BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN007F08

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001190922.1|  monosaccharide-sensing protein 2                   223   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595864.1|  PREDICTED: monosaccharide-sensing protein 2        225   7e-66   Nicotiana tomentosiformis
dbj|BAH57059.1|  AT4G35300                                              222   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796447.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   4e-65   Nicotiana sylvestris
ref|XP_006342166.1|  PREDICTED: monosaccharide-sensing protein 2-...    222   9e-65   Solanum tuberosum [potatoes]
ref|XP_011100175.1|  PREDICTED: monosaccharide-sensing protein 2-...    222   1e-64   Sesamum indicum [beniseed]
gb|EYU43534.1|  hypothetical protein MIMGU_mgv1a001953mg                221   2e-64   Erythranthe guttata [common monkey flower]
gb|EYU43535.1|  hypothetical protein MIMGU_mgv1a002513mg                220   3e-64   Erythranthe guttata [common monkey flower]
gb|EPS65490.1|  hypothetical protein M569_09283                         219   1e-63   Genlisea aurea
gb|ABK29441.1|  sugar transport protein                                 209   1e-63   Coffea canephora [robusta coffee]
ref|NP_849565.1|  monosaccharide-sensing protein 2                      218   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195256.3|  monosaccharide-sensing protein 2                      218   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001289848.1|  monosaccharide-sensing protein 2                   218   5e-63   Solanum lycopersicum
gb|KJB14186.1|  hypothetical protein B456_002G113400                    209   3e-61   Gossypium raimondii
gb|KHN20087.1|  Monosaccharide-sensing protein 2                        211   7e-61   Glycine soja [wild soybean]
gb|ABR25915.1|  sugar transporter type 2a                               198   9e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_003527273.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   1e-60   Glycine max [soybeans]
emb|CDP07261.1|  unnamed protein product                                211   2e-60   Coffea canephora [robusta coffee]
ref|XP_007135975.1|  hypothetical protein PHAVU_009G007600g             210   2e-60   Phaseolus vulgaris [French bean]
ref|XP_004500833.1|  PREDICTED: monosaccharide-sensing protein 2-...    210   2e-60   Cicer arietinum [garbanzo]
gb|KJB77473.1|  hypothetical protein B456_012G139000                    207   2e-60   Gossypium raimondii
ref|XP_002867077.1|  hypothetical protein ARALYDRAFT_491117             210   3e-60   
ref|XP_003603868.1|  Monosaccharide-sensing protein                     210   3e-60   Medicago truncatula
ref|XP_003603869.1|  Monosaccharide-sensing protein                     209   3e-60   
ref|XP_006577928.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   5e-60   Glycine max [soybeans]
gb|KJB14185.1|  hypothetical protein B456_002G113400                    209   5e-60   Gossypium raimondii
gb|KHN33775.1|  Monosaccharide-sensing protein 2                        209   5e-60   Glycine soja [wild soybean]
gb|KJB14177.1|  hypothetical protein B456_002G113400                    209   7e-60   Gossypium raimondii
gb|KHG10189.1|  Monosaccharide-sensing 2 -like protein                  209   7e-60   Gossypium arboreum [tree cotton]
ref|XP_007043079.1|  Tonoplast monosaccharide transporter2              209   1e-59   
ref|XP_004289029.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   1e-59   Fragaria vesca subsp. vesca
ref|XP_010061214.1|  PREDICTED: monosaccharide-sensing protein 2-...    208   1e-59   Eucalyptus grandis [rose gum]
ref|XP_011074068.1|  PREDICTED: monosaccharide-sensing protein 2-...    208   1e-59   Sesamum indicum [beniseed]
ref|XP_008358445.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   2e-59   
emb|CDP01766.1|  unnamed protein product                                207   2e-59   Coffea canephora [robusta coffee]
ref|XP_010446942.1|  PREDICTED: monosaccharide-sensing protein 2        207   3e-59   Camelina sativa [gold-of-pleasure]
gb|KJB79729.1|  hypothetical protein B456_013G064200                    204   3e-59   Gossypium raimondii
gb|AJO70165.1|  tonoplast monosaccharide transporters 1                 207   4e-59   Camellia sinensis [black tea]
ref|XP_007018122.1|  Tonoplast monosaccharide transporter2 isoform 4    207   4e-59   
ref|XP_007018119.1|  Tonoplast monosaccharide transporter2 isoform 1    207   5e-59   
gb|KHG04802.1|  Monosaccharide-sensing protein 2                        206   5e-59   Gossypium arboreum [tree cotton]
ref|XP_010432297.1|  PREDICTED: monosaccharide-sensing protein 2-...    206   6e-59   Camelina sativa [gold-of-pleasure]
gb|KHG04801.1|  Monosaccharide-sensing protein 2                        206   7e-59   Gossypium arboreum [tree cotton]
gb|KDO68402.1|  hypothetical protein CISIN_1g004750mg                   206   7e-59   Citrus sinensis [apfelsine]
ref|XP_006486570.1|  PREDICTED: monosaccharide-sensing protein 2-...    206   7e-59   Citrus sinensis [apfelsine]
ref|XP_008373385.1|  PREDICTED: monosaccharide-sensing protein 2-...    206   7e-59   
emb|CDY65623.1|  BnaCnng48010D                                          205   9e-59   Brassica napus [oilseed rape]
emb|CDX69128.1|  BnaC01g03250D                                          205   9e-59   
gb|KJB77472.1|  hypothetical protein B456_012G139000                    206   1e-58   Gossypium raimondii
ref|XP_006422393.1|  hypothetical protein CICLE_v10027893mg             206   1e-58   
gb|ABK29442.1|  sugar transport protein                                 191   1e-58   Coffea canephora [robusta coffee]
ref|XP_006283193.1|  hypothetical protein CARUB_v10004225mg             206   1e-58   Capsella rubella
ref|XP_010094525.1|  Monosaccharide-sensing protein 2                   206   1e-58   Morus notabilis
ref|XP_009103100.1|  PREDICTED: monosaccharide-sensing protein 2        205   1e-58   
ref|XP_008237926.1|  PREDICTED: monosaccharide-sensing protein 2        205   2e-58   Prunus mume [ume]
emb|CBI21577.3|  unnamed protein product                                203   3e-58   Vitis vinifera
dbj|BAJ87413.1|  predicted protein                                      199   4e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004500684.1|  PREDICTED: monosaccharide-sensing protein 2-...    204   4e-58   
ref|XP_010090703.1|  Monosaccharide-sensing protein 2                   204   7e-58   Morus notabilis
ref|XP_010266257.1|  PREDICTED: monosaccharide-sensing protein 2 ...    203   7e-58   Nelumbo nucifera [Indian lotus]
gb|EYU30848.1|  hypothetical protein MIMGU_mgv1a001984mg                203   7e-58   Erythranthe guttata [common monkey flower]
emb|CBI40753.3|  unnamed protein product                                202   8e-58   Vitis vinifera
ref|XP_002276373.1|  PREDICTED: monosaccharide-sensing protein 2        203   8e-58   Vitis vinifera
ref|XP_010437493.1|  PREDICTED: monosaccharide-sensing protein 2-...    203   8e-58   
gb|AAX47312.1|  hexose transporter 6                                    203   1e-57   Vitis vinifera
gb|KJB79728.1|  hypothetical protein B456_013G064200                    203   1e-57   Gossypium raimondii
gb|AIQ77649.1|  tonoplastic transporter 1                               203   1e-57   Vitis vinifera
gb|KHG05233.1|  Monosaccharide-sensing 2 -like protein                  203   1e-57   Gossypium arboreum [tree cotton]
emb|CAN59780.1|  hypothetical protein VITISV_024656                     203   1e-57   Vitis vinifera
ref|NP_001267873.1|  hexose transporter-like                            202   1e-57   Vitis vinifera
ref|XP_010680636.1|  PREDICTED: monosaccharide-sensing protein 2-...    202   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010066352.1|  PREDICTED: monosaccharide-sensing protein 2-...    202   2e-57   Eucalyptus grandis [rose gum]
gb|KCW64229.1|  hypothetical protein EUGRSUZ_G01880                     202   2e-57   Eucalyptus grandis [rose gum]
ref|XP_007210337.1|  hypothetical protein PRUPE_ppa001932mg             202   2e-57   Prunus persica
ref|XP_011098017.1|  PREDICTED: monosaccharide-sensing protein 2-...    201   6e-57   Sesamum indicum [beniseed]
