  469  EEFLRQSKAACLFTVSKTF--VFDGLLESELSRAFGGLERLDTFFPFDPCLLKRCDSFIR  526

Query  370  PNFIYWSMVRNT  405
            P F++WSMV+ T
Sbjct  527  PMFVFWSMVKPT  538



>ref|XP_010674318.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3 [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 97/139 (70%), Gaps = 3/139 (2%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N NP AH+ FYAGCQAIMY++CFR  SI  + R+KS +  M +  I  + L P  VCLPS
Sbjct  422  NLNPTAHRLFYAGCQAIMYVLCFRMKSIIDIPRLKSQISAMPLRQIFVNHLEPFKVCLPS  481

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            IVEEF++ A++  L        PI   +LESE S AFGG +RLD FFPFDPCLLKKSD F
Sbjct  482  IVEEFVQQAKSANLL---HGGTPIFKDVLESEYSRAFGGIERLDMFFPFDPCLLKKSDSF  538

Query  364  IRPNFIYWSMVRNTYDEAE  420
            +RPNF+YWSMV+  Y+E E
Sbjct  539  LRPNFVYWSMVQKLYEEDE  557



>ref|XP_006415449.1| hypothetical protein EUTSA_v10007103mg [Eutrema salsugineum]
 gb|ESQ33802.1| hypothetical protein EUTSA_v10007103mg [Eutrema salsugineum]
Length=614

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH+ FY+GCQAI+Y++CFR  SI  + R +S LL +  E IL H L PLMVCLPS+V 
Sbjct  415  PEAHQVFYSGCQAILYVLCFRMRSILEVSRFQSQLLPL--ESILSHKLNPLMVCLPSVVS  472

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFL+ A+   LF   E  A I  GLLESE+S AFGG++RLDTFFPFDPCLLK S+ +I  
Sbjct  473  EFLKQAKAGGLFIVSE--AFIFDGLLESELSRAFGGHERLDTFFPFDPCLLKNSNSYISR  530

Query  373  NFIYWSMVRNTYDEAEDD  426
            NF YWSMV+ TY+E ++D
Sbjct  531  NFNYWSMVKPTYEEDDED  548



>gb|ACJ85821.1| unknown [Medicago truncatula]
Length=292

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+ CQAIMYI+CFR  S+  + R+K  L++M +E I +H L PL VCLPS+V
Sbjct  79   NPQAHQVFYSACQAIMYILCFRMKSLMEVPRLKVKLIKMPMELIWKHKLNPLKVCLPSVV  138

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFL+ A+   LF   E    I   LLE+++S AFGG  RLD FFPFDPCLLKKS+ ++R
Sbjct  139  EEFLKQAKAARLFMSAE--LFIFDDLLEADLSKAFGGINRLDMFFPFDPCLLKKSESYLR  196

Query  370  PNFIYWSMVRNTYD  411
            P+F+ WS VR TYD
Sbjct  197  PHFVRWSKVRTTYD  210



>ref|XP_003547884.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Glycine max]
 ref|XP_006599254.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Glycine max]
Length=627

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NPRAH+ FY+GCQAIMYI+CFR  S+  + R+K  LL M +E IL+H L PL VCLP++V
Sbjct  413  NPRAHQVFYSGCQAIMYILCFRMRSLMDIPRLKLQLLNMPMEAILKHKLSPLKVCLPTVV  472

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR A+   LF   E+   +   +LES++S AFGG  RLD FFPFDPCLLKKS+ +IR
Sbjct  473  VEFLRQAKAAQLFMASESF--VFDDMLESDLSKAFGGIDRLDMFFPFDPCLLKKSESYIR  530

Query  370  PNFIYWSMVRNTY  408
            P+F+ WS VR TY
Sbjct  531  PHFVRWSKVRTTY  543



>ref|XP_003534228.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Glycine max]
Length=628

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NPRAH+ FY+GCQAIMYI+CFR  S+  + R+K  LL M +E IL+H L PL VCLP++V
Sbjct  413  NPRAHQVFYSGCQAIMYIMCFRMRSLMDVPRLKLQLLNMPMEAILKHKLSPLKVCLPTVV  472

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR A+   LF   E  + +   +LES++S AFGG  RLD FFPFDPCLLK+S+ +IR
Sbjct  473  VEFLRQAKAAQLFMASE--SFVFDDMLESDLSKAFGGMDRLDMFFPFDPCLLKRSESYIR  530

Query  370  PNFIYWSMVRNTY  408
            P+F+ WS VR TY
Sbjct  531  PHFVRWSKVRTTY  543



>gb|KEH32234.1| transcription initiation factor ia protein, putative [Medicago 
truncatula]
Length=635

 Score =   157 bits (396),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+ CQAIMYI+CFR  S+  + R+K  L++M +E I +H L PL VCLPS+V
Sbjct  422  NPQAHQVFYSACQAIMYILCFRMKSLMEVPRLKVKLIKMPMELIWKHKLNPLKVCLPSVV  481

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            EEFL+ A+   LF   E    I   LLE+++S AFGG  RLD FFPFDPCLLKKS+ ++R
Sbjct  482  EEFLKQAKAARLFMSAE--LFIFDDLLEADLSKAFGGINRLDMFFPFDPCLLKKSESYLR  539

Query  370  PNFIYWSMVRNTYD  411
            P+F+ WS VR TYD
Sbjct  540  PHFVRWSKVRTTYD  553



>gb|KHN38852.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Glycine soja]
Length=628

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NPRAH+ FY+GCQAIMYI+CFR  S+  + R+K  LL M +E IL+H L PL VCLP++V
Sbjct  413  NPRAHQVFYSGCQAIMYIMCFRMRSLMDVPRLKLQLLNMPMEAILKHKLSPLKVCLPTVV  472

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR A+   LF   E  + +   +LES++S AFGG  RLD FFPFDPCLLK+S+ +IR
Sbjct  473  VEFLRQAKAAQLFMASE--SFVFDDMLESDLSKAFGGMDRLDMFFPFDPCLLKRSESYIR  530

Query  370  PNFIYWSMVRNTY  408
            P+F+ WS +R TY
Sbjct  531  PHFVRWSKIRTTY  543



>ref|XP_002524432.1| transcription initiation factor ia, putative [Ricinus communis]
 gb|EEF37967.1| transcription initiation factor ia, putative [Ricinus communis]
Length=640

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAI+Y++CFR  S+  +  +KS LL M +E I++H L PL VCLPSIV
Sbjct  428  NPKAHRVFYSGCQAILYVLCFRMSSMMDIPWLKSQLLHMPLEQIMKHKLGPLKVCLPSIV  487

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR-FI  366
            EEFL+ A+   LF+  + ++     +LESE S  FGG +RLD FFPFDPCLL+  DR FI
Sbjct  488  EEFLKQAKAAHLFTTSQTSS--FEDVLESEFSKDFGGLERLDMFFPFDPCLLRTCDRSFI  545

Query  367  RPNFIYWSMVRNTY  408
            RPNF+YW  VR TY
Sbjct  546  RPNFVYWKDVRTTY  559



>ref|XP_002307198.2| RNA polymerase 1 specific transcription initiation factor RRN3 
family protein [Populus trichocarpa]
 gb|EEE94194.2| RNA polymerase 1 specific transcription initiation factor RRN3 
family protein [Populus trichocarpa]
Length=637

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+ CQ IMY++CF   SI ++  +KS LL M IE IL+H L PL VCLPSIV
Sbjct  427  NPKAHQVFYSACQGIMYVLCFHMKSIMNVPTLKSQLLLMPIEPILKHKLGPLEVCLPSIV  486

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR-FI  366
             EFL+ A+   LF+   + A I   LLES++S  FGG +RLD FFPFDPCLLKK DR FI
Sbjct  487  NEFLKQAKAAHLFTI--SKAFIFEDLLESDLSRDFGGLERLDMFFPFDPCLLKKCDRGFI  544

Query  367  RPNFIYWSMVRNTY  408
            RPNFIYW+ V+ TY
Sbjct  545  RPNFIYWNHVKTTY  558



>dbj|BAF01881.1| hypothetical protein [Arabidopsis thaliana]
Length=410

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            +  P AH+ F++GCQAIMY++CFR  SI  + R +S L    +E IL H L PLMVCLPS
Sbjct  213  DTRPEAHQIFFSGCQAIMYVLCFRMRSILDVPRFRSQL--TPLESILMHKLNPLMVCLPS  270

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V EFLR A+   LF    +++ I   LLESE+S AFGG +RLDTFFPFDPCLLK S+ F
Sbjct  271  VVAEFLRQAKEGGLFIV--SDSFIFDDLLESELSRAFGGFERLDTFFPFDPCLLKSSNSF  328

Query  364  IRPNFIYWSMVRNTY  408
            I PNFIYWSMV+ TY
Sbjct  329  ISPNFIYWSMVKATY  343



>ref|XP_008681385.1| PREDICTED: uncharacterized protein LOC100272544 isoform X1 [Zea 
mays]
 gb|AFW69236.1| hypothetical protein ZEAMMB73_457339 [Zea mays]
Length=620

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            +  NP  H+ FYA CQA+MY++CFR  SI     +K  L RMRI DIL H L PL VCLP
Sbjct  408  VTANPIKHQLFYASCQAVMYVLCFRLRSIMDYPNLKQQLFRMRIRDILVHPLQPLKVCLP  467

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            SIV EFLR A    LF  P     +    +ES++S AFGG  RLD FFPFDP LLK+SDR
Sbjct  468  SIVNEFLRQATAASLFHAPA--ISMHEDAVESDLSKAFGGLNRLDMFFPFDPYLLKESDR  525

Query  361  FIRPNFIYWSMVRNTY--DEAEDD  426
            +IRPNF +WS+V+ TY  D +++D
Sbjct  526  YIRPNFEFWSLVKTTYSNDNSDED  549



>ref|XP_011022128.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3 [Populus euphratica]
Length=637

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AHK FY+ CQ IMY++CF   SI ++  +KS LL M IE IL+H L PL VCLPSIV
Sbjct  427  NPKAHKVFYSACQGIMYVLCFHMKSIMNVPTLKSQLLLMPIEPILKHKLGPLEVCLPSIV  486

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR-FI  366
             EFL+ A+   LF+   + A I   LLES++S  FGG +RLD FFPFDPCLLKK DR FI
Sbjct  487  NEFLKQAKAAHLFTI--SKAFIFEDLLESDLSRDFGGLERLDMFFPFDPCLLKKCDRGFI  544

Query  367  RPNFIYWSMVRNTY  408
            RP+FIYW+ V+ TY
Sbjct  545  RPHFIYWNHVKTTY  558



>gb|AFW69235.1| hypothetical protein ZEAMMB73_457339 [Zea mays]
Length=592

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            +  NP  H+ FYA CQA+MY++CFR  SI     +K  L RMRI DIL H L PL VCLP
Sbjct  380  VTANPIKHQLFYASCQAVMYVLCFRLRSIMDYPNLKQQLFRMRIRDILVHPLQPLKVCLP  439

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            SIV EFLR A    LF  P     +    +ES++S AFGG  RLD FFPFDP LLK+SDR
Sbjct  440  SIVNEFLRQATAASLFHAPA--ISMHEDAVESDLSKAFGGLNRLDMFFPFDPYLLKESDR  497

Query  361  FIRPNFIYWSMVRNTY--DEAEDD  426
            +IRPNF +WS+V+ TY  D +++D
Sbjct  498  YIRPNFEFWSLVKTTYSNDNSDED  521



>ref|XP_008392869.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Malus domestica]
Length=555

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FY+GCQAIMY++CFR  S+  +  +KS LLR+ +E +L + L PL VCLPSIV
Sbjct  346  NPEAHRVFYSGCQAIMYLLCFRMRSMMDVPLLKSWLLRLPLESVLNNKLSPLQVCLPSIV  405

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR ++   LF   +         LESE+S  FGG +RLD FFPFDPCLLKKSDR+IR
Sbjct  406  NEFLRQSKAAGLFMTLDKFD--FDDYLESELSKEFGGRERLDMFFPFDPCLLKKSDRYIR  463

Query  370  PNFIYWSMVRNTY  408
            P FI+WSMV  TY
Sbjct  464  PKFIFWSMVHPTY  476



>ref|XP_010540653.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Tarenaya hassleriana]
Length=614

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 94/132 (71%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P  H+ FY GCQAIMY++CFR  SI  + R+ S L    +E +L+H L PLMVCLPS+V 
Sbjct  415  PETHRVFYCGCQAIMYVMCFRMRSISDVPRLHSQL--APLESVLKHKLNPLMVCLPSVVG  472

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A++  LF+  E    +   +LESE+S AFGG +RLD FFPFDPCLLK S+ FIRP
Sbjct  473  EFLRQAKSAGLFTISETF--VFDDMLESELSRAFGGLERLDMFFPFDPCLLKISESFIRP  530

Query  373  NFIYWSMVRNTY  408
            NF+YWSMV  TY
Sbjct  531  NFVYWSMVGTTY  542



>gb|AAC16259.1| unknown protein [Arabidopsis thaliana]
Length=602

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            +  P AH+ F++GCQAIMY++CFR  SI  + R +S L    +E IL H L PLMVCLPS
Sbjct  405  DTRPEAHQIFFSGCQAIMYVLCFRMRSILDVPRFRSQL--TPLESILMHKLNPLMVCLPS  462

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V EFLR A+   LF    +++ I   LLESE+S AFGG +RLDTFFPFDPCLLK S+ F
Sbjct  463  VVAEFLRQAKEGGLFIV--SDSFIFDDLLESELSRAFGGFERLDTFFPFDPCLLKSSNSF  520

Query  364  IRPNFIYWSMVRNTY  408
            I PNFIYWSMV+ TY
Sbjct  521  ISPNFIYWSMVKATY  535



>ref|NP_850236.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
 gb|AAM20140.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13210.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09018.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
Length=613

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            +  P AH+ F++GCQAIMY++CFR  SI  + R +S L    +E IL H L PLMVCLPS
Sbjct  416  DTRPEAHQIFFSGCQAIMYVLCFRMRSILDVPRFRSQL--TPLESILMHKLNPLMVCLPS  473

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V EFLR A+   LF    +++ I   LLESE+S AFGG +RLDTFFPFDPCLLK S+ F
Sbjct  474  VVAEFLRQAKEGGLFIV--SDSFIFDDLLESELSRAFGGFERLDTFFPFDPCLLKSSNSF  531

Query  364  IRPNFIYWSMVRNTY  408
            I PNFIYWSMV+ TY
Sbjct  532  ISPNFIYWSMVKATY  546



>ref|XP_008354575.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Malus domestica]
Length=627

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FY+GCQAIMY++CFR  S+  +  +KS LLR+ +E +L + L PL VCLPSIV
Sbjct  418  NPEAHRVFYSGCQAIMYLLCFRMRSMMDVPLLKSWLLRLPLESVLNNKLSPLQVCLPSIV  477

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR ++   LF   +         LESE+S  FGG +RLD FFPFDPCLLKKSDR+IR
Sbjct  478  NEFLRQSKAAGLFMTLDKFD--FDDYLESELSKEFGGRERLDMFFPFDPCLLKKSDRYIR  535

Query  370  PNFIYWSMVRNTY  408
            P FI+WSMV  TY
Sbjct  536  PKFIFWSMVHPTY  548



>ref|XP_009369775.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Pyrus x bretschneideri]
Length=627

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FY+GCQAIMY++CFR  S+  +  +KS LLR+ +E +L + L PL VCLPSIV
Sbjct  418  NPEAHRVFYSGCQAIMYLLCFRMRSMMDVPLLKSWLLRLPLESVLNNKLSPLQVCLPSIV  477

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR ++   LF   +         LESE+S  FGG +RLD FFPFDPCLLKKSDR+IR
Sbjct  478  NEFLRQSKAAGLFMTLDKFD--FDDYLESELSKEFGGRERLDMFFPFDPCLLKKSDRYIR  535

Query  370  PNFIYWSMVRNTY  408
            P FI+WSMV  TY
Sbjct  536  PKFIFWSMVHPTY  548



>ref|XP_010088711.1| hypothetical protein L484_016497 [Morus notabilis]
 gb|EXB36892.1| hypothetical protein L484_016497 [Morus notabilis]
Length=616

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 3/139 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAIMY +CFR  SI  +   KS LL M I  IL H L PL VCLPSIV
Sbjct  413  NPKAHRIFYSGCQAIMYALCFRMRSIMGVPWFKSQLL-MPINLILSHKLSPLKVCLPSIV  471

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR ++   LF   E         LESE+S  FGG +RLD FFPFDPCLLK+ D FIR
Sbjct  472  TEFLRQSKAAGLFITSERFN--FDDYLESELSKGFGGMERLDMFFPFDPCLLKRCDSFIR  529

Query  370  PNFIYWSMVRNTYDEAEDD  426
            P ++YWSMVR TYD+ +++
Sbjct  530  PYYVYWSMVRPTYDDGQEE  548



>gb|KDO71565.1| hypothetical protein CISIN_1g0157611mg, partial [Citrus sinensis]
 gb|KDO71566.1| hypothetical protein CISIN_1g0157611mg, partial [Citrus sinensis]
Length=184

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +1

Query  49   AIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFLRVAETTCLF  228
            AIMY++CFR  SI  + R+KS LL M +E +L+H L PL VCLPS+V EFL+ ++   LF
Sbjct  1    AIMYVLCFRMRSIMDIPRLKSRLLLMPLETVLKHDLNPLKVCLPSVVSEFLQQSKAAHLF  60

Query  229  SFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFIYWSMVRNTY  408
            +  E+   I S +LESE+S AFGG +RLD FFPFDPCLLKKSD FIRP FIYW+MV+  Y
Sbjct  61   TVSESF--IFSDMLESELSRAFGGLERLDMFFPFDPCLLKKSDSFIRPKFIYWAMVKTAY  118

Query  409  DEAEDD  426
               ++D
Sbjct  119  HGDKED  124



>ref|XP_007204094.1| hypothetical protein PRUPE_ppa002914mg [Prunus persica]
 gb|EMJ05293.1| hypothetical protein PRUPE_ppa002914mg [Prunus persica]
Length=622

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FY+GCQAIMY++CFR  S+    ++K  L+R+ +E IL + L PL VCLPSIV
Sbjct  410  NPEAHRIFYSGCQAIMYLLCFRMRSMMDDPQLKPWLVRLPLESILNNKLSPLKVCLPSIV  469

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR A+   LF   E         LESE+S  FGG +RLD FFPFDPCLLKKSD +IR
Sbjct  470  LEFLRQAKAARLFMTSEKFN--FDDYLESELSREFGGMERLDMFFPFDPCLLKKSDSYIR  527

Query  370  PNFIYWSMVRNTY  408
            PNFI+WSMV+ TY
Sbjct  528  PNFIFWSMVQPTY  540



>ref|XP_002437492.1| hypothetical protein SORBIDRAFT_10g028030 [Sorghum bicolor]
 gb|EER88859.1| hypothetical protein SORBIDRAFT_10g028030 [Sorghum bicolor]
Length=593

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            +  NP  H+ FYA CQA+MY++CFR  SI     +K  L +MRI++IL H L PL VCLP
Sbjct  381  VTANPIKHQLFYASCQAVMYVLCFRLRSIMDYPNLKLQLFQMRIQNILAHPLEPLKVCLP  440

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            SIV EFLR A +  LF    N+       +ES++S AFGG  RLD FFPFDP LLK+SDR
Sbjct  441  SIVNEFLRQARSASLFHASVNST--HEDAVESDLSKAFGGLNRLDMFFPFDPYLLKESDR  498

Query  361  FIRPNFIYWSMVRNTYDEAEDD  426
            +IRPNF +WS+V+ TY     D
Sbjct  499  YIRPNFEFWSLVKTTYSNNNSD  520



>ref|XP_010913887.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X3 [Elaeis guineensis]
Length=523

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+GCQA+MY++CFR  SI  +  +KS LL M +  I+ H L PL VCLPSIV
Sbjct  320  KPEAHRVFYSGCQAVMYVLCFRMRSIMDVPHLKSLLLHMPLSSIMCHPLDPLKVCLPSIV  379

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR A+   LF+  ++   +   LLESE S AFGG +RLD FFPFDP LLK+SDRF+R
Sbjct  380  QEFLRQAKAARLFN--KSVPSLYDNLLESEFSKAFGGIERLDMFFPFDPYLLKESDRFMR  437

Query  370  PNFIYWSMVRNTY  408
            P+F +WSMV+ TY
Sbjct  438  PHFEFWSMVKTTY  450



>ref|XP_008242108.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Prunus mume]
Length=622

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FY+GCQAIMY++CFR  S+    ++K  L+R+ +E IL + L PL VCLPSIV
Sbjct  410  NPEAHRIFYSGCQAIMYLLCFRMRSMMDDPQLKPWLVRLPLESILNNKLSPLKVCLPSIV  469

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR A+   LF   E    I    LES++S  FGG +RLD FFPFDPCLL+KSD +IR
Sbjct  470  LEFLRQAKAARLFMTSEKF--IFDDYLESKLSREFGGMERLDMFFPFDPCLLEKSDSYIR  527

Query  370  PNFIYWSMVRNTY  408
            PNFI+WSMV+ TY
Sbjct  528  PNFIFWSMVQPTY  540



>ref|XP_010913886.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Elaeis guineensis]
Length=602

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+GCQA+MY++CFR  SI  +  +KS LL M +  I+ H L PL VCLPSIV
Sbjct  399  KPEAHRVFYSGCQAVMYVLCFRMRSIMDVPHLKSLLLHMPLSSIMCHPLDPLKVCLPSIV  458

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR A+   LF+  ++   +   LLESE S AFGG +RLD FFPFDP LLK+SDRF+R
Sbjct  459  QEFLRQAKAARLFN--KSVPSLYDNLLESEFSKAFGGIERLDMFFPFDPYLLKESDRFMR  516

Query  370  PNFIYWSMVRNTY  408
            P+F +WSMV+ TY
Sbjct  517  PHFEFWSMVKTTY  529



>ref|XP_010913884.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Elaeis guineensis]
 ref|XP_010913885.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Elaeis guineensis]
Length=626

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+GCQA+MY++CFR  SI  +  +KS LL M +  I+ H L PL VCLPSIV
Sbjct  423  KPEAHRVFYSGCQAVMYVLCFRMRSIMDVPHLKSLLLHMPLSSIMCHPLDPLKVCLPSIV  482

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR A+   LF+  ++   +   LLESE S AFGG +RLD FFPFDP LLK+SDRF+R
Sbjct  483  QEFLRQAKAARLFN--KSVPSLYDNLLESEFSKAFGGIERLDMFFPFDPYLLKESDRFMR  540

Query  370  PNFIYWSMVRNTY  408
            P+F +WSMV+ TY
Sbjct  541  PHFEFWSMVKTTY  553



>emb|CDY43658.1| BnaA04g20330D [Brassica napus]
Length=605

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH+ FY+GCQAIMY++CFR  SI ++   +S L+ +  E IL H L PLMVCLPS+V 
Sbjct  409  PEAHQIFYSGCQAIMYVLCFRMRSILNVPLFRSQLIPL--ESILMHRLNPLMVCLPSVVA  466

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFL+ A+   +F    ++A I   LLESE+S AFGG +RLDTFFPFD CLLK S+ +I P
Sbjct  467  EFLKQAKAGGMFVV--SDAFIFDDLLESELSRAFGGPERLDTFFPFDSCLLKSSNSYISP  524

Query  373  NFIYWSMVRNTY  408
            NFIYWSMVR TY
Sbjct  525  NFIYWSMVRPTY  536



>gb|KFK44868.1| hypothetical protein AALP_AA1G312900 [Arabis alpina]
Length=608

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 98/139 (71%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAI+Y++CFR  SI  + R +S L    +E IL H L PLMVCLPS+V
Sbjct  411  NPKAHQVFYSGCQAILYVLCFRMRSILDIPRSQSAL--APLESILTHKLNPLMVCLPSVV  468

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+   LF    + A I   LLESE+S AFGG +RLDTFFPFDPCLLK S+  I 
Sbjct  469  AEFLKQAKAGGLFIV--SKAFIFDDLLESELSRAFGGFERLDTFFPFDPCLLKISNSLIS  526

Query  370  PNFIYWSMVRNTYDEAEDD  426
             NF YWS V+ TYD+ +D+
Sbjct  527  SNFNYWSNVKPTYDDEDDE  545



>emb|CDX84629.1| BnaA03g16010D [Brassica napus]
Length=613

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH+ FY+GCQAIMY++CFR  SI  + R +S L+ +  E IL H L PLMVCLPS+V 
Sbjct  416  PEAHQLFYSGCQAIMYVLCFRMRSILDVPRFRSELIPL--ESILMHKLNPLMVCLPSVVA  473

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A+   LF    +++ I   LLESE+S AFGG +RLDTFFPFDPCLLK S+  I  
Sbjct  474  EFLRQAKAGGLFVV--SDSFIFEDLLESELSRAFGGCERLDTFFPFDPCLLKSSNSNISG  531

Query  373  NFIYWSMVRNTY  408
            NFIYWSMVR TY
Sbjct  532  NFIYWSMVRPTY  543



>ref|XP_009133000.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Brassica rapa]
Length=605

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH+ FY+GCQAIMY++CFR  SI  + R +S L+ +  E IL H L PLMVCLPS+V 
Sbjct  408  PEAHQLFYSGCQAIMYVLCFRMRSILDVPRFRSELIPL--ESILMHKLNPLMVCLPSVVA  465

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A+   LF    +++ I   LLESE+S AFGG +RLDTFFPFDPCLLK S+  I  
Sbjct  466  EFLRQAKAGGLFVV--SDSFIFEDLLESELSRAFGGCERLDTFFPFDPCLLKSSNSNISG  523

Query  373  NFIYWSMVRNTY  408
            NFIYWSMVR TY
Sbjct  524  NFIYWSMVRPTY  535



>ref|XP_004966190.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Setaria italica]
Length=618

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 96/142 (68%), Gaps = 8/142 (6%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P+ H+ FYA CQA+MY++CFR  SI     +KS L +M IE IL  +L PL VCLPSIV
Sbjct  412  KPKDHQIFYASCQAVMYVLCFRLRSIMDYPNLKSQLFQMPIESILMDTLEPLKVCLPSIV  471

Query  190  EEFLRVAETTCLFSFPENNAPIG---SGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
             EFLR +    LF     NA +      ++ES++S AFGG  RLD FFPFDP LL++SDR
Sbjct  472  NEFLRQSRAARLF-----NASVDLPLEDIVESDLSKAFGGPNRLDMFFPFDPYLLRESDR  526

Query  361  FIRPNFIYWSMVRNTYDEAEDD  426
            +IRPNF +WS+V+ TY + EDD
Sbjct  527  YIRPNFEFWSLVKTTYSDGEDD  548



>ref|XP_008805454.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Phoenix dactylifera]
Length=626

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+GCQA+MY++CFR  SI  +  +KS L  M +  IL H L PL VCLPSIV
Sbjct  423  KPEAHRVFYSGCQAVMYVLCFRMRSIMDVPHLKSLLFHMPLSSILGHPLDPLKVCLPSIV  482

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR A+   LF+  ++   +   LLES+ S AFGG +RLD FFPFDP LLK+SDRF+R
Sbjct  483  QEFLRQAKAARLFN--KSVPSLCDNLLESDFSKAFGGIERLDMFFPFDPYLLKESDRFVR  540

Query  370  PNFIYWSMVRNTY  408
            P+F +WSMV+ TY
Sbjct  541  PHFEFWSMVKTTY  553



>ref|XP_004966189.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Setaria italica]
Length=644

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 97/139 (70%), Gaps = 2/139 (1%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P+ H+ FYA CQA+MY++CFR  SI     +KS L +M IE IL  +L PL VCLPSIV
Sbjct  438  KPKDHQIFYASCQAVMYVLCFRLRSIMDYPNLKSQLFQMPIESILMDTLEPLKVCLPSIV  497

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR +    LF+    + P+   ++ES++S AFGG  RLD FFPFDP LL++SDR+IR
Sbjct  498  NEFLRQSRAARLFN-ASVDLPL-EDIVESDLSKAFGGPNRLDMFFPFDPYLLRESDRYIR  555

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF +WS+V+ TY + EDD
Sbjct  556  PNFEFWSLVKTTYSDGEDD  574



>ref|XP_009141397.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Brassica rapa]
Length=597

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH+ FY+GCQAIMY++CFR  SI ++   +S L    +E IL H L PLMVCLPS+V 
Sbjct  401  PEAHQIFYSGCQAIMYVLCFRMRSILNVPLFRSQL--RPLESILMHRLNPLMVCLPSVVA  458

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFL+ A+   +F    ++A I   LLESE+S AFGG +RLDTFFPFD CLLK S+ +I P
Sbjct  459  EFLKQAKAGGMFVV--SDAFIFDDLLESELSRAFGGPERLDTFFPFDSCLLKSSNSYISP  516

Query  373  NFIYWSMVRNTY  408
            NFIYWSMVR TY
Sbjct  517  NFIYWSMVRPTY  528



>ref|XP_006410626.1| hypothetical protein EUTSA_v10016395mg [Eutrema salsugineum]
 gb|ESQ52079.1| hypothetical protein EUTSA_v10016395mg [Eutrema salsugineum]
Length=616

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH+ FY+GCQ+IMY++CFR  SI  +   ++ L+ +  E IL H L PLMVCLPS+V 
Sbjct  419  PEAHQIFYSGCQSIMYVLCFRMRSILDVPHFRTQLIPL--ESILMHKLNPLMVCLPSVVA  476

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A+   LF    +++ I   LLESE+S AFGG +RLDTFFPFDPCLLK ++ FI P
Sbjct  477  EFLRQAKAGGLFIV--SDSFIFDDLLESELSRAFGGCERLDTFFPFDPCLLKDANSFISP  534

Query  373  NFIYWSMVRNTY  408
            NF YWSMV+ TY
Sbjct  535  NFNYWSMVKATY  546



>gb|KDO67467.1| hypothetical protein CISIN_1g0074032mg, partial [Citrus sinensis]
Length=202

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H L PL VCLPS+V
Sbjct  81   NPKAHRVFYSGCQAIMYVLCFRMRSIMDIPRLKSQLLLMPLETVLKHDLNPLKVCLPSVV  140

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
             EFL+ ++   LF+  E    + + LLESE+S AFGG +RLD FFPFDPCLLKKSDRF
Sbjct  141  SEFLQQSKAARLFTVSETF--VFNDLLESELSRAFGGLERLDMFFPFDPCLLKKSDRF  196



>emb|CDX79576.1| BnaC03g19120D [Brassica napus]
Length=608

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH+  Y+GCQAIMY++CFR  SI  + R +S L+ +  E IL H L PLMVCLPS+V 
Sbjct  412  PEAHQLLYSGCQAIMYVLCFRMRSILDVPRFRSELIPL--ESILMHRLNPLMVCLPSVVA  469

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A+   LF    +++ I   LLESE+S AFGG +RLDTFFPFDPCLLK S+  I  
Sbjct  470  EFLRQAKAGGLFVV--SDSFIFEDLLESELSRAFGGCERLDTFFPFDPCLLKSSNSNISG  527

Query  373  NFIYWSMVRNTY  408
            NFIYWSMVR TY
Sbjct  528  NFIYWSMVRPTY  539



>ref|XP_010928803.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Elaeis guineensis]
Length=610