ref|XP_007137297.1|  hypothetical protein PHAVU_009G115500g             201   8e-57   Phaseolus vulgaris [French bean]
ref|XP_006343319.1|  PREDICTED: monosaccharide-sensing protein 2-...    200   8e-57   Solanum tuberosum [potatoes]
ref|XP_003604104.1|  Monosaccharide-sensing protein                     201   8e-57   Medicago truncatula
gb|KDO85210.1|  hypothetical protein CISIN_1g004673mg                   197   9e-57   Citrus sinensis [apfelsine]
emb|CDI66591.1|  putative sugar transporter type 2a protein             200   9e-57   Saccharum hybrid cultivar R570
ref|XP_003526737.1|  PREDICTED: monosaccharide-sensing protein 2-...    200   1e-56   Glycine max [soybeans]
ref|XP_008464819.1|  PREDICTED: monosaccharide-sensing protein 2-...    200   1e-56   Cucumis melo [Oriental melon]
ref|XP_003543932.1|  PREDICTED: monosaccharide-sensing protein 2-...    200   1e-56   
gb|KHN19961.1|  Monosaccharide-sensing protein 2                        200   1e-56   Glycine soja [wild soybean]
gb|EMS49950.1|  Monosaccharide-sensing protein 2                        199   2e-56   Triticum urartu
ref|NP_001280690.1|  monosaccharide-sensing protein 2-like              199   2e-56   Solanum lycopersicum
gb|KHN33643.1|  Monosaccharide-sensing protein 2                        199   2e-56   Glycine soja [wild soybean]
emb|CAN64713.1|  hypothetical protein VITISV_043728                     185   2e-56   Vitis vinifera
ref|XP_009359630.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   2e-56   
ref|XP_006647093.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   2e-56   Oryza brachyantha
ref|XP_009359631.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   2e-56   
ref|XP_009359629.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_010686712.1|  PREDICTED: monosaccharide-sensing protein 2        199   3e-56   Beta vulgaris subsp. vulgaris [field beet]
emb|CDI66586.1|  putative sugar transporter type 2a protein             199   3e-56   Saccharum hybrid cultivar R570
gb|EAY85098.1|  hypothetical protein OsI_06450                          199   3e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_004154526.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   3e-56   
ref|NP_001046359.1|  Os02g0229400                                       199   3e-56   
ref|XP_004139974.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   3e-56   
dbj|BAJ89532.1|  predicted protein                                      199   4e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002510716.1|  sugar transporter, putative                        199   4e-56   Ricinus communis
gb|EAZ22316.1|  hypothetical protein OsJ_05971                          199   4e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539774.1|  PREDICTED: monosaccharide-sensing protein 1-...    198   5e-56   Tarenaya hassleriana [spider flower]
ref|XP_003518591.1|  PREDICTED: monosaccharide-sensing protein 2-...    198   6e-56   Glycine max [soybeans]
ref|XP_009390770.1|  PREDICTED: monosaccharide-sensing protein 2-...    198   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN46863.1|  Monosaccharide-sensing protein 2                        198   7e-56   Glycine soja [wild soybean]
ref|XP_008440928.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    197   9e-56   
ref|XP_006412119.1|  hypothetical protein EUTSA_v10024517mg             197   9e-56   Eutrema salsugineum [saltwater cress]
ref|XP_010909820.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   1e-55   Elaeis guineensis
emb|CDY31497.1|  BnaC05g16060D                                          196   1e-55   Brassica napus [oilseed rape]
ref|XP_004300112.1|  PREDICTED: monosaccharide-sensing protein 2        197   1e-55   Fragaria vesca subsp. vesca
gb|KDO85208.1|  hypothetical protein CISIN_1g004673mg                   197   1e-55   Citrus sinensis [apfelsine]
ref|XP_007204446.1|  hypothetical protein PRUPE_ppa026426mg             197   1e-55   Prunus persica
gb|EMT06669.1|  Monosaccharide-sensing protein 2                        197   1e-55   
ref|XP_004951395.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   1e-55   Setaria italica
ref|XP_006435423.1|  hypothetical protein CICLE_v10000400mg             197   1e-55   Citrus clementina [clementine]
ref|XP_009340799.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   2e-55   Pyrus x bretschneideri [bai li]
emb|CDY29502.1|  BnaA06g14680D                                          196   2e-55   Brassica napus [oilseed rape]
ref|XP_008382498.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   2e-55   
gb|KDP36756.1|  hypothetical protein JCGZ_08047                         197   2e-55   Jatropha curcas
ref|XP_008242106.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   2e-55   Prunus mume [ume]
ref|XP_009149562.1|  PREDICTED: monosaccharide-sensing protein 1        196   3e-55   Brassica rapa
ref|XP_008448165.1|  PREDICTED: monosaccharide-sensing protein 2        196   3e-55   Cucumis melo [Oriental melon]
ref|XP_011040809.1|  PREDICTED: monosaccharide-sensing protein 2-...    196   3e-55   Populus euphratica
ref|XP_010459775.1|  PREDICTED: monosaccharide-sensing protein 1-...    195   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009589978.1|  PREDICTED: monosaccharide-sensing protein 2-...    196   3e-55   Nicotiana tomentosiformis
ref|XP_008392888.1|  PREDICTED: monosaccharide-sensing protein 2-...    192   3e-55   
ref|XP_003571780.1|  PREDICTED: monosaccharide-sensing protein 2-...    196   4e-55   Brachypodium distachyon [annual false brome]
gb|AIN39841.1|  hypothetical protein                                    196   4e-55   Zoysia matrella [Japanese carpet grass]
ref|XP_002520608.1|  sugar transporter, putative                        196   4e-55   Ricinus communis
gb|AFW59276.1|  hypothetical protein ZEAMMB73_154299                    195   4e-55   
ref|XP_008645619.1|  PREDICTED: monosaccharide-sensing protein 2-...    196   5e-55   Zea mays [maize]
ref|XP_010537220.1|  PREDICTED: monosaccharide-sensing protein 1-...    195   6e-55   Tarenaya hassleriana [spider flower]
ref|XP_009608796.1|  PREDICTED: monosaccharide-sensing protein 2-...    195   7e-55   Nicotiana tomentosiformis
ref|XP_010548175.1|  PREDICTED: monosaccharide-sensing protein 2        195   7e-55   Tarenaya hassleriana [spider flower]
ref|XP_009763350.1|  PREDICTED: monosaccharide-sensing protein 2-...    195   7e-55   Nicotiana sylvestris
ref|XP_009775817.1|  PREDICTED: monosaccharide-sensing protein 2-...    195   7e-55   Nicotiana sylvestris
ref|XP_011099908.1|  PREDICTED: monosaccharide-sensing protein 2-...    194   1e-54   Sesamum indicum [beniseed]
emb|CDP14489.1|  unnamed protein product                                194   1e-54   Coffea canephora [robusta coffee]
gb|KDP47010.1|  hypothetical protein JCGZ_10737                         194   1e-54   Jatropha curcas
ref|XP_004169167.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    194   1e-54   
ref|XP_004134823.1|  PREDICTED: monosaccharide-sensing protein 2-...    194   1e-54   
ref|XP_010690557.1|  PREDICTED: monosaccharide-sensing protein 2        194   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008778122.1|  PREDICTED: monosaccharide-sensing protein 2-...    194   1e-54   
ref|XP_002467580.1|  hypothetical protein SORBIDRAFT_01g030430          194   1e-54   Sorghum bicolor [broomcorn]
gb|KGN49001.1|  hypothetical protein Csa_6G509700                       194   1e-54   Cucumis sativus [cucumbers]
ref|XP_003574265.1|  PREDICTED: monosaccharide-sensing protein 2-...    193   3e-54   Brachypodium distachyon [annual false brome]
ref|XP_009776539.1|  PREDICTED: monosaccharide-sensing protein 2-...    193   3e-54   Nicotiana sylvestris
ref|XP_009622210.1|  PREDICTED: monosaccharide-sensing protein 2-...    193   4e-54   Nicotiana tomentosiformis
ref|XP_006416357.1|  hypothetical protein EUTSA_v10006916mg             192   5e-54   Eutrema salsugineum [saltwater cress]
dbj|BAJ33724.1|  unnamed protein product                                192   5e-54   Eutrema halophilum