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+G QA+MY++CFR  SI  +  +KS L  M +  IL H L PL VCLPSIV
Sbjct  399  KPEAHRVFYSGVQAVMYVLCFRMRSIMDVPNLKSLLFHMPLSSILCHPLDPLKVCLPSIV  458

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR A+   LFS   +   +   LLESE S A GG +RLD FFPFDP LLK+SDRF+R
Sbjct  459  QEFLRQAQAARLFSM--SVPSLYDNLLESEFSKAIGGIERLDMFFPFDPYLLKESDRFMR  516

Query  370  PNFIYWSMVRNTY  408
            PNF +W+MV+ TY
Sbjct  517  PNFEFWAMVKTTY  529



>dbj|BAD45609.1| RNA polymerase I specific transcription initiation factor RRN3-like 
[Oryza sativa Japonica Group]
 dbj|BAD46065.1| RNA polymerase I specific transcription initiation factor RRN3-like 
[Oryza sativa Japonica Group]
Length=291

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            I   P  H+ FYA CQA+MYI+CFR  SI     +K+ L  M    IL H L PL VCLP
Sbjct  79   ITTKPINHQIFYASCQAVMYILCFRLRSIMDYPNLKAQLFNMPFGYILTHPLEPLKVCLP  138

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGL---LESEVSMAFGGNQRLDTFFPFDPCLLKK  351
            SIV+EFLR A+   LF     NA + S     LES++S  FGG  RLD FFPFDP LLK+
Sbjct  139  SIVDEFLRQAKAARLF-----NASVHSEFEDALESDLSKTFGGMNRLDMFFPFDPYLLKE  193

Query  352  SDRFIRPNFIYWSMVRNTYD  411
            SDR++RPNF YWSMV+ TY+
Sbjct  194  SDRYMRPNFEYWSMVKTTYN  213



>ref|NP_174347.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
 gb|AEE31247.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
Length=604

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+GCQAI+Y++CFR  SI  + R +S      +E IL H L PL+VCLPS+V
Sbjct  405  KPEAHQVFYSGCQAILYVLCFRMRSIVEIPRFQSQF--RSLESILSHKLNPLLVCLPSVV  462

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+   LF   E  + I   L ESE+S AFGG +RLDTFFPFDPCLLK S  +I 
Sbjct  463  SEFLKQAKAGGLFIVSE--SFIFDDLHESELSRAFGGFERLDTFFPFDPCLLKMSSSYIS  520

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF +WSMV+ TY E  D+
Sbjct  521  PNFNFWSMVKTTYGEDGDE  539



>gb|AAD25746.1|AC007060_4 EST gb|Z37678 comes from this gene [Arabidopsis thaliana]
Length=622

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+GCQAI+Y++CFR  SI  + R +S      +E IL H L PL+VCLPS+V
Sbjct  423  KPEAHQVFYSGCQAILYVLCFRMRSIVEIPRFQSQF--RSLESILSHKLNPLLVCLPSVV  480

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+   LF   E  + I   L ESE+S AFGG +RLDTFFPFDPCLLK S  +I 
Sbjct  481  SEFLKQAKAGGLFIVSE--SFIFDDLHESELSRAFGGFERLDTFFPFDPCLLKMSSSYIS  538

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNF +WSMV+ TY E  D+
Sbjct  539  PNFNFWSMVKTTYGEDGDE  557



>ref|XP_010928802.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Elaeis guineensis]
Length=634

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+G QA+MY++CFR  SI  +  +KS L  M +  IL H L PL VCLPSIV
Sbjct  423  KPEAHRVFYSGVQAVMYVLCFRMRSIMDVPNLKSLLFHMPLSSILCHPLDPLKVCLPSIV  482

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR A+   LFS   +   +   LLESE S A GG +RLD FFPFDP LLK+SDRF+R
Sbjct  483  QEFLRQAQAARLFSM--SVPSLYDNLLESEFSKAIGGIERLDMFFPFDPYLLKESDRFMR  540

Query  370  PNFIYWSMVRNTY  408
            PNF +W+MV+ TY
Sbjct  541  PNFEFWAMVKTTY  553



>ref|XP_006467185.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Citrus sinensis]
Length=588

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = +1

Query  46   QAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFLRVAETTCL  225
            QAIMY++CFR  SI  + R+KS LL M +E +L+H L PL VCLPS+V EFL+ ++   L
Sbjct  389  QAIMYVLCFRMRSIMDIPRLKSRLLLMPLETVLKHDLNPLKVCLPSVVSEFLQQSKAAHL  448

Query  226  FSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFIYWSMVRNT  405
            F+  E  + I S +LESE+S  FGG +RLD FFPFDPCLLKKSD FIRP FIYW+MV+  
Sbjct  449  FTVSE--SFIFSDMLESELSRDFGGLERLDMFFPFDPCLLKKSDSFIRPKFIYWAMVKTA  506

Query  406  YDEAEDD  426
            Y   ++D
Sbjct  507  YHGDKED  513



>gb|EEC81212.1| hypothetical protein OsI_24246 [Oryza sativa Indica Group]
Length=622

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            I   P  H+ FYA CQA+MYI+CFR  SI     +K+ L  M    IL H L PL VCLP
Sbjct  410  ITTKPINHQIFYASCQAVMYILCFRLRSIMDYPNLKAQLFNMPFGYILTHPLEPLKVCLP  469

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGL---LESEVSMAFGGNQRLDTFFPFDPCLLKK  351
            SIV+EFLR A+   LF     NA + S     LES++S  FGG  RLD FFPFDP LLK+
Sbjct  470  SIVDEFLRQAKAARLF-----NASVHSEFEDALESDLSKTFGGMNRLDMFFPFDPYLLKE  524

Query  352  SDRFIRPNFIYWSMVRNTYD  411
            SDR++RPNF YWSMV+ TY+
Sbjct  525  SDRYMRPNFEYWSMVKTTYN  544



>ref|NP_001058413.2| Os06g0688100 [Oryza sativa Japonica Group]
 dbj|BAD45608.1| putative RNA polymerase I transcription factor RRN3 [Oryza sativa 
Japonica Group]
 dbj|BAD46064.1| putative RNA polymerase I transcription factor RRN3 [Oryza sativa 
Japonica Group]
 dbj|BAG94924.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66248.1| hypothetical protein OsJ_22429 [Oryza sativa Japonica Group]
 dbj|BAF20327.2| Os06g0688100 [Oryza sativa Japonica Group]
Length=622

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            I   P  H+ FYA CQA+MYI+CFR  SI     +K+ L  M    IL H L PL VCLP
Sbjct  410  ITTKPINHQIFYASCQAVMYILCFRLRSIMDYPNLKAQLFNMPFGYILTHPLEPLKVCLP  469

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGL---LESEVSMAFGGNQRLDTFFPFDPCLLKK  351
            SIV+EFLR A+   LF     NA + S     LES++S  FGG  RLD FFPFDP LLK+
Sbjct  470  SIVDEFLRQAKAARLF-----NASVHSEFEDALESDLSKTFGGMNRLDMFFPFDPYLLKE  524

Query  352  SDRFIRPNFIYWSMVRNTYD  411
            SDR++RPNF YWSMV+ TY+
Sbjct  525  SDRYMRPNFEYWSMVKTTYN  544



>ref|XP_009411620.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Musa acuminata subsp. malaccensis]
Length=629

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 98/146 (67%), Gaps = 11/146 (8%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRH-SLCPLMVCLPSI  186
            NP+AH+ FY+GCQA+MYI+CFR  +I  +  ++  L  M +  IL H +L PL VCLPSI
Sbjct  421  NPQAHRIFYSGCQAVMYILCFRMRAILDVSHLRQLLFHMPLVSILCHPNLDPLKVCLPSI  480

Query  187  VEEFLRVAETTCLF--SFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            V+EFLR A+   LF  S P     +    LESE S AFGG +RLD FFPFDP LLK SDR
Sbjct  481  VQEFLRQAKAGRLFKISIPY----LDDNSLESEFSKAFGGIERLDMFFPFDPYLLKDSDR  536

Query  361  FIRPNFIYWSMVRNTY----DEAEDD  426
            F+RPNF +WSMV+ TY     E ED+
Sbjct  537  FMRPNFEFWSMVKTTYSNCNSEGEDE  562



>ref|XP_009391870.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391871.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391872.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Musa acuminata subsp. malaccensis]
Length=632

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 5/135 (4%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRH-SLCPLMVCLPSI  186
            NP+AH+ FY+GCQA MYI+CFR  SI  +  +K  L  M +  IL H +L PL VCLPSI
Sbjct  420  NPQAHRVFYSGCQAAMYILCFRMRSILDVPHLKHLLFHMPLGSILCHPTLDPLKVCLPSI  479

Query  187  VEEFLRVAETTCLFSFPENNAP-IGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            V+EFLR A+   LF   + + P +    LESE S AFGG +RLD FFPFDP LLK+SDRF
Sbjct  480  VQEFLRQAKAARLF---KTSVPYLYDYSLESEFSKAFGGIERLDMFFPFDPYLLKESDRF  536

Query  364  IRPNFIYWSMVRNTY  408
            +RPNF +WSMV+ TY
Sbjct  537  MRPNFEFWSMVKTTY  551



>ref|XP_002881355.1| RNA polymerase I specific transcription initiation factor RRN3 
family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57614.1| RNA polymerase I specific transcription initiation factor RRN3 
family protein [Arabidopsis lyrata subsp. lyrata]
Length=614

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P  H+ F++GCQAIMY++CFR  SI  + R +S L    +E IL H L PL VCLPS+V 
Sbjct  418  PEEHQIFFSGCQAIMYVLCFRMRSILDVPRFRSQL--TPLESILMHKLNPLRVCLPSVVA  475

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A+   LF    +++ I   LLESE+S AFGG +RLDTFFPFDPCLLK S+ FI  
Sbjct  476  EFLRQAKAGGLFIV--SDSFIFDDLLESELSRAFGGCERLDTFFPFDPCLLKTSNSFISR  533

Query  373  NFIYWSMVRNT  405
            NFIYWSMV  T
Sbjct  534  NFIYWSMVSAT  544



>ref|XP_006296428.1| hypothetical protein CARUB_v10025608mg [Capsella rubella]
 gb|EOA29326.1| hypothetical protein CARUB_v10025608mg [Capsella rubella]
Length=608

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 90/131 (69%), Gaps = 4/131 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P  H  F++GCQAIMY++CFR  SI  + R+ S L    +E IL H L PL VCLPS+V 
Sbjct  413  PEVHPIFFSGCQAIMYVLCFRMKSILDVPRLWSQL--TPLESILMHKLDPLRVCLPSVVA  470

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFL+ A+   LF    +++ I    LESE+S AFGG  RLDTFFPFDPCLLK S+ FI P
Sbjct  471  EFLKQAKAGGLFIV--SDSFIFDNRLESELSSAFGGVNRLDTFFPFDPCLLKSSNSFISP  528

Query  373  NFIYWSMVRNT  405
            NFIYWSMV+ T
Sbjct  529  NFIYWSMVKAT  539



>ref|XP_006483561.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X3 [Citrus sinensis]
Length=534

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N NP+AH+ FY+GCQAIMY++CFR  SI  + R+KS LL M +E +L+H+L PL VCLPS
Sbjct  415  NINPKAHRVFYSGCQAIMYVLCFRMRSIMDVPRLKSQLLLMPLETVLKHNLNPLKVCLPS  474

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            +V EFL+ ++   LF+  E    I + LLESE+S  FGG +RLD FFPFDPCLLKKSDR
Sbjct  475  VVSEFLQQSKAARLFTVSETF--IFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDR  531



>ref|XP_010516632.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010516633.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010516634.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010516635.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
Length=615

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 91/136 (67%), Gaps = 12/136 (9%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH  F++GCQAIMY++CFR  SI  + R++S L    +E IL H L PL VC+PS+V 
Sbjct  419  PEAHLIFFSGCQAIMYVLCFRMRSILDVPRLRSEL--TPLESILTHKLDPLSVCIPSVVA  476

Query  193  EFLRVAETTCLF----SFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            EFLR A+   LF    SF  NN       LESE+S +FGG  +L TFFPFDPCLLK S+ 
Sbjct  477  EFLRQAKADGLFIVSDSFIFNNQ------LESELSGSFGGCDKLKTFFPFDPCLLKSSNS  530

Query  361  FIRPNFIYWSMVRNTY  408
            FI PNFIYWSMVR  Y
Sbjct  531  FISPNFIYWSMVRAPY  546



>ref|XP_010509710.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010509711.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010509712.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
Length=613

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH  F++GCQAIMY++CFR  SI  + R++S L    +E IL H L PL VC+PS+V 
Sbjct  418  PEAHLIFFSGCQAIMYVLCFRMRSILDVPRLRSEL--TPLESILTHKLDPLSVCIPSVVA  475

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A+   LF    +++ I + LLE E+S A GG  +L+TFFPFDPCLLK S+ FI P
Sbjct  476  EFLRQAKADGLFIV--SDSFIFNNLLEPELSGAIGGCDKLNTFFPFDPCLLKSSNSFISP  533

Query  373  NFIYWSMVRNTY  408
            NFIYWSMVR  Y
Sbjct  534  NFIYWSMVRAPY  545



>ref|XP_008782843.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Phoenix dactylifera]
Length=466

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH  FY+G QA+MY++CFR  SI  +  +KS L  M +  IL H L PL VCLPSIV
Sbjct  255  KPEAHCVFYSGFQAVMYVLCFRMRSIMDVPNLKSLLFHMPLSLILCHPLDPLKVCLPSIV  314

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR A+   LF+   +   +   LLESE S AFGG  RLD FFPFDP LLK+SDRF+R
Sbjct  315  QEFLRQAKAARLFNM--SVPSLYDNLLESEFSKAFGGIGRLDVFFPFDPYLLKESDRFMR  372

Query  370  PNFIYWSMVRNTY  408
            P + +WSMV+ TY
Sbjct  373  PKYEFWSMVKTTY  385



>ref|XP_010504951.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504952.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504953.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504954.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504955.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504956.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504957.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
Length=616

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P AH  F++GCQAIMY++CFR  SI  + R++S L    +E IL H L PL VC+PS+V 
Sbjct  420  PEAHLIFFSGCQAIMYVLCFRMRSILDVPRLRSEL--TPLESILTHKLDPLSVCIPSVVA  477

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFLR A+   LF    +++ I + LLESE+S  FGG  +L TFFPFDPCLLK S+ FI P
Sbjct  478  EFLRQAKADGLFIV--SDSFIFNNLLESELSGDFGGCDKLKTFFPFDPCLLKSSNSFISP  535

Query  373  NFIYWSMVRNTY  408
            +FIYWSMVR  Y
Sbjct  536  SFIYWSMVRAPY  547



>ref|NP_001140484.1| uncharacterized protein LOC100272544 [Zea mays]
 gb|ACF83926.1| unknown [Zea mays]
Length=195

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  55   MYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFLRVAETTCLFSF  234
            MY++CFR  SI     +K  L RMRI DIL H L PL VCLPSIV EFLR A    LF  
Sbjct  1    MYVLCFRLRSIMDYPNLKQQLFRMRIRDILVHPLQPLKVCLPSIVNEFLRQATAASLFHA  60

Query  235  PENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFIYWSMVRNTY--  408
            P     +    +ES++S AFGG  RLD FFPFDP LLK+SDR+IRPNF +WS+V+ TY  
Sbjct  61   PA--ISMHEDAVESDLSKAFGGLNRLDMFFPFDPYLLKESDRYIRPNFEFWSLVKTTYSN  118

Query  409  DEAEDD  426
            D +++D
Sbjct  119  DNSDED  124



>ref|XP_002893635.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69894.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=610

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 89/133 (67%), Gaps = 4/133 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH+ FY+GCQAI+Y++CF+  SI  + R +  L    +E IL H L PLMVCLPS+V
Sbjct  411  KPEAHQVFYSGCQAILYVLCFQMRSILDIPRFQLQL--TSLESILSHKLNPLMVCLPSVV  468

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+   LF   E  A I   L ESE+S AFGG +RLDTFFPFDPCLLK S  +I 
Sbjct  469  SEFLKQAKAGGLFIVSE--AFIFDDLHESELSRAFGGFERLDTFFPFDPCLLKMSSSYIS  526

Query  370  PNFIYWSMVRNTY  408
            PNF +W M + TY
Sbjct  527  PNFNFWLMEKTTY  539



>ref|XP_008782841.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Phoenix dactylifera]
Length=570

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P AH  FY+G QA+MY++CFR  SI  +  +KS L  M +  IL H L PL VCLPSIV
Sbjct  359  KPEAHCVFYSGFQAVMYVLCFRMRSIMDVPNLKSLLFHMPLSLILCHPLDPLKVCLPSIV  418

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFLR A+   LF+   +   +   LLESE S AFGG  RLD FFPFDP LLK+SDRF+R
Sbjct  419  QEFLRQAKAARLFNM--SVPSLYDNLLESEFSKAFGGIGRLDVFFPFDPYLLKESDRFMR  476

Query  370  PNFIYWSMVRNTY  408
            P + +WSMV+ TY
Sbjct  477  PKYEFWSMVKTTY  489



>ref|XP_006656405.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Oryza brachyantha]
Length=622

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 89/145 (61%), Gaps = 8/145 (6%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            I   P  H+ FYA CQA+MYI+CFR  SI     +KS L  M    IL H L PL VCLP
Sbjct  410  IITKPINHQIFYASCQAVMYILCFRLRSIMDYPNLKSQLFNMPFGYILTHPLEPLKVCLP  469

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGL---LESEVSMAFGGNQRLDTFFPFDPCLLKK  351
             IV+EFLR A+   LF     NA + S     LES++S  FGG  RLD FFPFDP LLK+
Sbjct  470  VIVDEFLRQAKAARLF-----NASMSSAFEDALESDLSRTFGGIDRLDMFFPFDPYLLKE  524

Query  352  SDRFIRPNFIYWSMVRNTYDEAEDD  426
            SDR+IRPNF +WS V+ TY     D
Sbjct  525  SDRYIRPNFEFWSRVKTTYSNYNSD  549



>ref|XP_006656406.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Oryza brachyantha]
Length=597

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 89/145 (61%), Gaps = 8/145 (6%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLP  180
            I   P  H+ FYA CQA+MYI+CFR  SI     +KS L  M    IL H L PL VCLP
Sbjct  385  IITKPINHQIFYASCQAVMYILCFRLRSIMDYPNLKSQLFNMPFGYILTHPLEPLKVCLP  444

Query  181  SIVEEFLRVAETTCLFSFPENNAPIGSGL---LESEVSMAFGGNQRLDTFFPFDPCLLKK  351
             IV+EFLR A+   LF     NA + S     LES++S  FGG  RLD FFPFDP LLK+
Sbjct  445  VIVDEFLRQAKAARLF-----NASMSSAFEDALESDLSRTFGGIDRLDMFFPFDPYLLKE  499

Query  352  SDRFIRPNFIYWSMVRNTYDEAEDD  426
            SDR+IRPNF +WS V+ TY     D
Sbjct  500  SDRYIRPNFEFWSRVKTTYSNYNSD  524



>gb|KHF98889.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Gossypium arboreum]
Length=523

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP AH+ FY+GCQAIMY++CFR      + R+KS LL + +E +L+H L PL VCLPS+V
Sbjct  410  NPNAHRVFYSGCQAIMYVLCFRMKVFVDVPRLKSELL-IPLEQVLKHKLNPLKVCLPSVV  468

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR  360
            EEFLR A+   LF+  +    I  GLLESE+S AFGG +RLDTFFPFDPCLLKK DR
Sbjct  469  EEFLRQAKAASLFTVCKTF--IFDGLLESELSRAFGGLERLDTFFPFDPCLLKKCDR  523



>ref|XP_003563455.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Brachypodium distachyon]
Length=622

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 2/129 (2%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFL  201
            H+ FYA CQA+MY++CFR  SI     +KS L  M    +L H L PL VCLPSIV EFL
Sbjct  416  HQIFYATCQAVMYVLCFRLRSIMDYPNLKSELFHMPFGFLLTHPLEPLKVCLPSIVNEFL  475

Query  202  RVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFI  381
            R A+   LF+   +  P     +ES++S  FGG  RLD FFPFDP LLK+SDR+IRPNF 
Sbjct  476  RQAKPAGLFTAFVD--PAFEDAIESDLSRTFGGVNRLDVFFPFDPYLLKESDRYIRPNFE  533

Query  382  YWSMVRNTY  408
            YWSMV+ TY
Sbjct  534  YWSMVKTTY  542



>ref|XP_010227381.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Brachypodium distachyon]
Length=538

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 2/129 (2%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFL  201
            H+ FYA CQA+MY++CFR  SI     +KS L  M    +L H L PL VCLPSIV EFL
Sbjct  332  HQIFYATCQAVMYVLCFRLRSIMDYPNLKSELFHMPFGFLLTHPLEPLKVCLPSIVNEFL  391

Query  202  RVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFI  381
            R A+   LF+   +  P     +ES++S  FGG  RLD FFPFDP LLK+SDR+IRPNF 
Sbjct  392  RQAKPAGLFTAFVD--PAFEDAIESDLSRTFGGVNRLDVFFPFDPYLLKESDRYIRPNFE  449

Query  382  YWSMVRNTY  408
            YWSMV+ TY
Sbjct  450  YWSMVKTTY  458



>ref|XP_008242159.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase I-specific transcription 
initiation factor rrn3-like, partial [Prunus mume]
Length=701

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            N  AH+ FY+GCQAIMY++CFR  S+    ++K  L+ + +E IL + L PL VCLP IV
Sbjct  312  NAEAHRIFYSGCQAIMYLLCFRMRSMMDDPQLKPXLVHLPLELILNNKLSPLKVCLPFIV  371

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFLR A+   +F   E         LESE+S  FGG +RLDTFFPF+PCLLKKSD +IR
Sbjct  372  LEFLRQAKAAKVFMTSEKFN--FDDYLESELSREFGGMERLDTFFPFEPCLLKKSDSYIR  429

Query  370  PNFIYWSMV  396
            PNFI+WSMV
Sbjct  430  PNFIFWSMV  438



>gb|EMS63005.1| hypothetical protein TRIUR3_02342 [Triticum urartu]
Length=571

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFL  201
            H+ FYA CQA+MY++CFR  SI     +KS L  M    + RH L PL VCLPSIV EFL
Sbjct  356  HQLFYATCQAVMYVLCFRLRSIMDYPNLKSDLFHMPFGFLFRHRLEPLKVCLPSIVNEFL  415

Query  202  RVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFI  381
            R A+   L +   +  P     +ES++S  FGG  RLD FFPFDP LLK+SDR+IRPNF 
Sbjct  416  RQAKVAGLVAAFVD--PAAEDAIESDLSRTFGGINRLDMFFPFDPYLLKESDRYIRPNFE  473

Query  382  YWSMVRNTY  408
            +WSMV+ TY
Sbjct  474  FWSMVKTTY  482



>ref|XP_006307098.1| hypothetical protein CARUB_v10008684mg [Capsella rubella]
 gb|EOA39996.1| hypothetical protein CARUB_v10008684mg [Capsella rubella]
Length=581

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 91/136 (67%), Gaps = 9/136 (7%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P+AH+ FY+GCQAI+Y++CF   SI  + R +S L    +E IL H L PLMVCLPS+V 
Sbjct  393  PKAHQVFYSGCQAILYVLCFHMRSILDIPRFQSQL--TSLESILSHKLNPLMVCLPSVVS  450

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFL+ ++   LF   E  A I   L ESE+S AFGG +RLDTFFPFDPCLLK S+R+I  
Sbjct  451  EFLKQSKAGGLFVVSE--AFIFDDLQESELSRAFGGFERLDTFFPFDPCLLKMSNRYISH  508

Query  373  NFIYWSMVRNTYDEAE  420
            NF  W     TY++ E
Sbjct  509  NFNSW-----TYNDEE  519



>ref|XP_009143744.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Brassica rapa]
Length=597

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 7/133 (5%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            N +AH+ FY+GCQAIMY++CFR  SI ++ R +S L+ +  E IL H L PL  CLP +V
Sbjct  406  NSKAHQIFYSGCQAIMYVLCFRMRSILAVPRFRSELIPL--ESILMHKLNPLKECLPWVV  463

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+   LF    +++ I   LLESE+S    G++RLD FFPFDPCLLK S+ FI 
Sbjct  464  AEFLKQAKAGGLFVV--SDSFIFDKLLESELS---RGSKRLDAFFPFDPCLLKSSNSFIS  518

Query  370  PNFIYWSMVRNTY  408
             NFIYWSMVR TY
Sbjct  519  GNFIYWSMVRPTY  531



>ref|XP_007204151.1| hypothetical protein PRUPE_ppa019726mg [Prunus persica]
 gb|EMJ05350.1| hypothetical protein PRUPE_ppa019726mg [Prunus persica]
Length=569

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 91/146 (62%), Gaps = 15/146 (10%)
 Frame = +1

Query  10   NPRAHKDFYAGCQ-------------AIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRH  150
            NP AH+ FY+G               AIMY++CFR  S+    ++K  L+R+ +E IL +
Sbjct  342  NPEAHRIFYSGSDDNECIVEHRLCHAAIMYLLCFRMRSMMDDPQLKPWLVRLPLESILNN  401

Query  151  SLCPLMVCLPSIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPF  330
             L PL VCLPSIV EFLR A+   LF   E         LESE+S  FGG +RLD FFPF
Sbjct  402  KLSPLKVCLPSIVLEFLRQAKAARLFMTSEKFN--FDDYLESELSREFGGMERLDMFFPF  459

Query  331  DPCLLKKSDRFIRPNFIYWSMVRNTY  408
            DPCLLKKSD  IRPNFI+WSMV+ TY
Sbjct  460  DPCLLKKSDSCIRPNFIFWSMVQPTY  485



>ref|XP_004287706.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Fragaria vesca subsp. vesca]
Length=628

 Score =   131 bits (329),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 69/139 (50%), Positives = 87/139 (63%), Gaps = 3/139 (2%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP   K FYA CQAIMY++CFR  S+    + KS L  + +E IL   + PL  C+PSIV
Sbjct  415  NPENDKLFYAACQAIMYLLCFRMRSLMDDPQSKSLLAGLPLESILSTQISPLKACVPSIV  474

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EFL  A    L +  E +       LESE S  +GG + L   FPFDPCLL+ SDRFIR
Sbjct  475  KEFLWQANAAGLITADEFDF---DDDLESEYSWVWGGKEELHKLFPFDPCLLRNSDRFIR  531

Query  370  PNFIYWSMVRNTYDEAEDD  426
            PNFIYWSMV+ TYD+ + +
Sbjct  532  PNFIYWSMVQRTYDDEDKE  550



>ref|XP_010460864.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Camelina sativa]
Length=611

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P+AH+ FY+GCQAI+Y++CFR  SI  + R +S  L   +E IL H L PLMVCLPS+V
Sbjct  407  KPKAHQVFYSGCQAILYVLCFRMRSILDIPRFQS--LLTPLESILCHKLNPLMVCLPSVV  464

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+T  LF   E  A     L +SE+S AFGG +RLDTFFP   CLLKKS RF  
Sbjct  465  SEFLKQAKTGGLFVVSE--AFNFDDLQKSELSRAFGGFERLDTFFPLSLCLLKKSSRFTL  522

Query  370  PNFIYWSMVRNTYDEAED  423
              F +WS V+ TY E ++
Sbjct  523  FTFDFWSKVKTTYYEDDE  540



>emb|CDY31637.1| BnaA05g09100D [Brassica napus]
Length=583

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            N  AH+ FY+GCQAIMY++CFR  SI ++ R +S L+ +  E IL H L PL  CLP +V
Sbjct  392  NSDAHQIFYSGCQAIMYVLCFRMRSIVAVPRFRSELIPL--ESILMHRLNPLKECLPWVV  449

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+   LF    +++ I   LLESE+S    G+++LD FFPFDPCLLK S+ FI 
Sbjct  450  AEFLKQAKAGGLFVV--SDSFIFDKLLESELS---RGSKKLDAFFPFDPCLLKSSNSFIS  504

Query  370  PNFIYWSMVRNTY  408
             NFIYWSMVR TY
Sbjct  505  RNFIYWSMVRPTY  517



>ref|XP_010552505.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Tarenaya hassleriana]
Length=550

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 88/134 (66%), Gaps = 5/134 (4%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P +H+ FY+GCQAIMY++CFR  +I  + R KS  L M +E +L+H L PL VCLPS+V
Sbjct  395  KPESHRVFYSGCQAIMYVLCFRMAAIIDVPRHKS--LLMPLETVLKHKLNPLTVCLPSVV  452

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSD-RFI  366
             EFLR A+    F+F E          ESE S AFG  +R+D+FFPFDPCLLK S+  +I
Sbjct  453  TEFLRQAKAAA-FTFSEAFV-FEEERQESEPSNAFGRKERIDSFFPFDPCLLKTSEISYI  510

Query  367  RPNFIYWSMVRNTY  408
            R N++YW  VR  Y
Sbjct  511  RENYVYWGDVRKAY  524



>gb|KDO71567.1| hypothetical protein CISIN_1g0157611mg, partial [Citrus sinensis]
Length=109

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = +1

Query  49   AIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFLRVAETTCLF  228
            AIMY++CFR  SI  + R+KS LL M +E +L+H L PL VCLPS+V EFL+ ++   LF
Sbjct  1    AIMYVLCFRMRSIMDIPRLKSRLLLMPLETVLKHDLNPLKVCLPSVVSEFLQQSKAAHLF  60

Query  229  SFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFI  381
            +  E+   I S +LESE+S AFGG +RLD FFPFDPCLLKKSDRF     +
Sbjct  61   TVSESF--IFSDMLESELSRAFGGLERLDMFFPFDPCLLKKSDRFANATLL  109



>gb|EMT22842.1| hypothetical protein F775_01666 [Aegilops tauschii]
Length=604

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = +1

Query  46   QAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFLRVAETTCL  225
             A+MY++CFR  SI     +K+ L ++    IL H L PL VCLPSIV EFLR A+   L
Sbjct  397  SAVMYVLCFRLRSIMDYPNLKAQLFQLSFGFILNHRLEPLKVCLPSIVNEFLRQAKDAGL  456

Query  226  FSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFIYWSMVRNT  405
            F+    +A      +ES++S AFGG  RLDTFFPFDP LLK+SDR+IRPNF +WSMV+ T
Sbjct  457  FAASMYSA--AEDAIESDLSRAFGGINRLDTFFPFDPYLLKESDRYIRPNFEFWSMVKTT  514

Query  406  Y  408
            Y
Sbjct  515  Y  515



>ref|XP_006849976.1| hypothetical protein AMTR_s00022p00154500 [Amborella trichopoda]
 gb|ERN11557.1| hypothetical protein AMTR_s00022p00154500 [Amborella trichopoda]
Length=563

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            NP  H+ FY+GCQA+MY++CFR G+I  +  +KSH+ R  +E +L HSL PL VCLPSIV
Sbjct  444  NPATHRVFYSGCQAVMYVVCFRIGAIMEIPYLKSHIFR-PLESVLHHSLNPLKVCLPSIV  502

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFI  366
            EEFLR  +   +F+       I   LLESE S  FGG +RLD FFPFDP LLK+S+R++
Sbjct  503  EEFLRRTKVADVFT--SLATAIVQNLLESENSRTFGGVERLDMFFPFDPYLLKRSERYL  559



>ref|XP_010519059.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Tarenaya hassleriana]
Length=561