emb|CAD58958.1|  hexose transporter                                     192   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90138.1|  predicted protein                                      192   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009401004.1|  PREDICTED: monosaccharide-sensing protein 2-...    192   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS57524.1|  hypothetical protein M569_17293                         192   8e-54   Genlisea aurea
gb|EMS63940.1|  Monosaccharide-sensing protein 2                        192   9e-54   Triticum urartu
gb|EMT29091.1|  Monosaccharide-sensing protein 2                        192   1e-53   
ref|NP_001065182.1|  Os10g0539900                                       192   1e-53   
ref|XP_007142576.1|  hypothetical protein PHAVU_008G292400g             191   1e-53   Phaseolus vulgaris [French bean]
gb|EEC67373.1|  hypothetical protein OsI_34495                          191   1e-53   Oryza sativa Indica Group [Indian rice]
emb|CBI37732.3|  unnamed protein product                                191   1e-53   Vitis vinifera
ref|XP_009392211.1|  PREDICTED: monosaccharide-sensing protein 2-...    191   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA46101.1|  TPA: hypothetical protein ZEAMMB73_051534              184   1e-53   
ref|XP_002282975.1|  PREDICTED: monosaccharide-sensing protein 2        191   2e-53   Vitis vinifera
ref|XP_010678631.1|  PREDICTED: monosaccharide-sensing protein 2-...    191   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009397963.1|  PREDICTED: monosaccharide-sensing protein 2-...    191   2e-53   
ref|XP_010029562.1|  PREDICTED: monosaccharide-sensing protein 2-...    191   2e-53   Eucalyptus grandis [rose gum]
gb|AFP89954.1|  tonoplastic transporter 2                               191   3e-53   Vitis vinifera
ref|XP_010477336.1|  PREDICTED: monosaccharide-sensing protein 1        190   4e-53   Camelina sativa [gold-of-pleasure]
tpg|DAA46100.1|  TPA: hypothetical protein ZEAMMB73_051534              186   5e-53   
ref|XP_004983796.1|  PREDICTED: monosaccharide-sensing protein 2-...    189   7e-53   Setaria italica
gb|AAD30608.1|AC007369_18  Sugar transporter                            189   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173508.1|  tonoplast monosaccharide transporter1                 189   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009372620.1|  PREDICTED: monosaccharide-sensing protein 2        189   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_010270527.1|  PREDICTED: monosaccharide-sensing protein 2        189   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010063149.1|  PREDICTED: monosaccharide-sensing protein 2-...    188   2e-52   Eucalyptus grandis [rose gum]
ref|XP_002307812.1|  hypothetical protein POPTR_0005s27680g             188   2e-52   Populus trichocarpa [western balsam poplar]
gb|AAO37640.1|  putative sugar transporter type 2a                      188   2e-52   Saccharum hybrid cultivar Q117
emb|CAN80213.1|  hypothetical protein VITISV_042076                     188   3e-52   Vitis vinifera
ref|XP_009110209.1|  PREDICTED: monosaccharide-sensing protein 1        188   3e-52   Brassica rapa
emb|CDX96618.1|  BnaA08g21610D                                          188   3e-52   
emb|CDY33650.1|  BnaC08g19500D                                          187   3e-52   Brassica napus [oilseed rape]
ref|XP_009333794.1|  PREDICTED: monosaccharide-sensing protein 2-...    187   7e-52   
ref|XP_004290074.1|  PREDICTED: monosaccharide-sensing protein 2        187   7e-52   Fragaria vesca subsp. vesca
ref|XP_006306868.1|  hypothetical protein CARUB_v10008415mg             186   9e-52   
ref|XP_008377843.1|  PREDICTED: monosaccharide-sensing protein 2-...    186   1e-51   
ref|XP_010940242.1|  PREDICTED: monosaccharide-sensing protein 2-...    186   1e-51   Elaeis guineensis
ref|NP_001151936.1|  LOC100285573                                       186   1e-51   Zea mays [maize]
ref|XP_007201798.1|  hypothetical protein PRUPE_ppa001957mg             186   1e-51   Prunus persica
ref|XP_002893133.1|  hypothetical protein ARALYDRAFT_472320             186   1e-51   
ref|XP_009341490.1|  PREDICTED: monosaccharide-sensing protein 2-...    186   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_008235816.1|  PREDICTED: monosaccharide-sensing protein 2        185   3e-51   Prunus mume [ume]
emb|CDY16303.1|  BnaC01g23380D                                          184   5e-51   Brassica napus [oilseed rape]
ref|XP_006384856.1|  transporter-related family protein                 184   8e-51   
ref|XP_002312798.1|  transporter-related family protein                 184   9e-51   
ref|XP_006403910.1|  hypothetical protein EUTSA_v10011113mg             184   9e-51   Eutrema salsugineum [saltwater cress]
ref|XP_009148978.1|  PREDICTED: monosaccharide-sensing protein 3        183   1e-50   Brassica rapa
ref|XP_011000869.1|  PREDICTED: monosaccharide-sensing protein 2-...    183   1e-50   Populus euphratica
ref|XP_004978456.1|  PREDICTED: monosaccharide-sensing protein 2-...    183   1e-50   
ref|XP_010503840.1|  PREDICTED: monosaccharide-sensing protein 3-...    183   2e-50   Camelina sativa [gold-of-pleasure]
dbj|BAI94493.1|  sugar transporter                                      182   2e-50   Dianthus caryophyllus [carnation]
ref|XP_010426703.1|  PREDICTED: monosaccharide-sensing protein 3-...    182   3e-50   Camelina sativa [gold-of-pleasure]
ref|NP_001147067.1|  hexose transporter                                 182   3e-50   Zea mays [maize]
gb|ACG25339.1|  hexose transporter                                      182   3e-50   Zea mays [maize]
gb|KCW55684.1|  hypothetical protein EUGRSUZ_I01534                     174   3e-50   Eucalyptus grandis [rose gum]
ref|XP_009115837.1|  PREDICTED: monosaccharide-sensing protein 3        182   4e-50   Brassica rapa
emb|CDX78009.1|  BnaA09g32040D                                          181   4e-50   
ref|XP_008812559.1|  PREDICTED: monosaccharide-sensing protein 2-...    182   5e-50   Phoenix dactylifera
ref|XP_010515555.1|  PREDICTED: monosaccharide-sensing protein 3        181   5e-50   Camelina sativa [gold-of-pleasure]
emb|CDX73717.1|  BnaC08g22860D                                          181   5e-50   
ref|XP_006292750.1|  hypothetical protein CARUB_v10018997mg             181   5e-50   
gb|KFK34392.1|  hypothetical protein AALP_AA5G139300                    181   5e-50   Arabis alpina [alpine rockcress]
ref|NP_001190054.1|  tonoplast monosaccharide transporter3              179   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190717.1|  tonoplast monosaccharide transporter3                 179   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877807.1|  predicted protein                                  179   3e-49   
ref|XP_004144248.1|  PREDICTED: monosaccharide-sensing protein 2-...    179   4e-49   Cucumis sativus [cucumbers]
emb|CDY33276.1|  BnaA01g19430D                                          178   5e-49   Brassica napus [oilseed rape]
ref|XP_006855646.1|  hypothetical protein AMTR_s00044p00110510          178   6e-49   
ref|XP_008786687.1|  PREDICTED: monosaccharide-sensing protein 2-...    177   1e-48   Phoenix dactylifera
gb|EMT28528.1|  Monosaccharide-sensing protein 3                        175   3e-48   
ref|NP_001067890.1|  Os11g0475600                                       176   4e-48   
gb|EAY80902.1|  hypothetical protein OsI_36080                          176   5e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006662557.1|  PREDICTED: monosaccharide-sensing protein 2-...    175   7e-48   
ref|XP_011041174.1|  PREDICTED: monosaccharide-sensing protein 2-...    175   1e-47   Populus euphratica
ref|XP_010028861.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    175   1e-47   
ref|XP_004964709.1|  PREDICTED: monosaccharide-sensing protein 2-...    174   2e-47   Setaria italica
ref|XP_007203009.1|  hypothetical protein PRUPE_ppa017631mg             174   2e-47   Prunus persica
ref|XP_011034826.1|  PREDICTED: monosaccharide-sensing protein 2-...    174   2e-47   Populus euphratica
ref|XP_003560303.1|  PREDICTED: monosaccharide-sensing protein 2-...    174   3e-47   Brachypodium distachyon [annual false brome]
ref|XP_004977696.1|  PREDICTED: monosaccharide-sensing protein 2-...    163   5e-47   Setaria italica
dbj|BAK02857.1|  predicted protein                                      172   6e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008242155.1|  PREDICTED: monosaccharide-sensing protein 2-...    172   7e-47   Prunus mume [ume]
ref|XP_002300629.1|  hypothetical protein POPTR_0002s00760g             172   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002439068.1|  hypothetical protein SORBIDRAFT_10g031000          172   1e-46   Sorghum bicolor [broomcorn]
gb|KJB12351.1|  hypothetical protein B456_002G014400                    171   3e-46   Gossypium raimondii
gb|KJB12354.1|  hypothetical protein B456_002G014400                    171   3e-46   Gossypium raimondii
ref|XP_009359632.1|  PREDICTED: monosaccharide-sensing protein 2-...    171   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_004289030.1|  PREDICTED: monosaccharide-sensing protein 2        170   4e-46   Fragaria vesca subsp. vesca
gb|EYU40481.1|  hypothetical protein MIMGU_mgv1a001997mg                170   6e-46   Erythranthe guttata [common monkey flower]
gb|KJB31963.1|  hypothetical protein B456_005G216600                    170   7e-46   Gossypium raimondii
gb|KHG00737.1|  Monosaccharide-sensing 2 -like protein                  168   2e-45   Gossypium arboreum [tree cotton]
gb|KHG14026.1|  Monosaccharide-sensing 2 -like protein                  168   3e-45   Gossypium arboreum [tree cotton]
ref|XP_010097645.1|  Monosaccharide-sensing protein 3                   167   6e-45   Morus notabilis
ref|XP_006653836.1|  PREDICTED: monosaccharide-sensing protein 2-...    165   4e-44   Oryza brachyantha
ref|XP_011022133.1|  PREDICTED: monosaccharide-sensing protein 2-...    164   5e-44   Populus euphratica
ref|XP_002306419.1|  hypothetical protein POPTR_0005s10180g             164   5e-44   
gb|EMT02609.1|  Monosaccharide-sensing protein 3                        164   1e-43   
ref|XP_006649210.1|  PREDICTED: monosaccharide-sensing protein 2-...    163   1e-43   
ref|XP_004954530.1|  PREDICTED: monosaccharide-sensing protein 2-...    163   1e-43   Setaria italica
gb|EMS63099.1|  Monosaccharide-sensing protein 3                        163   1e-43   Triticum urartu
ref|XP_003573173.1|  PREDICTED: monosaccharide-sensing protein 2-...    163   2e-43   Brachypodium distachyon [annual false brome]
gb|EMS60524.1|  Monosaccharide-sensing protein 3                        160   2e-43   Triticum urartu
ref|XP_002979533.1|  hypothetical protein SELMODRAFT_111167             162   4e-43   
ref|XP_010029563.1|  PREDICTED: monosaccharide-sensing protein 2-...    162   4e-43   Eucalyptus grandis [rose gum]
dbj|BAD23011.1|  putative hexose transporter                            160   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88138.1|  hypothetical protein OsI_09573                          160   1e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_002977746.1|  hypothetical protein SELMODRAFT_10582              160   2e-42   
gb|EMT01868.1|  Monosaccharide-sensing protein 2                        159   2e-42   
gb|KDP43790.1|  hypothetical protein JCGZ_22417                         158   9e-42   Jatropha curcas
emb|CAA90628.1|  sugar transporter                                      157   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16371.1|  hexose transporter                                      152   1e-39   Saccharum hybrid cultivar R570
gb|EEE58264.1|  hypothetical protein OsJ_09268                          150   3e-39   Oryza sativa Japonica Group [Japonica rice]
gb|AAN17390.1|  Putative sugar transporter protein                      150   6e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88374.1|  hypothetical protein OsI_09831                          150   6e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_001761207.1|  predicted protein                                  150   6e-39   
dbj|BAA85398.1|  unnamed protein product                                150   7e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562146.1|  PREDICTED: monosaccharide-sensing protein 2-...    150   1e-38   
emb|CAD58959.1|  sugar transporter                                      149   4e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004509464.1|  PREDICTED: monosaccharide-sensing protein 2-...    147   8e-38   Cicer arietinum [garbanzo]
ref|XP_003629095.1|  Monosaccharide-sensing protein                     144   9e-37   
ref|XP_001784511.1|  predicted protein                                  144   1e-36   
ref|XP_001773057.1|  predicted protein                                  143   4e-36   
ref|XP_002981960.1|  hypothetical protein SELMODRAFT_179172             142   6e-36   Selaginella moellendorffii
ref|XP_003548779.1|  PREDICTED: monosaccharide-sensing protein 3-...    142   8e-36   Glycine max [soybeans]
ref|XP_007156262.1|  hypothetical protein PHAVU_003G271500g             141   1e-35   Phaseolus vulgaris [French bean]
ref|XP_002978337.1|  hypothetical protein SELMODRAFT_268165             140   3e-35   
ref|XP_002970170.1|  hypothetical protein SELMODRAFT_231525             140   3e-35   
ref|XP_002982939.1|  hypothetical protein SELMODRAFT_445340             140   5e-35   Selaginella moellendorffii
ref|XP_007158028.1|  hypothetical protein PHAVU_002G118100g             140   5e-35   Phaseolus vulgaris [French bean]
gb|KHN35942.1|  Monosaccharide-sensing protein 3                        139   8e-35   Glycine soja [wild soybean]
ref|XP_003517121.1|  PREDICTED: monosaccharide-sensing protein 2-...    139   9e-35   
gb|AFK36736.1|  unknown                                                 133   2e-34   
ref|XP_003537696.1|  PREDICTED: monosaccharide-sensing protein 2-...    138   3e-34   
ref|XP_004512287.1|  PREDICTED: monosaccharide-sensing protein 2-...    137   4e-34   
gb|AES95370.2|  tonoplast monosaccharide transporter 2                  137   4e-34   
ref|XP_003612412.1|  Monosaccharide-sensing protein                     137   5e-34   
ref|XP_004977442.1|  PREDICTED: monosaccharide-sensing protein 2-...    125   2e-32   
ref|XP_001754179.1|  predicted protein                                  131   4e-32   
ref|XP_010237536.1|  PREDICTED: monosaccharide-sensing protein 2-...    126   6e-31   
ref|XP_003577342.1|  PREDICTED: monosaccharide-sensing protein 2-...    125   4e-30   
ref|XP_009387331.1|  PREDICTED: monosaccharide-sensing protein 1-...    125   4e-30   
ref|XP_003614108.1|  Monosaccharide-sensing protein                     124   2e-29   
gb|EEC68553.1|  hypothetical protein OsI_36866                          123   4e-29   
gb|ABA94776.1|  Sugar transporter, putative, expressed                  123   4e-29   
gb|ABA94777.1|  Sugar transporter, putative, expressed                  122   5e-29   
ref|XP_006663052.1|  PREDICTED: monosaccharide-sensing protein 2-...    120   6e-28   
ref|XP_002981894.1|  hypothetical protein SELMODRAFT_179271             117   4e-27   
ref|XP_002986014.1|  hypothetical protein SELMODRAFT_182142             117   4e-27   
ref|XP_008242156.1|  PREDICTED: monosaccharide-sensing protein 2-...    109   6e-27   
gb|ABK93009.1|  unknown                                                 105   5e-26   
ref|XP_004979746.1|  PREDICTED: monosaccharide-sensing protein 3-...    111   5e-25   
ref|NP_001140361.1|  uncharacterized protein LOC100272411               108   7e-25   
ref|XP_008676725.1|  PREDICTED: uncharacterized protein LOC100272...    108   2e-24   
gb|AAM94321.1|  putative sugar transporter                              110   2e-24   
ref|XP_002449882.1|  hypothetical protein SORBIDRAFT_05g024860          110   2e-24   
gb|AAN40021.1|  putative sugar transporter protein                      108   6e-24   
ref|XP_008676723.1|  PREDICTED: uncharacterized protein LOC100272...    108   7e-24   
ref|XP_002453101.1|  hypothetical protein SORBIDRAFT_04g038470          100   2e-23   
ref|WP_018699802.1|  hypothetical protein                             94.0    3e-19   
ref|WP_019233467.1|  sugar:proton symporter                           93.6    4e-19   
ref|WP_031563482.1|  sugar:proton symporter                           92.0    2e-18   
ref|WP_028380912.1|  sugar:proton symporter                           91.3    3e-18   