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P +H+ FY+GCQA+MY++CFR  +I  + R KS  L M +E +L+H L PL VCL S+V
Sbjct  406  KPESHRVFYSGCQAVMYVLCFRMAAIIDVPRHKS--LLMPLETVLKHKLNPLTVCLSSVV  463

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSD-RFI  366
             EFLR A+    F+F E          ESE S A GG +R+D+FFPFDPCLLK S+  +I
Sbjct  464  TEFLRQAKAAA-FTFSEAFV-FEEERQESEPSNASGGKERIDSFFPFDPCLLKTSEISYI  521

Query  367  RPNFIYWSMVRNTY  408
            R N++YW  VR  Y
Sbjct  522  RENYVYWGNVRKAY  535



>emb|CDY71933.1| BnaCnng75170D, partial [Brassica napus]
Length=348

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 82/134 (61%), Gaps = 10/134 (7%)
 Frame = +1

Query  19   AHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEF  198
             H  FY+GCQAIMY++CFR  SI  + R +  LL   +E +L H L PL  C P +V EF
Sbjct  163  GHLVFYSGCQAIMYVLCFRMRSILDVPRFQ--LLLTPLESVLYHKLNPLKECNPYVVSEF  220

Query  199  LRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNF  378
            L+ A+   LF   E  A I   L ESE S AFGG      FF FDPCL K S+ FI PNF
Sbjct  221  LKQAKAGGLFIVSE--AFIFGDLPESETSRAFGG------FFSFDPCLFKISNSFISPNF  272

Query  379  IYWSMVRNTYDEAE  420
            IYWSMV+ T+DE E
Sbjct  273  IYWSMVKRTHDEDE  286



>ref|XP_010478481.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like [Camelina sativa]
 ref|XP_010478483.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like [Camelina sativa]
Length=597

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P+AH+ FY+GCQAI+Y++CFR  SI  + R +S  L   +E IL H L PLMVCLPS+V
Sbjct  405  KPKAHQVFYSGCQAILYVLCFRMRSILDIPRFQS--LLTPLESILCHKLNPLMVCLPSVV  462

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+T  LF   E  A     L ESE+S AFGG +RL      DPCLLKKS   I 
Sbjct  463  SEFLKQAKTGGLFVVSE--AFNFDDLQESELSRAFGGFERL------DPCLLKKSSSLIS  514

Query  370  PNFIYWSMVRNTY  408
            P+F  WS V+ TY
Sbjct  515  PHFNLWSEVKTTY  527



>ref|XP_002967968.1| hypothetical protein SELMODRAFT_440149 [Selaginella moellendorffii]
 gb|EFJ31315.1| hypothetical protein SELMODRAFT_440149 [Selaginella moellendorffii]
Length=637

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFL  201
            H  FYA CQA+MYI+CFR   +H+    +  L  +R++ ++ H LCPL VCLPS+VEEF+
Sbjct  442  HGVFYAACQAVMYILCFRLRELHADSTQRPLLKGLRLQQLIEHKLCPLKVCLPSVVEEFV  501

Query  202  RVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFI  381
            R A    L S+     P  S   E     ++GG+ RL+ FFPFDP LL++SDRFI P F 
Sbjct  502  RQATAIQLISYSGTVEP--SSGFEVLSFKSYGGDNRLEMFFPFDPYLLRRSDRFIEPIFT  559

Query  382  YWSMVR--NTYDEAEDD  426
            +WS     N  +E   D
Sbjct  560  HWSAAHSANEVEEQSSD  576



>gb|KHN03116.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Glycine soja]
Length=214

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 4/105 (4%)
 Frame = +1

Query  100  RIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFLRVAETTCLFSFPENNAPIGSGLLESE  279
            R+K  LL M +E IL+H L PL VCLP++V EFLR A+   LF   E+   +   +LES+
Sbjct  28   RLKLQLLNMPMEAILKHKLSPLKVCLPTVVVEFLRQAKAAQLFMASESF--VFDDMLESD  85

Query  280  VSMAFGGNQRLDTFFPFDPCLLKKSDR--FIRPNFIYWSMVRNTY  408
            +S AFGG  RLD FFPFDPCLLKKS+R  +IRP+F+ WS VR TY
Sbjct  86   LSKAFGGIDRLDMFFPFDPCLLKKSERQVYIRPHFVRWSKVRTTY  130



>ref|XP_002963952.1| hypothetical protein SELMODRAFT_405493 [Selaginella moellendorffii]
 gb|EFJ34285.1| hypothetical protein SELMODRAFT_405493 [Selaginella moellendorffii]
Length=635

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFL  201
            H  FYA CQA+MYI+CFR   +++    +  L  +R++ ++ H LCPL VCLPS+VEEF+
Sbjct  442  HGVFYAACQAVMYILCFRLRELYAESTQRPLLKGLRLQQLIEHKLCPLKVCLPSVVEEFV  501

Query  202  RVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFI  381
            R A    L S+     P  S   E     ++GG+ RL+ FFPFDP LL++SDRFI P F 
Sbjct  502  RQATAIQLISYSGTVEP--SSGFEVLSFKSYGGDNRLEMFFPFDPYLLRRSDRFIEPIFT  559

Query  382  YWSMVR--NTYDEAEDD  426
            +WS     N  +E   D
Sbjct  560  HWSAAHSANEVEEQSSD  576



>ref|XP_010460863.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Camelina sativa]
Length=538

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 82/123 (67%), Gaps = 4/123 (3%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P+AH+ FY+GCQAI+Y++CFR  SI  + R +S  L   +E IL H L PLMVCLPS+V
Sbjct  407  KPKAHQVFYSGCQAILYVLCFRMRSILDIPRFQS--LLTPLESILCHKLNPLMVCLPSVV  464

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+T  LF   E  A     L +SE+S AFGG +RLDTFFP   CLLKKS R I 
Sbjct  465  SEFLKQAKTGGLFVVSE--AFNFDDLQKSELSRAFGGFERLDTFFPLSLCLLKKSSRSIS  522

Query  370  PNF  378
             +F
Sbjct  523  RHF  525



>emb|CDX84284.1| BnaC04g10460D [Brassica napus]
Length=600

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            N  A++ FY+GCQAIMY++CFR  SI ++   +S L+ +  E IL H L PL  CLP +V
Sbjct  413  NSDANQIFYSGCQAIMYVLCFRMRSILAVPCFRSELIPL--ESILMHKLNPLKECLPWVV  470

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             EFL+ A+   LF    +++ I   LLES         +RLD FFPFDPCLLK S+ FI 
Sbjct  471  AEFLKQAKAGGLFVV--SDSFIFDKLLES---------KRLDAFFPFDPCLLKSSNSFIS  519

Query  370  PNFIYWSMVRNTY  408
             NFIYWSMVR TY
Sbjct  520  RNFIYWSMVRPTY  532



>ref|XP_001771048.1| predicted protein [Physcomitrella patens]
 gb|EDQ64203.1| predicted protein [Physcomitrella patens]
Length=624

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 87/144 (60%), Gaps = 7/144 (5%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            +P  H  FY  CQA+MY++CFR   +    R+K  L  + +++++ H L PL VCLPS+V
Sbjct  366  DPVLHGVFYCACQAVMYVLCFRLKDLTEDQRLKRVLRTLPLQELVEHHLKPLKVCLPSVV  425

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EF++ A    L    + +    +  ++S  S  FGG  RLD FFPFDP LL++SDRFIR
Sbjct  426  DEFVKQASIAQLVDCRQWSNTRDATAVQSAGS--FGGEGRLDMFFPFDPYLLRESDRFIR  483

Query  370  PNFIYWSMVR-----NTYDEAEDD  426
            P+FI W+MV        Y + +DD
Sbjct  484  PHFIQWAMVEPPEIIEEYSDEDDD  507



>ref|XP_001775034.1| predicted protein [Physcomitrella patens]
 gb|EDQ60141.1| predicted protein [Physcomitrella patens]
Length=655

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 87/144 (60%), Gaps = 7/144 (5%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
            +P  H  FY  CQA+MY++CFR   +    R+K  L  + +++++ H L PL +CLPS+V
Sbjct  400  DPVLHGVFYCACQAVMYVLCFRLKDLTEDQRLKRLLRNLPLQELVEHHLKPLTICLPSVV  459

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
            +EF++ A    L    + +    +    S+   +FGG  RLD FFPFDP LL++SDRFIR
Sbjct  460  DEFVKQASIAQLVDCRQWSNIRDAA--ASQACGSFGGEGRLDMFFPFDPYLLRQSDRFIR  517

Query  370  PNFIYWSMVR-----NTYDEAEDD  426
            P+FI+W+MV        + E +DD
Sbjct  518  PHFIHWAMVELPELYEEFSEEDDD  541



>gb|AAC28984.1| unknown protein [Arabidopsis thaliana]
Length=545

 Score =   104 bits (259),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 83/136 (61%), Gaps = 11/136 (8%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P  H+ FY+GCQAI+Y++CFR  SI  +   +S L    +E +L H L PL VCL S+V 
Sbjct  363  PEVHQVFYSGCQAILYVLCFRMRSILEVPHFQSQL--TPLESVLSHKLDPLRVCLSSVVS  420

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFL  A+   LF    ++A I   L ESE+S A GG      FFPF P LL+KS+  I P
Sbjct  421  EFLIQAKACGLFIV--SDAFIFDDLSESELSRALGG------FFPF-PWLLEKSNSLISP  471

Query  373  NFIYWSMVRNTYDEAE  420
            +FI  S V+ TY++AE
Sbjct  472  HFIKRSEVKKTYEQAE  487



>ref|NP_181457.2| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
 gb|ABE65893.1| RNA polymerase I specific transcription initiation factor RRN3 
family protein [Arabidopsis thaliana]
 gb|AEC09649.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
Length=573

 Score =   104 bits (259),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 83/136 (61%), Gaps = 11/136 (8%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P  H+ FY+GCQAI+Y++CFR  SI  +   +S L    +E +L H L PL VCL S+V 
Sbjct  391  PEVHQVFYSGCQAILYVLCFRMRSILEVPHFQSQL--TPLESVLSHKLDPLRVCLSSVVS  448

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFL  A+   LF    ++A I   L ESE+S A GG      FFPF P LL+KS+  I P
Sbjct  449  EFLIQAKACGLFIV--SDAFIFDDLSESELSRALGG------FFPF-PWLLEKSNSLISP  499

Query  373  NFIYWSMVRNTYDEAE  420
            +FI  S V+ TY++AE
Sbjct  500  HFIKRSEVKKTYEQAE  515



>ref|XP_006293892.1| hypothetical protein CARUB_v10022885mg [Capsella rubella]
 gb|EOA26790.1| hypothetical protein CARUB_v10022885mg [Capsella rubella]
Length=585

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 17/140 (12%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            + +P AH+ FY+GCQAI+++ CFR  SI ++   +S L+ +  E +L H L PL VCLPS
Sbjct  403  DASPEAHQVFYSGCQAILHVFCFRMSSILNVPHFQSQLIPL--ESVLSHKLDPLRVCLPS  460

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V +FL  A+ + LF   +  A I   L +SE+S A GG      FFPFD CLLK S+R+
Sbjct  461  VVSQFLYQAKASGLFIVLD--AFILDELSKSELSRALGG------FFPFDRCLLKNSNRY  512

Query  364  IRPNFIYWSMVRNTYDEAED  423
            I       S V+ TYDE +D
Sbjct  513  I-------SRVKRTYDEDDD  525



>ref|XP_010499599.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X2 [Camelina sativa]
Length=597

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 85/141 (60%), Gaps = 10/141 (7%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P+AH+ FY+GCQAI+Y++CFR  SI  + R +S  L   +E  L H L PLMVC PS+V
Sbjct  408  KPKAHQVFYSGCQAILYVLCFRMRSILDIPRFQS--LLTPLESTLCHKLNPLMVCHPSVV  465

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR---  360
             EFL+ A+   LF   E  A   + L ESE+S AFG  +RL+   PF P LLK S R   
Sbjct  466  SEFLKQAKAGGLFVVSE--AFNFNDLQESELSRAFGSFERLE---PFSPYLLKMSSRLED  520

Query  361  FIRPNFIYWSMVRNTYDEAED  423
             I  +F  WSM + T DE ++
Sbjct  521  LISRHFNVWSMPKTTCDEDDE  541



>ref|XP_010499598.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X1 [Camelina sativa]
Length=622

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 85/141 (60%), Gaps = 10/141 (7%)
 Frame = +1

Query  10   NPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIV  189
             P+AH+ FY+GCQAI+Y++CFR  SI  + R +S  L   +E  L H L PLMVC PS+V
Sbjct  433  KPKAHQVFYSGCQAILYVLCFRMRSILDIPRFQS--LLTPLESTLCHKLNPLMVCHPSVV  490

Query  190  EEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDR---  360
             EFL+ A+   LF   E  A   + L ESE+S AFG  +RL+   PF P LLK S R   
Sbjct  491  SEFLKQAKAGGLFVVSE--AFNFNDLQESELSRAFGSFERLE---PFSPYLLKMSSRLED  545

Query  361  FIRPNFIYWSMVRNTYDEAED  423
             I  +F  WSM + T DE ++
Sbjct  546  LISRHFNVWSMPKTTCDEDDE  566



>ref|XP_002879723.1| hypothetical protein ARALYDRAFT_902994 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55982.1| hypothetical protein ARALYDRAFT_902994 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 10/127 (8%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            +  P  H+ FY+ CQAI+Y++CFR  SI  + R +S +    +E +L H L PL VCLPS
Sbjct  366  DARPEEHQVFYSVCQAILYLLCFRMRSILDVPRFRSQI--TPLESVLSHKLDPLRVCLPS  423

Query  184  IVEEFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRF  363
            +V EFL  A+   LF    ++A I   L ESE+S A GG      FFPFDPCLLKK++RF
Sbjct  424  VVSEFLYQAKAGGLFIV--SDAFIFDDLPESELSRALGG------FFPFDPCLLKKTNRF  475

Query  364  IRPNFIY  384
                 ++
Sbjct  476  TILTLVF  482



>ref|XP_009359751.1| PREDICTED: uncharacterized protein LOC103950283 [Pyrus x bretschneideri]
Length=517

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  268  LESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFIYWSMVRNTYDEAED  423
            LESE+S  FGG +RLD FFPFDPCLLKKSDR+IRP FI+WSMV  TYD  ED
Sbjct  388  LESELSKEFGGRERLDMFFPFDPCLLKKSDRYIRPKFIFWSMVHPTYDIDED  439



>ref|XP_002881638.1| hypothetical protein ARALYDRAFT_321615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57897.1| hypothetical protein ARALYDRAFT_321615 [Arabidopsis lyrata subsp. 
lyrata]
Length=584

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 74/137 (54%), Gaps = 24/137 (18%)
 Frame = +1

Query  13   PRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVE  192
            P  H+DFY+GCQAI+Y++CFR  SI ++ R  S L    +E +      P  VCLPS+V 
Sbjct  408  PEEHQDFYSGCQAILYVLCFRMRSILAVPRFLSQL--TPLESVFISQTRP--VCLPSVVS  463

Query  193  EFLRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRP  372
            EFL+ A+   +    E  A I   L ESE+S AFGG      FFP            I  
Sbjct  464  EFLKQAKAGGMIIVSE--AFIFDDLPESELSRAFGG------FFP-----------VISR  504

Query  373  NFIYWSMV-RNTYDEAE  420
            NFIYWS V + TYDE E
Sbjct  505  NFIYWSEVKKKTYDEDE  521



>ref|XP_002310691.1| RNA polymerase 1 specific transcription initiation factor RRN3 
family protein [Populus trichocarpa]
 gb|EEE91141.1| RNA polymerase 1 specific transcription initiation factor RRN3 
family protein [Populus trichocarpa]
Length=355

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  106  KSHLLRMRIEDILRHSLCPLMVCLPSIVEEFLRVAETTCLFSFPENNAPIGSGLLESEVS  285
            +S LL M IE IL+H L PL VCLPSIV EFL+ A+   LF+  +  A I   LLES++S
Sbjct  280  QSQLLLMSIESILKHKLGPLEVCLPSIVNEFLKQAKAAHLFTISK--AFIFEDLLESDLS  337