ref|WP_043236249.1|  sugar transporter                                88.6    2e-17   
ref|WP_018631168.1|  hypothetical protein                             89.0    3e-17   
ref|WP_028379283.1|  sugar:proton symporter                           88.6    3e-17   
ref|WP_027228917.1|  sugar:proton symporter                           88.6    3e-17   
ref|WP_028378007.1|  sugar:proton symporter                           88.6    3e-17   
ref|WP_003635103.1|  sugar:proton symporter                           88.6    3e-17   
ref|WP_024277537.1|  sugar transporter                                88.2    4e-17   
ref|WP_029557156.1|  sugar transporter                                87.8    4e-17   
ref|WP_027269579.1|  sugar:proton symporter                           87.8    5e-17   
ref|WP_041339107.1|  major facilitator transporter                    87.4    7e-17   
ref|WP_035714084.1|  sugar transporter                                87.0    7e-17   
gb|ABS66075.1|  sugar transporter                                     87.0    8e-17   
ref|WP_010621797.1|  MFS transporter                                  87.0    8e-17   
ref|XP_005174792.1|  PREDICTED: facilitated trehalose transporter...  88.2    1e-16   
ref|WP_020694258.1|  hypothetical protein                             86.7    1e-16   
ref|WP_007765369.1|  MFS transporter                                  86.7    1e-16   
ref|WP_028555263.1|  MFS transporter                                  86.3    2e-16   
ref|WP_041576361.1|  sugar transporter                                85.9    2e-16   
ref|WP_041882616.1|  sugar:proton symporter                           85.5    3e-16   
gb|EEF77612.1|  transporter, major facilitator family protein         84.0    3e-16   
emb|CEG58058.1|  putative metabolite transport protein YwtG           85.5    4e-16   
ref|XP_006621467.1|  PREDICTED: solute carrier family 2, facilita...  85.9    4e-16   
ref|XP_003693200.1|  PREDICTED: solute carrier family 2, facilita...  85.5    4e-16   
ref|WP_013644894.1|  major facilitator transporter                    85.1    4e-16   
ref|WP_007560303.1|  MFS transporter                                  85.1    5e-16   
ref|WP_027222610.1|  sugar:proton symporter                           84.7    5e-16   
ref|WP_028383633.1|  sugar:proton symporter                           85.1    5e-16   
ref|WP_035891457.1|  sugar:proton symporter                           84.7    6e-16   
ref|WP_025519285.1|  sugar:proton symporter                           82.8    6e-16   
ref|XP_003398790.1|  PREDICTED: solute carrier family 2, facilita...  85.1    6e-16   
ref|WP_006872344.1|  sugar:proton symporter                           84.7    7e-16   
ref|WP_027266629.1|  sugar:proton symporter                           84.7    7e-16   
ref|WP_010946170.1|  sugar:proton symporter                           84.7    7e-16   
ref|XP_003489694.1|  PREDICTED: solute carrier family 2, facilita...  85.1    7e-16   
ref|WP_027223498.1|  sugar:proton symporter                           84.7    7e-16   
ref|WP_010654727.1|  sugar:proton symporter                           84.7    7e-16   
ref|WP_032845792.1|  MULTISPECIES: MFS transporter                    84.3    9e-16   
ref|WP_004307928.1|  MULTISPECIES: MFS transporter                    84.3    9e-16   
ref|WP_035352377.1|  hypothetical protein                             84.3    9e-16   
ref|WP_043553534.1|  major facilitator transporter                    84.3    9e-16   
ref|WP_014216842.1|  sugar:proton symporter                           84.0    1e-15   
ref|WP_004306567.1|  MFS transporter                                  84.3    1e-15   
gb|EIY61831.1|  sugar porter (SP) family MFS transporter              84.3    1e-15   
ref|WP_025849336.1|  MFS transporter                                  84.3    1e-15   
dbj|GAK28219.1|  sugar transporter                                    79.3    1e-15   
ref|WP_033027706.1|  major facilitator transporter                    81.6    1e-15   
ref|WP_044639214.1|  MFS transporter                                  84.0    1e-15   
ref|XP_009024311.1|  hypothetical protein HELRODRAFT_114157           84.0    1e-15   
ref|XP_004992344.1|  hypothetical protein PTSG_06943                  84.3    1e-15   
ref|WP_033012988.1|  major facilitator transporter                    81.3    1e-15   
ref|WP_022277842.1|  sugar porter (SP) family MFS transporter         84.0    1e-15   
ref|WP_034793608.1|  MFS transporter                                  84.0    1e-15   
ref|WP_039074963.1|  metabolite transporter CsbC                      84.0    1e-15   
gb|ERG08448.1|  sugar transporter                                     81.6    1e-15   
ref|WP_032827048.1|  MULTISPECIES: major facilitator transporter      81.3    1e-15   
gb|ABM54152.1|  sugar transporter                                     83.2    1e-15   
ref|WP_019234077.1|  hypothetical protein                             83.6    1e-15   
gb|KFC79470.1|  sugar-proton symporter                                84.0    1e-15   
ref|WP_035155729.1|  MFS transporter                                  83.6    1e-15   
ref|WP_020429182.1|  hypothetical protein                             81.6    1e-15   
ref|XP_003699336.1|  PREDICTED: solute carrier family 2, facilita...  84.0    2e-15   
ref|WP_033611623.1|  MFS transporter                                  83.6    2e-15   
ref|WP_014666032.1|  major facilitator transporter                    83.6    2e-15   
sp|B3MG58.2|TRET1_DROAN  RecName: Full=Facilitated trehalose tran...  84.7    2e-15   
ref|WP_018577072.1|  sugar:proton symporter                           83.6    2e-15   
ref|WP_011405548.1|  major facilitator transporter                    84.0    2e-15   
gb|KFF54976.1|  metabolite transporter CsbC                           83.6    2e-15   
ref|XP_001959931.1|  GF13114                                          84.7    2e-15   
ref|WP_021481038.1|  major facilitator transporter                    83.6    2e-15   
ref|WP_038828964.1|  metabolite transporter CsbC                      83.6    2e-15   
ref|WP_003326199.1|  MULTISPECIES: major facilitator transporter      83.6    2e-15   
ref|WP_018754345.1|  MFS transporter                                  83.2    2e-15   
ref|WP_016710574.1|  major facilitator transporter                    83.2    2e-15   
ref|WP_014841005.1|  sugar:proton symporter                           83.2    2e-15   
ref|WP_038428086.1|  metabolite transporter CsbC                      83.2    2e-15   
ref|WP_003219045.1|  MULTISPECIES: major facilitator transporter      83.2    2e-15   
ref|WP_027219158.1|  sugar:proton symporter                           83.2    2e-15   
ref|WP_011214682.1|  sugar:proton symporter                           83.2    2e-15   
gb|KFK78858.1|  putative metabolite transport protein CsbC            83.2    2e-15   
ref|XP_001422705.1|  MFS family transporter: hexose                   83.2    2e-15   
ref|WP_027264806.1|  sugar:proton symporter                           83.2    2e-15   
ref|WP_038622452.1|  major facilitator transporter                    83.2    2e-15   
ref|WP_014368462.1|  MFS transporter                                  83.2    2e-15   
ref|WP_033012985.1|  major facilitator transporter                    81.3    2e-15   
ref|WP_013914552.1|  MFS transporter                                  83.2    2e-15   
emb|CBH25983.1|  putative sugar-transporter subfamily                 83.2    2e-15   
gb|ERH62287.1|  MFS transporter                                       83.2    2e-15   
ref|WP_024572430.1|  metabolite transporter CsbC                      82.8    3e-15   
ref|WP_040081246.1|  metabolite transporter CsbC                      82.8    3e-15   
ref|XP_004339367.1|  transporter, major facilitator superfamily p...  83.6    3e-15   
gb|ERG08434.1|  sugar transporter                                     80.9    3e-15   
ref|XP_787337.3|  PREDICTED: facilitated trehalose transporter Tr...  83.2    3e-15   
ref|WP_009000594.1|  MFS transporter                                  82.8    3e-15   
ref|WP_012169786.1|  sugar transporter                                82.8    3e-15   
ref|WP_005679385.1|  MULTISPECIES: MFS transporter                    82.8    3e-15   