Query  286  MAFGGNQRLDTFFPFDPC  339
              FGG + LD FFPFDPC
Sbjct  338  RDFGGLEWLDMFFPFDPC  355



>ref|XP_001693305.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03331.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=199

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 11/127 (9%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFL  201
            H+ FYA  QA++Y++C+    +  L      L+R  +  +L H L PL VCLPS+  EF+
Sbjct  84   HQVFYATAQAVLYVLCYHMQPL--LAETVVALVRGPVWQVLNHRLQPLGVCLPSVAAEFV  141

Query  202  RVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIRPNFI  381
              A +  +         +    L S+V  A    + L+ FFPFDP LL++S RF++    
Sbjct  142  HQATSLGI---------VDCRPLLSQVEPATRSQRPLEMFFPFDPYLLRRSSRFLQLKVS  192

Query  382  YWSMVRN  402
            YW M R 
Sbjct  193  YWCMERT  199



>gb|ERE89854.1| RNA polymerase I-specific transcription initiation factor RRN3-like 
protein [Cricetulus griseus]
Length=167

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   I S  L     +L  +  E ++   L PL +CLPS+V  
Sbjct  19   HGPFYSACQAVFYTFVFRHKQILSGNLKEGLRYLQSLNFERVVLSQLNPLKICLPSVVNF  78

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  V     L   ++  E N+     +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  79   FAAVTNKYQLVFCYTIMERNS---RQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  135

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  136  SKKFIDPIYQIW  147



>gb|AAH55781.1| Rrn3 protein, partial [Mus musculus]
Length=214

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   + S  L +   +L  +  E I+   L PL +CLP +V  
Sbjct  9    HGPFYSACQAVFYTVVFRHKQLLSGNLKQGLQYLQSLNFERIVLSQLNPLKICLPQVVNF  68

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N+     +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  69   FAAITNKYQLVFCYTIMERNS---RQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  125

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  126  SKKFIDPIYQIW  137



>gb|EGV93005.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Cricetulus griseus]
Length=224

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   I S  L     +L  +  E ++   L PL +CLPS+V  
Sbjct  19   HGPFYSACQAVFYTFVFRHKQILSGNLKEGLRYLQSLNFERVVLSQLNPLKICLPSVVNF  78

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  V     L   ++  E N+     +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  79   FAAVTNKYQLVFCYTIMERNS---RQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  135

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  136  SKKFIDPIYQIW  147



>gb|EAW54752.1| hCG1786665, isoform CRA_c [Homo sapiens]
Length=276

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  78   HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  137

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  138  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  194

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  195  SKKFIDPIYQVW  206



>ref|XP_007087397.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Panthera tigris altaica]
Length=651

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 72/157 (46%), Gaps = 25/157 (16%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L    ++L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLTYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + R     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVRTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYWSM------------VRNTYDEAEDD  426
            S +FI P +  W              VR    E EDD
Sbjct  570  SKKFIDPIYQIWENMSAEELQEFTKPVRKQVVEDEDD  606



>ref|XP_011288882.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Felis catus]
Length=651

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 72/157 (46%), Gaps = 25/157 (16%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L    ++L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLTYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + R     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVRTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYWSM------------VRNTYDEAEDD  426
            S +FI P +  W              VR    E EDD
Sbjct  570  SKKFIDPIYQIWENMSAEELQEFTKPVRKQVVEDEDD  606



>ref|XP_007087398.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Panthera tigris altaica]
Length=650

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L    ++L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLTYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + R     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVRTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|XP_008558356.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like, partial [Microplitis demolitor]
Length=213

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 69/131 (53%), Gaps = 7/131 (5%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N + RAH  FY+ CQA+ YI+ FR   + S  +    L  +    I+   L PL VCLP 
Sbjct  32   NSDVRAHTVFYSVCQAVFYIVGFRSRELVSTRKNLLFLQGLNFTKIISCRLNPLRVCLPV  91

Query  184  IVEEFLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKS  354
            +V+ F  V  T  L   +S  E+N+     +L++         + LDTFFPFDP +L +S
Sbjct  92   VVQHFAAVTRTYQLAYCYSIMEHNSRSNLPVLQTTNRFV----KWLDTFFPFDPYVLIRS  147

Query  355  DRFIRPNFIYW  387
             + I P ++++
Sbjct  148  SQKIDPIYLHY  158



>ref|XP_002826374.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like, partial [Pongo abelii]
Length=275

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  77   HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  136

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  137  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  193

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  194  SKKFIDPIYQVW  205



>ref|XP_004998396.1| hypothetical protein PTSG_00924 [Salpingoeca rosetta]
 gb|EGD76221.1| hypothetical protein PTSG_00924 [Salpingoeca rosetta]
Length=865

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 46/135 (34%), Positives = 66/135 (49%), Gaps = 8/135 (6%)
 Frame = +1

Query  7    PNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSI  186
            PN   H  FYA CQ++ Y++CFR             L  + +E I+R SL PLMV  P++
Sbjct  438  PNVHRHTPFYALCQSLFYMLCFRVRDFMDEPDGHRWLKSLGLETIVRCSLNPLMVVTPAV  497

Query  187  VEEFLRVAET----TCLFSFPEN-NAPIGSGLLESEVSMAFGGN---QRLDTFFPFDPCL  342
            V+EF R         C      N NA +G+G     V+    G+     L+ FFPFDP  
Sbjct  498  VDEFARAMRAYEVMLCDVEVLRNRNASVGAGTSAHIVAAVENGDLCLNDLEFFFPFDPIA  557

Query  343  LKKSDRFIRPNFIYW  387
            L +S +F++  +  W
Sbjct  558  LPRSLQFVQQLYKVW  572



>ref|XP_004335689.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Acanthamoeba castellanii str. Neff]
 gb|ELR13676.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Acanthamoeba castellanii str. Neff]
Length=569

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 69/137 (50%), Gaps = 17/137 (12%)
 Frame = +1

Query  7    PNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRI---KSHLLRMRIEDILRHSLCPLMVCL  177
            P+   H  FY+ CQA+ Y++CF+   +    R     + L  + ++ I++  L PL +C 
Sbjct  317  PDAEVHGLFYSVCQAVFYVVCFKYQQL--ALRTPEGAAFLDSLELDAIIQSRLNPLRLCA  374

Query  178  PSIVEEFLRVAETTCLFSFPENNAPIGSGLLE--SEVSMA----FGGNQRLDTFFPFDPC  339
             ++V EFL+VA   C         P    +LE    V +A    FG   +LD+FFPFDP 
Sbjct  375  STVVTEFLKVAADLCGL------LPSARAVLERNKRVVLATKSVFGNANQLDSFFPFDPY  428

Query  340  LLKKSDRFIRPNFIYWS  390
            LL+ S + I   +  WS
Sbjct  429  LLRHSSKHISAIYQTWS  445



>ref|XP_005077486.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Mesocricetus auratus]
Length=669

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   I S  L     +L  +  E ++   L PL +CLPS+V  
Sbjct  464  HGPFYSACQAVFYTVVFRHKQILSGNLKEGLRYLQSLNFERVVLSQLNPLKICLPSVVNF  523

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  V     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  524  FAAVTNKYQLVFCYTIMERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  580

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  581  SKKFIDPLYQVW  592



>ref|XP_006212139.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Vicugna pacos]
Length=650

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L    S+L  +  E I+   L PL +CLPS+V  
Sbjct  452  HGPFYSACQAVFYTFVFRHKQVLSGNLKEGLSYLQSLNFERIVMSQLNPLKICLPSVVNF  511

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  512  FAAITSKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  568

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  569  SKKFIDPVYQVW  580



>ref|XP_010381980.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Rhinopithecus roxellana]
Length=284

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL VCLPS+V  
Sbjct  86   HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKVCLPSVVNF  145

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  146  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  202

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  203  SKQFIDPIYQIW  214



>ref|XP_006179131.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Camelus ferus]
 ref|XP_010959409.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Camelus bactrianus]
Length=650

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 66/133 (50%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L    S+L  +  E I+   L PL +CLPS+V  
Sbjct  452  HGPFYSACQAVFYTFVFRHKQVLSGNLKEGLSYLQSLNFERIVMSQLNPLKICLPSVVNF  511

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  512  FAAITSKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  568

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  569  SKKFIDPVYQVWE  581



>ref|XP_010959410.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Camelus bactrianus]
 ref|XP_010981171.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Camelus dromedarius]
Length=551

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 66/133 (50%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L    S+L  +  E I+   L PL +CLPS+V  
Sbjct  353  HGPFYSACQAVFYTFVFRHKQVLSGNLKEGLSYLQSLNFERIVMSQLNPLKICLPSVVNF  412

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  413  FAAITSKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  469

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  470  SKKFIDPVYQVWE  482



>ref|XP_010981170.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Camelus dromedarius]
Length=617

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 66/133 (50%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L    S+L  +  E I+   L PL +CLPS+V  
Sbjct  419  HGPFYSACQAVFYTFVFRHKQVLSGNLKEGLSYLQSLNFERIVMSQLNPLKICLPSVVNF  478

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  479  FAAITSKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  535

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  536  SKKFIDPVYQVWE  548



>ref|XP_004057477.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like, partial [Gorilla gorilla gorilla]
Length=301

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 64/133 (48%), Gaps = 15/133 (11%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  156  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  215

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR------LDTFFPFDPCLLK  348
            F  +     L   ++  E N      ++ S      GG+        LDTFFPFDPC+LK
Sbjct  216  FAAITNKYQLVFCYTIIERNNRQMLPVIRSTT----GGDSVQTCTNPLDTFFPFDPCVLK  271

Query  349  KSDRFIRPNFIYW  387
            +S +FI P +  W
Sbjct  272  RSKKFIDPIYQVW  284



>gb|EAW54750.1| hCG1786665, isoform CRA_a [Homo sapiens]
Length=366

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  168  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  227

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  228  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  284

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  285  SKKFIDPIYQVW  296



>gb|AAH34110.1| Rrn3 protein, partial [Mus musculus]
Length=513

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   + S  L +   +L  +  E I+   L PL +CLP +V  
Sbjct  308  HGPFYSACQAVFYTVVFRHKQLLSGNLKQGLQYLQSLNFERIVLSQLNPLKICLPQVVNF  367

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N+     +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  368  FAAITNKYQLVFCYTIMERNS---RQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  424

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  425  SKKFIDPIYQIW  436



>ref|XP_007984556.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Chlorocebus sabaeus]
Length=651

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL VCLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKVCLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|NP_001034610.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Mus musculus]
 sp|B2RS91.1|RRN3_MOUSE RecName: Full=RNA polymerase I-specific transcription initiation 
factor RRN3 [Mus musculus]
 gb|AAI38777.1| RRN3 RNA polymerase I transcription factor homolog (yeast) [Mus 
musculus]
 gb|AAI38775.1| RRN3 RNA polymerase I transcription factor homolog (yeast) [Mus 
musculus]
Length=656

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   + S  L +   +L  +  E I+   L PL +CLP +V  
Sbjct  451  HGPFYSACQAVFYTVVFRHKQLLSGNLKQGLQYLQSLNFERIVLSQLNPLKICLPQVVNF  510

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N+     +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  511  FAAITNKYQLVFCYTIMERNS---RQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  567

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  568  SKKFIDPIYQIW  579



>ref|XP_636150.1| hypothetical protein DDB_G0289587 [Dictyostelium discoideum AX4]
 gb|EAL62647.1| hypothetical protein DDB_G0289587 [Dictyostelium discoideum AX4]
Length=706

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 66/155 (43%), Gaps = 17/155 (11%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKS-----------HLLRMRIEDILR  147
            I P+P  H  FY+ CQ+I YI CFR   I      K+             L      I  
Sbjct  474  IYPDPHNHSLFYSVCQSIYYIFCFRNSVILDFTDFKNDKKDEKQREFWQDLHAAFRKISM  533

Query  148  HSLCPLMVCLPSIVEEF----LRVAE-TTCLFSFPEN-NAPIGSGLLESEVSMAFGGNQR  309
              L P  VCL S+V +F    LRV   T C      N N  +    +    +     N +
Sbjct  534  SRLNPFKVCLKSVVRQFCCVCLRVGIFTKCTGILKTNKNVLLSKSTITGSSAAPTVSNNQ  593

Query  310  LDTFFPFDPCLLKKSDRFIRPNFIYWSMVRNTYDE  414
             D+FFPFDP LL  S +F   ++I+W  +R   DE
Sbjct  594  FDSFFPFDPYLLFHSSKFFANSYIHWKDIRKDGDE  628



>ref|XP_007633999.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X3 [Cricetulus griseus]
Length=655

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   I S  L     +L  +  E ++   L PL +CLPS+V  
Sbjct  450  HGPFYSACQAVFYTFVFRHKQILSGNLKEGLRYLQSLNFERVVLSQLNPLKICLPSVVNF  509

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  V     L   ++  E N+     +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  510  FAAVTNKYQLVFCYTIMERNS---RQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  566

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  567  SKKFIDPIYQIW  578



>ref|XP_003502804.2| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Cricetulus griseus]
Length=655

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   I S  L     +L  +  E ++   L PL +CLPS+V  
Sbjct  450  HGPFYSACQAVFYTFVFRHKQILSGNLKEGLRYLQSLNFERVVLSQLNPLKICLPSVVNF  509

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  V     L   ++  E N+     +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  510  FAAVTNKYQLVFCYTIMERNS---RQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  566

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  567  SKKFIDPIYQIW  578



>gb|EDL96183.1| rCG49762 [Rattus norvegicus]
Length=291

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   + S  L     +L  +  E I+   L PL +CLP +V  
Sbjct  86   HGPFYSACQAVFYTVVFRHKQLLSGNLKEGLRYLQSLNFERIVLSQLNPLKICLPRVVNF  145

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  146  FAAITNKYQLVFCYTIMERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCMLKR  202

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  203  SKKFIDPVYQAW  214



>ref|XP_003362032.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3, partial [Sus scrofa]
Length=430

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 64/133 (48%), Gaps = 14/133 (11%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  231  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  290

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR------LDTFFPFDPCLLK  348
            F  +     L   ++  E N      +L   +    GG+        LDTFFPFDPC+LK
Sbjct  291  FAAITSKYQLVFCYTLIERN---NLKMLPVXIRNTAGGDSVQTCTNPLDTFFPFDPCVLK  347

Query  349  KSDRFIRPNFIYW  387
            +S +FI P +  W
Sbjct  348  RSKKFIDPVYQVW  360



>ref|XP_003269358.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Nomascus leucogenys]
Length=519

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 13/135 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  321  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  380

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  381  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  437

Query  352  SDRFIRPNFIYWSMV  396
            S +FI P +  W  V
Sbjct  438  SKKFIDPIYQVWEDV  452



>dbj|BAG64459.1| unnamed protein product [Homo sapiens]
Length=469

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  271  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  330

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  331  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  387

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  388  SKKFIDPIYQVW  399



>ref|XP_004604384.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Sorex araneus]
Length=648

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 68/136 (50%), Gaps = 13/136 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  452  HGPFYSACQAVFYTVVFRHKQLLSGNLREGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  511

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  512  FAAITNKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  568

Query  352  SDRFIRPNFIYWSMVR  399
            S +FI P +  W  +R
Sbjct  569  SKKFIDPLYQEWEGMR  584



>gb|AAH71868.1| RRN3 protein, partial [Homo sapiens]
Length=430

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  232  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  291

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  292  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  348

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  349  SKKFIDPIYQVW  360



>ref|XP_005255433.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Homo sapiens]
 ref|XP_005255434.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X3 [Homo sapiens]
 ref|XP_006725261.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Homo sapiens]
 ref|XP_006725262.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X3 [Homo sapiens]
Length=439