ref|WP_011945599.1|  sugar:proton symporter                           82.8    3e-15   
ref|WP_028551479.1|  MFS transporter                                  82.8    3e-15   
ref|WP_044654006.1|  MFS transporter                                  82.8    3e-15   
ref|WP_014866604.1|  major facilitator transporter                    82.8    3e-15   
ref|WP_011213069.1|  sugar:proton symporter                           82.8    3e-15   
ref|WP_044442034.1|  major facilitator transporter                    82.8    3e-15   
ref|WP_009283556.1|  sugar transporter                                82.8    3e-15   
ref|WP_026974727.1|  MFS transporter                                  82.8    3e-15   
gb|KJC63930.1|  major facilitator transporter                         82.8    3e-15   
ref|XP_002733383.2|  PREDICTED: solute carrier family 2, facilita...  81.3    3e-15   
ref|WP_010790464.1|  Major myo-inositol transporter IolT              82.8    3e-15   
emb|CEG02078.1|  Major facilitator superfamily domain, general su...  83.2    3e-15   
ref|WP_036745963.1|  major facilitator transporter                    82.4    3e-15   
ref|XP_010686665.1|  PREDICTED: inositol transporter 4-like           83.2    3e-15   
dbj|GAN28872.1|  putative metabolite transport protein CsbC           82.8    3e-15   
ref|WP_014843330.1|  sugar:proton symporter                           82.8    3e-15   
ref|WP_027224240.1|  sugar:proton symporter                           82.8    3e-15   
sp|Q291H8.3|TRET1_DROPS  RecName: Full=Facilitated trehalose tran...  83.6    3e-15   
sp|B4GAP7.2|TRET1_DROPE  RecName: Full=Facilitated trehalose tran...  83.6    3e-15   
emb|CDL60973.1|  sugar-proton symporter                               80.9    3e-15   
ref|XP_001360559.2|  GA15593                                          83.6    4e-15   
gb|EFB42172.1|  hypothetical protein pah_c014o100                     82.4    4e-15   
ref|XP_002016109.1|  GL11419                                          83.6    4e-15   
ref|XP_003082978.1|  hexose transporter (ISS)                         83.2    4e-15   
ref|WP_020090293.1|  MFS transporter                                  82.4    4e-15   
dbj|GAK78547.1|  putative sugar transporter                           81.3    4e-15   
gb|AJT41974.1|  major facilitator transporter                         82.4    4e-15   
ref|WP_038954325.1|  hypothetical protein                             78.2    4e-15   
ref|WP_033011127.1|  hypothetical protein                             77.8    4e-15   
ref|WP_010536987.1|  MFS transporter                                  82.4    4e-15   
dbj|BAI87684.2|  hypothetical protein BSNT_10673                      81.3    4e-15   
gb|KFA22558.1|  major facilitator transporter                         77.8    5e-15   
emb|CDL51605.1|  sugar-proton symporter                               80.5    5e-15   
ref|XP_001748408.1|  hypothetical protein                             82.4    5e-15   
ref|WP_043085813.1|  major facilitator transporter                    78.2    5e-15   
ref|WP_022301214.1|  sugar porter (SP) family MFS transporter         82.0    5e-15   
sp|B4LPX5.2|TRET1_DROVI  RecName: Full=Facilitated trehalose tran...  83.2    5e-15   
ref|WP_019183278.1|  major facilitator transporter                    82.0    6e-15   
ref|XP_002050122.1|  GJ20366                                          83.2    6e-15   
ref|WP_022471577.1|  sugar porter (SP) family MFS transporter         82.0    6e-15   
ref|WP_008650091.1|  MFS transporter                                  82.0    6e-15   
gb|EES68295.2|  sugar porter (SP) family MFS transporter              82.0    6e-15   
ref|WP_032840525.1|  MFS transporter                                  82.0    6e-15   
gb|EOS00445.1|  sugar porter (SP) family MFS transporter              82.0    6e-15   
ref|WP_011109239.1|  MFS transporter                                  82.0    6e-15   
ref|WP_008760064.1|  MFS transporter                                  82.0    6e-15   
ref|WP_040679904.1|  MFS transporter                                  82.0    6e-15   
ref|WP_032813586.1|  MFS transporter                                  82.0    6e-15   
ref|WP_043090971.1|  hypothetical protein                             78.2    6e-15   
ref|XP_001986495.1|  GH21392                                          82.8    6e-15   
ref|WP_033484407.1|  MULTISPECIES: major facilitator transporter      77.8    6e-15   
gb|KGT84775.1|  hypothetical protein OC00_06535                       77.8    7e-15   
ref|XP_005704896.1|  MFS transporter, SP family, sugar:H+ symporter   82.0    7e-15   
ref|WP_039185836.1|  MFS transporter                                  81.6    7e-15   
ref|WP_039838550.1|  MFS transporter                                  81.6    7e-15   
ref|WP_040220875.1|  MFS transporter                                  81.6    7e-15   
ref|WP_026144597.1|  hypothetical protein                             77.8    7e-15   
ref|WP_024713281.1|  metabolite transporter CsbC                      81.6    8e-15   
ref|WP_038689086.1|  major facilitator transporter                    81.6    8e-15   
ref|XP_005174793.1|  PREDICTED: facilitated trehalose transporter...  81.6    8e-15   
ref|WP_042504924.1|  major facilitator transporter                    77.8    8e-15   
ref|WP_039793159.1|  MFS transporter                                  81.6    8e-15   
ref|WP_007832171.1|  major facilitator transporter                    81.6    8e-15   
ref|WP_004092209.1|  MFS transporter                                  81.6    8e-15   
gb|KJF41716.1|  MFS transporter                                       78.2    8e-15   
ref|WP_036685129.1|  MFS transporter                                  81.6    8e-15   
sp|B4KR05.2|TRET1_DROMO  RecName: Full=Facilitated trehalose tran...  82.4    8e-15   
ref|XP_002006426.1|  GI18572                                          82.4    9e-15   
ref|WP_026962475.1|  MFS transporter                                  81.3    9e-15   
ref|WP_036719265.1|  MFS transporter                                  81.3    9e-15   
ref|WP_025119916.1|  MULTISPECIES: MFS transporter                    81.3    1e-14   
ref|WP_042976872.1|  metabolite transporter CsbC                      81.3    1e-14   
ref|WP_029318579.1|  metabolite transporter CsbC                      81.3    1e-14   
ref|WP_019712602.1|  major facilitator transporter                    81.3    1e-14   
ref|WP_033882801.1|  MULTISPECIES: metabolite transporter CsbC        81.3    1e-14   
ref|WP_015715023.1|  major facilitator transporter                    81.3    1e-14   
ref|WP_036593689.1|  sugar transporter                                81.3    1e-14   
ref|WP_015385124.1|  putative sugar transporter                       81.3    1e-14   
ref|WP_003227045.1|  major facilitator transporter                    81.3    1e-14   
ref|WP_014478492.1|  major facilitator transporter                    81.3    1e-14   
ref|WP_038700702.1|  MFS transporter                                  81.3    1e-14   
ref|WP_024610330.1|  major facilitator transporter                    81.3    1e-14   
ref|WP_043858362.1|  metabolite transporter CsbC                      81.3    1e-14   
gb|KIU10011.1|  sugar transporter                                     80.9    1e-14   
ref|WP_033184756.1|  major facilitator transporter                    81.3    1e-14   
ref|WP_003244055.1|  major facilitator transporter                    81.3    1e-14   
ref|WP_006990987.1|  D-xylose-proton symporter                        81.3    1e-14   
ref|WP_041767588.1|  major facilitator transporter                    81.3    1e-14   
ref|WP_017723977.1|  major facilitator transporter                    81.3    1e-14   
ref|XP_002777372.1|  hexose transporter, putative                     79.7    1e-14   
ref|WP_024594228.1|  major facilitator transporter                    81.3    1e-14   
ref|XP_002091187.1|  GE12373                                          82.0    1e-14   
ref|WP_035078795.1|  hypothetical protein                             81.3    1e-14   
ref|WP_037505586.1|  sugar:proton symporter                           81.3    1e-14   



>ref|NP_001190922.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86496.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=542

 Score =   223 bits (567),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  425  HAVLSTVSVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  484

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YA+VC ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  485  VLLKSIGLAGVFGMYAIVCCISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  542



>ref|XP_009595864.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595865.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595866.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
Length=738

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+ST+CVILYFC FV GYGPIPNILCAEIFPTRVRG CIAICALVFWICDVIVTY+L
Sbjct  620  AHAVVSTVCVILYFCFFVTGYGPIPNILCAEIFPTRVRGLCIAICALVFWICDVIVTYTL  679

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GLAGVFGIYAVVCVISW FVFLRVPETKGMPLEVITEFFAVGARQA MAK+E
Sbjct  680  PVMLSSIGLAGVFGIYAVVCVISWFFVFLRVPETKGMPLEVITEFFAVGARQAAMAKHE  738



>dbj|BAH57059.1| AT4G35300 [Arabidopsis thaliana]
Length=585

 Score =   222 bits (566),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  468  HAVLSTVSVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  527

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YA+VC ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  528  VLLKSIGLAGVFGMYAIVCCISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  585



>ref|XP_009796447.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796448.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796450.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=738

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+ST+CVILYFC FV GYGPIPNILCAEIFPTRVRG CIAICALVFWICDVIVTY+L
Sbjct  620  AHAVVSTVCVILYFCFFVTGYGPIPNILCAEIFPTRVRGLCIAICALVFWICDVIVTYTL  679

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML S+GLAGVFGIYAVVCVISW FVFLRVPETKGMPLEVITEFFAVGARQA MAK+E
Sbjct  680  PVMLRSIGLAGVFGIYAVVCVISWFFVFLRVPETKGMPLEVITEFFAVGARQAAMAKHE  738



>ref|XP_006342166.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342167.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=737

 Score =   222 bits (566),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+STICVILYFC FV GYGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTY+L
Sbjct  619  AHAVVSTICVILYFCFFVTGYGPIPNILCSEIFPTRVRGLCIAICALVFWICDVIVTYTL  678

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+S+GL+GVFGIYA+VCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA +AK+E
Sbjct  679  PVMLNSIGLSGVFGIYAIVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAAIAKHE  737



>ref|XP_011100175.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=740

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 116/121 (96%), Gaps = 2/121 (2%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+STICV++YFC+FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTY+L
Sbjct  620  AHAVISTICVVIYFCTFVMGYGPIPNILCSEIFPTRVRGICIAICALVFWICDVIVTYTL  679

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM--AKN  405
            PVMLSS+GLAGVFGIYAVVCV+SWIF+FLRVPETKGMPLEVITEFFAVGA+QA    AKN
Sbjct  680  PVMLSSIGLAGVFGIYAVVCVVSWIFIFLRVPETKGMPLEVITEFFAVGAKQAAAGSAKN  739

Query  406  E  408
            E
Sbjct  740  E  740



>gb|EYU43534.1| hypothetical protein MIMGU_mgv1a001953mg [Erythranthe guttata]
Length=734

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA++ST CV++YFC+FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTYSL
Sbjct  616  AHAIISTTCVVIYFCTFVMGYGPIPNILCSEIFPTRVRGICIAICALVFWICDVIVTYSL  675

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GLAGVFGIYAVVCVISW+F+FLRVPETKGMPLEVITEFFAVGA+Q+  AK E
Sbjct  676  PVMLSSIGLAGVFGIYAVVCVISWVFIFLRVPETKGMPLEVITEFFAVGAKQSAAAKGE  734



>gb|EYU43535.1| hypothetical protein MIMGU_mgv1a002513mg [Erythranthe guttata]
Length=665

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 115/119 (97%), Gaps = 2/119 (2%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+ST+CVI+YFC+FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTYSL
Sbjct  549  AHAVISTVCVIVYFCTFVMGYGPIPNILCSEIFPTRVRGICIAICALVFWICDVIVTYSL  608

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GLAGVFGIYAVVCVISW+F+FLRVPETKGMPLEVITEFFAVGA+Q   AK+E
Sbjct  609  PVMLSSIGLAGVFGIYAVVCVISWVFIFLRVPETKGMPLEVITEFFAVGAKQG--AKSE  665



>gb|EPS65490.1| hypothetical protein M569_09283 [Genlisea aurea]
Length=734

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+STICV++YFC+FVMGYGPIPNILC+EIFPTRVRG  IAIC+LVFWICDVIVTY+L
Sbjct  615  AHAVVSTICVVIYFCTFVMGYGPIPNILCSEIFPTRVRGIAIAICSLVFWICDVIVTYTL  674

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GLAGVFGIYAVVC ISW+F+FLRVPETKGMPLEVITEFFAVGA+Q E +KN+
Sbjct  675  PVMLSSIGLAGVFGIYAVVCAISWVFIFLRVPETKGMPLEVITEFFAVGAKQIEESKNQ  733



>gb|ABK29441.1| sugar transport protein, partial [Coffea canephora]
Length=290

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+ST+CV+LYFC FVMGYGP+PNILCAEIFPTRVRG CIAIC+LV+WICDVIVTY+L
Sbjct  175  AHAVMSTLCVVLYFCCFVMGYGPVPNILCAEIFPTRVRGLCIAICSLVYWICDVIVTYTL  234

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            PV+LSS+GLAGVFGIYAVVCVISW+FVFLRVPETKGMPLEVITEFFAVGA++
Sbjct  235  PVLLSSIGLAGVFGIYAVVCVISWVFVFLRVPETKGMPLEVITEFFAVGAKK  286



>ref|NP_849565.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001190923.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AAM19835.1| AT4g35300/F23E12_140 [Arabidopsis thaliana]
 gb|AEE86493.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86497.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=739

 Score =   218 bits (556),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  622  HAVLSTVSVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YA+VC ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  682  VLLKSIGLAGVFGMYAIVCCISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  739



>ref|NP_195256.3| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001154287.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 sp|Q8LPQ8.2|MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2; AltName: Full=Sugar 
transporter MSSP2 [Arabidopsis thaliana]
 emb|CAA18739.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAB80247.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAD58692.1| monosaccharide sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86494.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86495.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=729

 Score =   218 bits (554),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  612  HAVLSTVSVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  671

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YA+VC ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  672  VLLKSIGLAGVFGMYAIVCCISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  729



>ref|NP_001289848.1| monosaccharide-sensing protein 2 [Solanum lycopersicum]
 dbj|BAO96237.1| tonoplast monosaccharide transporter 2 [Solanum lycopersicum]
Length=738

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 115/120 (96%), Gaps = 1/120 (1%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+STICVILYFC FV GYGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTY+L
Sbjct  619  AHAVVSTICVILYFCFFVTGYGPIPNILCSEIFPTRVRGLCIAICALVFWICDVIVTYTL  678

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ-AEMAKNE  408
            PVML+S+GL+GVFGIYA+VCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ A +AK+E
Sbjct  679  PVMLNSIGLSGVFGIYAIVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAAAIAKHE  738



>gb|KJB14186.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=524

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST CVI+YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  407  NAAISTACVIVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  466

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAG+FGIYAVVC+ISW+FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  467  VMLSSIGLAGIFGIYAVVCLISWVFVFLKVPETKGMPLEVITEFFAVGARQAGATKNE  524



>gb|KHN20087.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=712

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA +ST+CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSL
Sbjct  594  AHAAISTVCVVVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSL  653

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GL GVF IYAVVC ISWIFVFL+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  654  PVMLSSLGLGGVFAIYAVVCFISWIFVFLKVPETKGMPLEVISEFFSVGAKQAASAKNE  712



>gb|ABR25915.1| sugar transporter type 2a [Oryza sativa Indica Group]
Length=178

 Score =   198 bits (503),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LSTI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSL
Sbjct  61   AHAALSTISVIIYFCCFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSL  120

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            PVML+++GLAGVFGIYAVVC I+++FVFL+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  121  PVMLNAIGLAGVFGIYAVVCSIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQATK  177



>ref|XP_003527273.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581130.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
Length=737

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA +ST+CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSL
Sbjct  619  AHAAISTVCVVVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSL  678

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GL GVF IYAVVC ISWIFVFL+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  679  PVMLSSLGLGGVFAIYAVVCFISWIFVFLKVPETKGMPLEVISEFFSVGAKQAASAKNE  737



>emb|CDP07261.1| unnamed protein product [Coffea canephora]
Length=737

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+ST+CV+LYFC FVMGYGP+PNILCAEIFPTRVRG CIAIC+LV+WICDVIVTY+L
Sbjct  622  AHAVMSTLCVVLYFCCFVMGYGPVPNILCAEIFPTRVRGLCIAICSLVYWICDVIVTYTL  681

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            PV+LSS+GLAGVFGIYAVVCVISW+FVFLRVPETKGMPLEVITEFFAVGA++
Sbjct  682  PVLLSSIGLAGVFGIYAVVCVISWVFVFLRVPETKGMPLEVITEFFAVGAKK  733



>ref|XP_007135975.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
 gb|ESW07969.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
Length=736