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  241  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  300

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  301  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  357

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  358  SKKFIDPIYQVW  369



>dbj|BAG58409.1| unnamed protein product [Homo sapiens]
Length=502

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  304  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  363

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  364  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  420

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  421  SKKFIDPIYQVW  432



>dbj|BAH14891.1| unnamed protein product [Homo sapiens]
Length=621

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  423  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  482

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  483  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  539

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  540  SKKFIDPIYQVW  551



>ref|XP_003916620.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Papio anubis]
Length=651

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL VCLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKVCLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|XP_001143837.3| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Pan troglodytes]
Length=651

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQVW  581



>ref|NP_060897.3| RNA polymerase I-specific transcription initiation factor RRN3 
isoform 1 [Homo sapiens]
 sp|Q9NYV6.1|RRN3_HUMAN RecName: Full=RNA polymerase I-specific transcription initiation 
factor RRN3; AltName: Full=Transcription initiation factor 
IA; Short=TIF-IA [Homo sapiens]
 gb|AAF66160.1|AF227156_1 RRN3 [Homo sapiens]
 gb|EAW54754.1| hCG1786665, isoform CRA_e [Homo sapiens]
 gb|AAI32689.1| RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) 
[Homo sapiens]
 gb|AAI32691.1| RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) 
[Homo sapiens]
 dbj|BAG37307.1| unnamed protein product [Homo sapiens]
 dbj|BAI45997.1| RRN3 RNA polymerase I transcription factor homolog [synthetic 
construct]
 gb|ADR83091.1| RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) 
[synthetic construct]
 gb|AIC51635.1| RRN3, partial [synthetic construct]
Length=651

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQVW  581



>ref|NP_001287993.1| RNA polymerase I-specific transcription initiation factor RRN3 
isoform 2 [Homo sapiens]
Length=621

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  423  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  482

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  483  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  539

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  540  SKKFIDPIYQVW  551



>ref|NP_001244593.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Macaca mulatta]
 ref|XP_005591367.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Macaca fascicularis]
 gb|EHH31449.1| Transcription initiation factor IA [Macaca mulatta]
Length=651

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL VCLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKVCLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>dbj|BAG62018.1| unnamed protein product [Homo sapiens]
Length=621

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  423  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  482

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  483  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  539

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  540  SKKFIDPIYQVW  551



>ref|XP_002755948.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Callithrix jacchus]
Length=651

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|XP_003291243.1| hypothetical protein DICPUDRAFT_81920 [Dictyostelium purpureum]
 gb|EGC32245.1| hypothetical protein DICPUDRAFT_81920 [Dictyostelium purpureum]
Length=691

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 47/155 (30%), Positives = 66/155 (43%), Gaps = 17/155 (11%)
 Frame = +1

Query  1    INPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKS-----------HLLRMRIEDILR  147
            + P+P  H  FY+ CQ+I YI CFR   I  +   K              L    + I  
Sbjct  456  VGPDPYNHSLFYSVCQSIYYIFCFRNTIILEISNDKEDKKNEKQREFWQDLHAAFKKIST  515

Query  148  HSLCPLMVCLPSIVEEFLRVAETTCLFSF------PENNAPIGSGLLESEVSMAFGGNQR  309
              L P  VCL S+V +F  V     +F           N  +    + S  S     N +
Sbjct  516  SRLNPFKVCLKSVVRQFCCVCLRVGIFQKCTGILKTNKNILLSKTTVSSASSAPTVSNNQ  575

Query  310  LDTFFPFDPCLLKKSDRFIRPNFIYWSMVRNTYDE  414
             D+FFPFDP LL  S +F + ++I+W  +R   DE
Sbjct  576  FDSFFPFDPYLLYHSSKFFQNSYIHWKDIRKDGDE  610



>dbj|BAG64131.1| unnamed protein product [Homo sapiens]
Length=552

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  354  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  413

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  414  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  470

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  471  SKKFIDPIYQVW  482



>dbj|BAG65594.1| unnamed protein product [Homo sapiens]
Length=618

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  420  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  479

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  480  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  536

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  537  SKKFIDPIYQVW  548



>ref|XP_004057298.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase I-specific transcription 
initiation factor RRN3 [Gorilla gorilla gorilla]
Length=579

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  381  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  440

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  441  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  497

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  498  SKKFIDPIYQVW  509



>ref|XP_005350399.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Microtus ochrogaster]
Length=656

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 67/135 (50%), Gaps = 13/135 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  + +E ++   L PL +CLPS+V  
Sbjct  451  HGPFYSACQAVFYTFVFRYKQLLSGNLKEGLRYLQSLNLERVVLSQLNPLKICLPSVVNF  510

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  511  FAAITNKYQLVFCYTIMERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCMLKR  567

Query  352  SDRFIRPNFIYWSMV  396
            S +FI P +  W  V
Sbjct  568  SKKFIDPIYQIWEDV  582



>ref|XP_006872017.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Chrysochloris asiatica]
Length=657

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL VCLPS+V  
Sbjct  452  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQGLNFERIVMSQLNPLKVCLPSVVNF  511

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  512  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  568

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  569  SKKFIDPTYQIW  580



>emb|CAC07955.1| transcription initiation factor IA protein [Homo sapiens]
Length=651

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYXFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQVW  581



>ref|XP_001488975.2| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Equus caballus]
 ref|XP_008518725.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Equus przewalskii]
Length=651

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 65/135 (48%), Gaps = 13/135 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G +       LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVVRSTAGGDSVHTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYWSMV  396
            S +FI P +  W  V
Sbjct  570  SKKFIDPIYQIWEDV  584



>ref|XP_010337746.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase I-specific transcription 
initiation factor RRN3 [Saimiri boliviensis boliviensis]
Length=664

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  410  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  469

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  470  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  526

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  527  SKKFIDPIYQIW  538



>ref|XP_006049819.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Bubalus bubalis]
Length=651

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L    ++L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLTYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQVW  581



>ref|XP_006983942.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Peromyscus maniculatus bairdii]
Length=658

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E ++   L PL +CLPS+V  
Sbjct  451  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERVVLSQLNPLKICLPSVVNF  510

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  V     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  511  FAAVTNKYQLVFCYTIMERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  567

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  568  SKKFIDPIYQIW  579



>ref|XP_003421933.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Loxodonta africana]
Length=658

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FASITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S++FI P +  W
Sbjct  570  SNKFIDPIYQIW  581



>ref|XP_008828116.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X3 [Nannospalax galili]
Length=557

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 64/132 (48%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  352  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  411

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G   +     LDTFFPFDPC+LK+
Sbjct  412  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDTVQTCTNPLDTFFPFDPCVLKR  468

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  469  SKKFIDPIYQIW  480



>ref|XP_008828114.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Nannospalax galili]
Length=656

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 64/132 (48%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  451  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  510

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G   +     LDTFFPFDPC+LK+
Sbjct  511  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDTVQTCTNPLDTFFPFDPCVLKR  567

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  568  SKKFIDPIYQIW  579



>ref|XP_007529594.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Erinaceus europaeus]
Length=652

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FYA CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  454  HGPFYAACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  513

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  514  FAAITNKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  570

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  571  SKKFIDPLYQIW  582



>ref|XP_006105278.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Myotis lucifugus]
Length=621

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 13/135 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  423  HGPFYSACQAVFYTCVFRHKQLLSGNLKEGLMYLQSLNFERIVMSQLNPLKICLPSVVNF  482

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  483  FAAITSKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  539

Query  352  SDRFIRPNFIYWSMV  396
            S +FI P +  W  V
Sbjct  540  SKKFIDPIYQIWEDV  554



>ref|XP_008139788.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Eptesicus fuscus]
Length=651

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPIIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|NP_001129318.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Rattus norvegicus]
 gb|AAI66485.1| Rrn3 protein [Rattus norvegicus]
Length=661

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   + S  L     +L  +  E I+   L PL +CLP +V  
Sbjct  456  HGPFYSACQAVFYTVVFRHKQLLSGNLKEGLRYLQSLNFERIVLSQLNPLKICLPRVVNF  515

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  516  FAAITNKYQLVFCYTIMERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCMLKR  572

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  573  SKKFIDPVYQAW  584



>ref|XP_005323746.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Ictidomys tridecemlineatus]
Length=655

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  450  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  509

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  510  FAAITNKYQLVFCYTIIERN---NRQMLPIIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  566

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  567  SKKFIDPIYQIW  578



>ref|XP_008765680.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Rattus norvegicus]
 ref|XP_008765681.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Rattus norvegicus]
Length=656

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   + S  L     +L  +  E I+   L PL +CLP +V  
Sbjct  451  HGPFYSACQAVFYTVVFRHKQLLSGNLKEGLRYLQSLNFERIVLSQLNPLKICLPRVVNF  510

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  511  FAAITNKYQLVFCYTIMERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCMLKR  567

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  568  SKKFIDPVYQAW  579



>ref|XP_008828115.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Nannospalax galili]
Length=637

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 64/132 (48%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  432  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  491

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G   +     LDTFFPFDPC+LK+
Sbjct  492  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDTVQTCTNPLDTFFPFDPCVLKR  548

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  549  SKKFIDPIYQIW  560



>ref|XP_006105277.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Myotis lucifugus]
Length=651

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 13/135 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTCVFRHKQLLSGNLKEGLMYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYWSMV  396
            S +FI P +  W  V
Sbjct  570  SKKFIDPIYQIWEDV  584



>ref|XP_007954667.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Orycteropus afer afer]
Length=658

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPVYQIW  581



>ref|XP_004587152.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Ochotona princeps]
Length=658

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ YI  FR   + S  L     +L  +  E I+   L PL VCLPS+V  
Sbjct  453  HGPFYSACQAVFYIFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKVCLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G +       LDTFFPFDPC+LK+
Sbjct  513  FAALTNKYQLAFCYTIIERN---NRQMLPVIRNTAGGDSVHTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|XP_319773.4| AGAP009024-PA [Anopheles gambiae str. PEST]
 gb|EAA14800.4| AGAP009024-PA [Anopheles gambiae str. PEST]
Length=602

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 43/136 (32%), Positives = 69/136 (51%), Gaps = 15/136 (11%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N + +AH  FY+ CQAI Y++ FR   + S  +  + L  +++  I+   L PL VCLP+
Sbjct  409  NQSLKAHLVFYSVCQAIFYVVAFRANHLTSSAKNLTFLQSLQLSSIVTCQLNPLRVCLPT  468

Query  184  IVEEF---LRVAETTCLFSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPC  339
            +   F    R  +     +  E NA         +++  +  N +     LDTFFPFDP 
Sbjct  469  VATAFAGITRAYQLAYCHTILERNA-------RRKLATVYKNNTQLPEDCLDTFFPFDPY  521

Query  340  LLKKSDRFIRPNFIYW  387
            +LKKS + I P ++ +
Sbjct  522  MLKKSGKRIEPFYLQY  537



>ref|XP_006759742.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Myotis davidii]
Length=651

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTCVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>gb|ELW67674.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Tupaia chinensis]
Length=388

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  182  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  241

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  242  FAAITNKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  298

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  299  SKKFIDPVYQIWE  311



>ref|XP_005872049.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Myotis brandtii]
 gb|EPQ11311.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Myotis brandtii]
Length=651

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTCVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>gb|ELK33281.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Myotis davidii]
Length=699

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  451  HGPFYSACQAVFYTCVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  510

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  511  FAAITSKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  567

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  568  SKKFIDPIYQIW  579



>ref|NP_001126928.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Pongo abelii]
 sp|Q5R4N9.1|RRN3_PONAB RecName: Full=RNA polymerase I-specific transcription initiation 
factor RRN3 [Pongo abelii]
 emb|CAH93277.1| hypothetical protein [Pongo abelii]
Length=650

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  452  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFEWIVMSQLNPLKICLPSVVNF  511

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  512  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  568

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  569  SKKFIDPIYQVW  580



>ref|XP_001655975.1| AAEL012265-PA [Aedes aegypti]
 gb|EAT35579.1| AAEL012265-PA [Aedes aegypti]
Length=606

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 5/132 (4%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N + +AH  FY+ CQAI Y++ FR   + S  +  + L  +++  I+   L PL VCLP+
Sbjct  412  NQSLKAHMVFYSVCQAIFYVVAFRSKHLTSNAKNLTFLQSLQLSSIVTCHLNPLRVCLPA  471

Query  184  IVEEFLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKS  354
            +   F  V     L    +  E NA      +    S      + LDTFFPFDP +LKKS
Sbjct  472  VATAFAGVTRAHQLAYCHTILERNARRKLATVYKNESQT--PEECLDTFFPFDPYMLKKS  529

Query  355  DRFIRPNFIYWS  390
             + I P F+ + 
Sbjct  530  GKRIEPIFLQYQ  541



>ref|XP_004471918.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform 1 [Dasypus novemcinctus]
Length=658

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCILKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPVYQIW  581



>ref|XP_004373328.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform 2 [Trichechus manatus latirostris]
Length=628

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  423  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  482

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  483  FASITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  539

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  540  SKKFIDPIYQIW  551



>dbj|BAG60661.1| unnamed protein product [Homo sapiens]
Length=486

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 64/133 (48%), Gaps = 15/133 (11%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  335  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFEWIVMSQLNPLKICLPSVVNF  394

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR------LDTFFPFDPCLLK  348
            F  +     L   ++  E N      ++ S      GG+        LDTFFPFDPC+LK
Sbjct  395  FAAITNKYQLVFCYTIIERNNRQMLPVIRSTT----GGDSVQTCTNPLDTFFPFDPCVLK  450

Query  349  KSDRFIRPNFIYW  387
            +S +FI P +  W
Sbjct  451  RSKKFIDPIYQVW  463



>ref|XP_004705814.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Echinops telfairi]
Length=657

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 67/133 (50%), Gaps = 15/133 (11%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMR---IEDILRHSLCPLMVCLPSIVE  192
            H  FY+ CQA+ Y   FR   + S   +K  LL ++    E I+   L PL +CLPS+V 
Sbjct  452  HGPFYSACQAVFYTFVFRHKQLLS-GNLKEGLLYLQSLNFERIVMSQLNPLKICLPSVVN  510

Query  193  EFLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLK  348
             F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK
Sbjct  511  LFAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLK  567

Query  349  KSDRFIRPNFIYW  387
            +S +FI P +  W
Sbjct  568  RSKKFIDPIYQLW  580



>ref|XP_006728703.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Leptonychotes weddellii]
Length=621

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  423  HGPFYSACQAVFYTFVFRHEQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  482

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  483  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  539

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  540  SKKFINPVYQIWE  552



>ref|XP_004373327.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform 1 [Trichechus manatus latirostris]
Length=658

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FASITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|XP_005697577.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Capra hircus]
Length=651

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FATITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQIW  581



>ref|XP_004408979.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Odobenus rosmarus divergens]
Length=651

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FATITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPVYQIW  581



>ref|XP_003478235.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cavia porcellus]
Length=658

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSI--HSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   +   +L    S+L  +  + I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLGSNLKEGLSYLQSLNFQRIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQTW  581



>ref|XP_010838185.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Bison bison bison]
Length=651

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQIW  581



>ref|XP_006728702.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Leptonychotes weddellii]
Length=651

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHEQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  570  SKKFINPVYQIWE  582



>ref|XP_004691805.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Condylura cristata]
Length=651

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPVYQIW  581



>ref|XP_002711789.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Oryctolagus cuniculus]
Length=658

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPVYQIW  581



>ref|XP_007498672.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Monodelphis domestica]
Length=662

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSI--HSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   +   +L    ++L  +  E I+   L PL +CLPS+V  
Sbjct  464  HGPFYSACQAVFYTFIFRHKQLLDGNLREGLAYLQSLNFERIVMSQLNPLKICLPSVVNL  523

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A GG+ +     LDTFFPFDPC+LK+
Sbjct  524  FAAITRKYQLVFCYTIIERN---NRQMLPVLRNTAGGGSVQTCTNPLDTFFPFDPCVLKR  580

Query  352  SDRFIRPNFIYW  387
            S + + P +  W
Sbjct  581  SKKIVDPIYQSW  592



>ref|XP_008256026.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Oryctolagus cuniculus]
Length=627

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  422  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  481

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  482  FAAITNKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  538

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  539  SKKFIDPVYQIW  550



>ref|XP_006637244.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Lepisosteus oculatus]
Length=614

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 62/129 (48%), Gaps = 7/129 (5%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSI--HSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y + FR   I   SL +  ++L +M +E I+   L PL VCLP+I   
Sbjct  418  HGPFYSACQAVFYTLIFRHQQILEGSLRQGMAYLQQMNLERIVMCQLNPLKVCLPAITNM  477

Query  196  FLRVAETT----CLFSFPENNAPIGSGLLESEVSMAFGGNQR-LDTFFPFDPCLLKKSDR  360
            F  +        C      NN      +   +   +   N   LD+FFPFDP LLK+S +
Sbjct  478  FAAITRKYQLVFCYTIIERNNRLTLPAVRSGQGGESLPVNTNPLDSFFPFDPYLLKRSGK  537

Query  361  FIRPNFIYW  387
             I P +  W
Sbjct  538  LIEPIYQVW  546



>ref|XP_005957879.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Pantholops hodgsonii]
Length=651

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQIW  581



>ref|XP_005906403.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Bos mutus]
 gb|ELR48636.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Bos mutus]
Length=651

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQIW  581



>ref|XP_004020834.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Ovis aries]
Length=651

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQIW  581



>ref|XP_536965.3| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase I-specific transcription 
initiation factor RRN3 [Canis lupus familiaris]
Length=696

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  498  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  557

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  558  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  614

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  615  SKKFIDPVYQIW  626



>ref|NP_001179361.2| RNA polymerase I-specific transcription initiation factor RRN3 
[Bos taurus]
 tpg|DAA15487.1| TPA: RRN3 RNA polymerase I transcription factor homolog [Bos 
taurus]
Length=651

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQIW  581



>ref|XP_006146663.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase I-specific transcription 
initiation factor RRN3 [Tupaia chinensis]
Length=630

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  424  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  483

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  484  FAAITNKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  540

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  541  SKKFIDPVYQIWE  553



>ref|XP_006910961.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Pteropus alecto]
 ref|XP_011356694.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Pteropus vampyrus]
 gb|ELK13544.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Pteropus alecto]
Length=651

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|XP_004441907.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Ceratotherium simum simum]
Length=651

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPIYQIW  581



>ref|XP_008063048.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Tarsius syrichta]
Length=625

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  420  HGPFYSTCQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  479

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    S A G + +     LDTFFPFDPC+LK+
Sbjct  480  FAAITNKYQLVFCYTIIERN---NRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKR  536

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  537  SRKFIDPIYQIW  548



>ref|XP_004797518.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Mustela putorius furo]
Length=651

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  570  SKKFIDPLYQIWE  582



>ref|XP_004312288.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Tursiops truncatus]
Length=651

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQVW  581



>ref|XP_004270208.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Orcinus orca]
Length=651

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQVW  581



>ref|XP_004652337.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Jaculus jaculus]
Length=655

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 64/132 (48%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  450  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIIMSQLNPLKICLPSVVNF  509

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  510  FAAITNKYQLVFCYTIIEKN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  566

Query  352  SDRFIRPNFIYW  387
            S  FI P +  W
Sbjct  567  SKEFINPIYQIW  578



>ref|XP_007467020.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Lipotes vexillifer]
Length=651

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQVW  581



>ref|XP_007106213.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Physeter catodon]
Length=634

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  436  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  495

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  496  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  552

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  553  SKKFIDPLYQVW  564



>ref|XP_007188417.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Balaenoptera acutorostrata scammoni]
Length=650

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  452  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  511

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  512  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  568

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  569  SKKFIDPLYQVW  580



>ref|XP_004797519.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Mustela putorius furo]
Length=634

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  436  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  495

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  496  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  552

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  553  SKKFIDPLYQIWE  565



>ref|XP_007188419.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X3 [Balaenoptera acutorostrata scammoni]
Length=614

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  452  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  511

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  512  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  568

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  569  SKKFIDPLYQVW  580



>ref|XP_004751023.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Mustela putorius furo]
Length=642

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 13/133 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  444  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  503

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  504  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  560

Query  352  SDRFIRPNFIYWS  390
            S +FI P +  W 
Sbjct  561  SKKFIDPLYQIWE  573



>ref|XP_007188418.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Balaenoptera acutorostrata scammoni]
Length=633

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  435  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  494

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  495  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  551

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  552  SKKFIDPLYQVW  563



>ref|XP_007106212.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Physeter catodon]
Length=651

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  453  HGPFYSACQAVFYTFVFRHRQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  512

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  513  FAAITNKYQLVFCYTLIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  569

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  570  SKKFIDPLYQVW  581



>ref|XP_009439122.1| PREDICTED: LOW QUALITY PROTEIN: putative RRN3-like protein RRN3P2 
[Pan troglodytes]
Length=476

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  317  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLNFERIVMSQLNPLKICLPSVVNF  376

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR------LDTFFPFDPCLLK  348
               +     L   ++  E N      ++ S      GG+        LDTFFPFDPC+LK
Sbjct  377  LAAITNKYQLVFCYTIIERNNHQMLPVIRSTT----GGDSVQTCTNPLDTFFPFDPCVLK  432

Query  349  KSDRFIRPNFIYW  387
            +S +FI P +  W
Sbjct  433  RSKKFIDPIYQVW  445



>ref|XP_008695144.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Ursus maritimus]
Length=629

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLP++V  
Sbjct  431  HGPFYSACQAVFYTFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPAVVNF  490

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  491  FAAITSKYQLVFCYTIIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  547

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  548  SKKFIDPVYQIW  559



>ref|XP_003790776.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform 2 [Otolemur garnettii]
Length=620

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  422  HGPFYSACQAVFYAFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  481

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  482  FAAITNKYQLVFCYTIIERN---HRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  538

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  539  SKKFIDPIYQVW  550



>ref|XP_003790775.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform 1 [Otolemur garnettii]
Length=650

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHS--LFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   + S  L     +L  +  E I+   L PL +CLPS+V  
Sbjct  452  HGPFYSACQAVFYAFVFRHKQLLSGNLKEGLRYLQSLNFERIVMSQLNPLKICLPSVVNF  511

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  512  FAAITNKYQLVFCYTIIERN---HRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  568

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  569  SKKFIDPIYQVW  580



>ref|XP_002740429.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Saccoglossus kowalevskii]
Length=625

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 4/131 (3%)
 Frame = +1

Query  7    PNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSI  186
            P+   H  FY+ CQA  YI  FR   +    +  +++  +  + I+   L PL VCLP++
Sbjct  478  PDVNLHGPFYSVCQAAFYIFVFRHKQLLETNKGLNYVRSLNFDRIVTCRLNPLKVCLPTV  537

Query  187  VEEFLRVAE----TTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKS  354
            V  F  +        C      NN  +   + +S  +        LD++FPFDP LL +S
Sbjct  538  VNMFATITRMHQIVYCYTVIERNNRTLLPVVTQSHNTNVLTNVNPLDSYFPFDPYLLSRS  597

Query  355  DRFIRPNFIYW  387
             ++I+P +  W
Sbjct  598  KKYIKPIYQEW  608



>ref|XP_001870906.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Culex quinquefasciatus]
 gb|EDS34774.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Culex quinquefasciatus]
Length=603

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 5/132 (4%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N + +AH  FY+ CQAI Y++ FR   + +  +  + L  +++  I    L PL VC+P 
Sbjct  412  NQSLKAHLVFYSVCQAIFYVVAFRSKQLTATPKNLAFLQTLQLTSIANCLLNPLRVCVPG  471

Query  184  IVEEFLRVAETTCLF---SFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKS  354
            +   F+ VA    +    +  E N    + +L +  ++A   +  LDTFFPFDP LLKKS
Sbjct  472  VATAFVAVARAHQIAYCNTIMERNERRRTFILFNNGALA--PDDCLDTFFPFDPYLLKKS  529

Query  355  DRFIRPNFIYWS  390
             + I P F+ + 
Sbjct  530  GKRIEPIFLQYQ  541



>gb|KFB38508.1| hypothetical protein ZHAS_00005915 [Anopheles sinensis]
Length=598

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (50%), Gaps = 18/151 (12%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPS  183
            N + +AH  FY+ CQAI Y++ FR   + S  +  + L  +++  I+   L PL VCLP+
Sbjct  402  NQSLKAHLVFYSVCQAIFYVVAFRSKHLTSDAKNLTFLQSLQLSSIVTCQLNPLRVCLPT  461

Query  184  IVEEFLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPC  339
            +   F  +     L    +  E NA         +++  +  N +     L+TFFPFDP 
Sbjct  462  VATAFAGITRAYQLAYCHTILERNA-------RRKLATVYKNNTQLPEDCLETFFPFDPY  514

Query  340  LLKKSDRFIRPNFIYWSMVRNTYDE--AEDD  426
            +LKKS + I P ++ +       DE  AE+D
Sbjct  515  MLKKSGKRIEPLYLQYQ-AHEVEDEGGAEED  544



>ref|XP_003071560.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EER29415.1| RNA polymerase I specific transcription initiation factor RRN3 
family protein [Coccidioides posadasii C735 delta SOWgp]
Length=697

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 75/162 (46%), Gaps = 31/162 (19%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFR---------RGSIHSLFRIKSHLLRM--RIEDILR-  147
             P+ R +  FYA  QAI+YI CFR          G I     +    +R    I D+L  
Sbjct  503  GPDLRRYATFYATAQAILYIFCFRWRDLTTAAQEGDIDIHVELDLDQVRFPPNISDVLHT  562

Query  148  --HS-LCPLMVCLPSIVEEFLRVAETTC-LFSFP--ENNAPIGSGLLESEVSMA--FGGN  303
              HS L PL +C PSIV EF R+A     ++ FP  E N  I      S +SM   FG  
Sbjct  563  AIHSKLNPLKICSPSIVREFARIAHHVGFMYVFPLLETNKRIRIFTFRSSMSMDSRFGQI  622

Query  304  QR-----------LDTFFPFDPCLLKKSDRFIRPNFIYWSMV  396
            +R           LD +FPFDP  L +S R++  +++ W  V
Sbjct  623  ERETRADNDLGPQLDAYFPFDPYNLPRSRRWLEGDYVEWRGV  664



>ref|XP_003740893.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Metaseiulus occidentalis]
Length=588

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 64/139 (46%), Gaps = 14/139 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSIHSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEEFL  201
            H  FY+ CQ++ Y I FR   I        +L R+ +E I+   L PL V  P++   F 
Sbjct  416  HGTFYSVCQSVFYCIAFRHKEIIEGDDGLGYLQRLNLEQIVTSPLNPLKVISPAVGIHFA  475

Query  202  RVAE----TTCLFSFPENNAPIGSGLLESEVSMAFGGNQRLDTFFPFDPCLLKKSDRFIR  369
             V        C   F  N          S + MA  GNQ+LD +FPFDP +L +S RF+ 
Sbjct  476  NVTRHYQVVYCYAIFERNQ--------RSALPMANPGNQKLDVYFPFDPYVLLRSKRFVE  527

Query  370  PNFIYWSMVRNTYDEAEDD  426
            P  IY   V +     ++D
Sbjct  528  P--IYREYVDHLKSSVDED  544



>ref|XP_001518561.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3, partial [Ornithorhynchus anatinus]
Length=660

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 15/133 (11%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSI--HSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQAI Y + FR   +   SL +  ++L  +  E ++   L PL +CLP++V  
Sbjct  462  HGPFYSACQAIFYTLVFRHKQLLDGSLRKGLAYLQSLNFERLVMCQLNPLKICLPTVVNL  521

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR------LDTFFPFDPCLLK  348
            F  +     L   ++  E N      ++ S V    GG+        LD+FFPFDPC+LK
Sbjct  522  FAAITRKYQLVFCYTIIERNNRQMLPVIRSSV----GGDSVQTCTNPLDSFFPFDPCVLK  577

Query  349  KSDRFIRPNFIYW  387
            +S + I P +  W
Sbjct  578  RSKKIIDPFYQIW  590



>gb|EFW15337.1| RNA polymerase I specific transcription initiation factor RRN3 
[Coccidioides posadasii str. Silveira]
Length=706

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 75/162 (46%), Gaps = 31/162 (19%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFR---------RGSIHSLFRIKSHLLRM--RIEDILR-  147
             P+ R +  FYA  QAI+YI CFR          G I     +    +R    I D+L  
Sbjct  512  GPDLRRYATFYATAQAILYIFCFRWRDLTTAAQEGDIDIHVELDLDQVRFPPNISDVLHT  571

Query  148  --HS-LCPLMVCLPSIVEEFLRVAETTC-LFSFP--ENNAPIGSGLLESEVSMA--FGGN  303
              HS L PL +C PSIV EF R+A     ++ FP  E N  I      S +SM   FG  
Sbjct  572  AIHSKLNPLKICSPSIVREFARIAHHVGFMYVFPLLETNKRIRIFTFRSSMSMDSRFGQI  631

Query  304  QR-----------LDTFFPFDPCLLKKSDRFIRPNFIYWSMV  396
            +R           LD +FPFDP  L +S R++  +++ W  V
Sbjct  632  ERETRADNDLGPQLDAYFPFDPYNLPRSRRWLEGDYVEWRGV  673



>ref|XP_001245293.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Coccidioides immitis RS]
Length=697

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 75/162 (46%), Gaps = 31/162 (19%)
 Frame = +1

Query  4    NPNPRAHKDFYAGCQAIMYIICFR---------RGSIHSLFRIKSHLLRM--RIEDILR-  147
             P+ R +  FYA  QAI+YI CFR          G I     +    +R    I D+L  
Sbjct  503  GPDLRRYATFYATAQAILYIFCFRWRDLTTAAQEGDIDIHVELDLDQVRFPPNISDVLHT  562

Query  148  --HS-LCPLMVCLPSIVEEFLRVAETTC-LFSFP--ENNAPIGSGLLESEVSMA--FGGN  303
              HS L PL +C PSIV EF R+A     ++ FP  E N  I      S +SM   FG  
Sbjct  563  AIHSKLNPLKICSPSIVREFARIAHHVGFMYVFPLLETNKRIRIFTFRSSMSMDSRFGQI  622

Query  304  QR-----------LDTFFPFDPCLLKKSDRFIRPNFIYWSMV  396
            +R           LD +FPFDP  L +S R++  +++ W  V
Sbjct  623  ERETRADNDLGPQLDAYFPFDPYNLPRSRRWLEGDYVEWRGV  664



>ref|XP_005391114.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X3 [Chinchilla lanigera]
Length=568

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +1

Query  22   HKDFYAGCQAIMYIICFRRGSI--HSLFRIKSHLLRMRIEDILRHSLCPLMVCLPSIVEE  195
            H  FY+ CQA+ Y   FR   +   +L     +L  +  + I+   L PL +CLPS+V  
Sbjct  363  HGPFYSACQAVFYTFVFRHKQLLDGNLKEGLRYLQSLNFQRIVMSQLNPLKICLPSVVNF  422

Query  196  FLRVAETTCL---FSFPENNAPIGSGLLESEVSMAFGGNQR-----LDTFFPFDPCLLKK  351
            F  +     L   ++  E N      +L    + A G + +     LDTFFPFDPC+LK+
Sbjct  423  FAAITNKYQLVFCYTVIERN---NRQMLPVIRNTAGGDSVQTCTNPLDTFFPFDPCVLKR  479

Query  352  SDRFIRPNFIYW  387
            S +FI P +  W
Sbjct  480  SKKFIDPIYQTW  491



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175