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSLP
Sbjct  619  HAAISTTCVVVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GL GVF IYAVVC ISWIFVFL+VPETKGMPLEVI+EFF+VGARQA  AKNE
Sbjct  679  VMLSSLGLGGVFAIYAVVCFISWIFVFLKVPETKGMPLEVISEFFSVGARQAATAKNE  736



>ref|XP_004500833.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500834.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=736

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+CV++YFC FVM YGPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLP
Sbjct  619  HAAISTVCVVVYFCFFVMAYGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GL+GVFG+YAVVC+ISWIFV+L+VPETKGMPLEVITEFF+VG++QA  AKNE
Sbjct  679  VMLSSLGLSGVFGVYAVVCLISWIFVYLKVPETKGMPLEVITEFFSVGSKQAASAKNE  736



>gb|KJB77473.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=523

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIA+CAL FWICD+IVTYSLP
Sbjct  406  HAAISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGICIAMCALTFWICDIIVTYSLP  465

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVCVISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  466  VLLKSVGLAGVFGMYAVVCVISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKNN  523



>ref|XP_002867077.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43336.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FW+CD+IVTYSLP
Sbjct  622  HAVLSTVSVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWVCDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YA+VC ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  682  VLLKSIGLAGVFGMYAIVCCISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  739



>ref|XP_003603868.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74119.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=730

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLP
Sbjct  613  HAAISTVCVVVYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIVTYSLP  672

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAGVFG+YA+VC ISW+FV+L+VPETKGMPLEVITEFF+VG++Q+  AKNE
Sbjct  673  VMLSSLGLAGVFGVYAIVCCISWVFVYLKVPETKGMPLEVITEFFSVGSKQSAAAKNE  730



>ref|XP_003603869.1| Monosaccharide-sensing protein [Medicago truncatula]
Length=689

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLP
Sbjct  572  HAAISTVCVVVYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIVTYSLP  631

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAGVFG+YA+VC ISW+FV+L+VPETKGMPLEVITEFF+VG++Q+  AKNE
Sbjct  632  VMLSSLGLAGVFGVYAIVCCISWVFVYLKVPETKGMPLEVITEFFSVGSKQSAAAKNE  689



>ref|XP_006577928.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=738

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA +ST+CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSL
Sbjct  620  AHAAISTVCVVVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSL  679

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML S+GL GVF IYAVVC ISWIFVFL+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  680  PVMLGSLGLGGVFAIYAVVCFISWIFVFLKVPETKGMPLEVISEFFSVGAKQAASAKNE  738



>gb|KJB14185.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=691

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST CVI+YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  574  NAAISTACVIVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  633

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAG+FGIYAVVC+ISW+FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  634  VMLSSIGLAGIFGIYAVVCLISWVFVFLKVPETKGMPLEVITEFFAVGARQAGATKNE  691



>gb|KHN33775.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=737

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA +ST+CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSL
Sbjct  619  AHAAISTVCVVVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSL  678

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML S+GL GVF IYAVVC ISWIFVFL+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  679  PVMLGSLGLGGVFAIYAVVCFISWIFVFLKVPETKGMPLEVISEFFSVGAKQAASAKNE  737



>gb|KJB14177.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14178.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14179.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14180.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14181.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14184.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=739

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST CVI+YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  622  NAAISTACVIVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAG+FGIYAVVC+ISW+FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  682  VMLSSIGLAGIFGIYAVVCLISWVFVFLKVPETKGMPLEVITEFFAVGARQAGATKNE  739



>gb|KHG10189.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST CVI+YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  622  NAAISTACVIVYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAG+FGIYAVVC+ISW+FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  682  VMLSSIGLAGIFGIYAVVCLISWVFVFLKVPETKGMPLEVITEFFAVGARQAGATKNE  739



>ref|XP_007043079.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
 gb|EOX98910.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
Length=739

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  622  HAAISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWICDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVCVISW+FVFL+VPETKGMPLEVITEFF+VGARQ   AKN 
Sbjct  682  VLLKSVGLAGVFGMYAVVCVISWVFVFLKVPETKGMPLEVITEFFSVGARQVAAAKNN  739



>ref|XP_004289029.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011461449.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   209 bits (531),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 92/116 (79%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STI V+LYFC+FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  641  NATISTISVVLYFCTFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  700

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            ++L+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFFAVGA+QAEMA+
Sbjct  701  ILLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFAVGAKQAEMAE  756



>ref|XP_010061214.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW68134.1| hypothetical protein EUGRSUZ_F01805 [Eucalyptus grandis]
Length=735

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST CVI+YFC FVM YGP+PNILC+EIFPTRVRG CIAICALV+WICD+IVTY+LP
Sbjct  618  NAIISTACVIIYFCCFVMAYGPVPNILCSEIFPTRVRGLCIAICALVYWICDIIVTYTLP  677

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLS+ GLAG+FGIYAVVCVISW+FVFL+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  678  VMLSAFGLAGIFGIYAVVCVISWVFVFLKVPETKGMPLEVITEFFSVGARQVAAAKNE  735



>ref|XP_011074068.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011074069.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=739

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+STICV++YFC+FVMGYGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTY+L
Sbjct  621  AHAVISTICVVIYFCTFVMGYGPIPNILCSEIFPTRVRGICIAICALVFWICDVIVTYTL  680

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GLAGVFGIYAVVCVISWIF+FLRVPETKGMPLEVITEFFAVGA+QA  AK+E
Sbjct  681  PVMLSSIGLAGVFGIYAVVCVISWIFIFLRVPETKGMPLEVITEFFAVGAKQAAAAKHE  739



>ref|XP_008358445.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=256

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  139  NASVSTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  198

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML S+GLAGVFG+YAVV VI++IF+FL+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  199  VMLKSVGLAGVFGMYAVVSVIAFIFIFLKVPETKGMPLEVITEFFSVGAKQASAAKNN  256



>emb|CDP01766.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAV+STI V++YFC FVMG+GP+PNILCAEIFPTR RG CIAICALVFWICD+IVTYSL
Sbjct  607  AHAVVSTISVVVYFCCFVMGFGPVPNILCAEIFPTRTRGLCIAICALVFWICDIIVTYSL  666

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            PVMLSS+GLAGVFGIYAVVC ISW+FVFL+VPETKGMPLEVITEFFAVGA+Q
Sbjct  667  PVMLSSIGLAGVFGIYAVVCAISWVFVFLKVPETKGMPLEVITEFFAVGAKQ  718



>ref|XP_010446942.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446943.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446944.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
Length=739

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  622  HAVLSTVSVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVC ISW+FVF++VPETKGMPLEVITEFF++GARQAE AK++
Sbjct  682  VLLKSVGLAGVFGMYAVVCCISWVFVFIKVPETKGMPLEVITEFFSLGARQAEAAKHD  739



>gb|KJB79729.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=526

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  409  HASISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWICDIIVTYSLP  468

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            ++L S+GLAGVFG+YAVVCVISW+FVFL+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  469  LLLKSVGLAGVFGMYAVVCVISWVFVFLKVPETKGMPLEVITEFFAVGAKQIAATKDN  526



>gb|AJO70165.1| tonoplast monosaccharide transporters 1 [Camellia sinensis]
Length=736

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
             AV+STICV++YFC FV GYGP+PNILCAEIFPTRVRG CI ICALV+WI D+IVTYSLP
Sbjct  619  EAVISTICVVVYFCCFVTGYGPVPNILCAEIFPTRVRGLCITICALVYWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L+S+GL GVFGIYA+VCVISWIF++L+VPETKGMPLEVITEFFAVGARQAE AK E
Sbjct  679  VLLTSIGLDGVFGIYAIVCVISWIFIYLKVPETKGMPLEVITEFFAVGARQAEAAKTE  736



>ref|XP_007018122.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
 gb|EOY15347.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
Length=740

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST CVI+YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  623  NAAISTACVIIYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAGVFGIYAVVCVIS +FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  683  VMLSSIGLAGVFGIYAVVCVISLVFVFLKVPETKGMPLEVITEFFAVGARQAAATKNE  740



>ref|XP_007018119.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018120.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018121.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15344.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15345.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15346.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
Length=739

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST CVI+YFC FVMGYGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  622  NAAISTACVIIYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAGVFGIYAVVCVIS +FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  682  VMLSSIGLAGVFGIYAVVCVISLVFVFLKVPETKGMPLEVITEFFAVGARQAAATKNE  739



>gb|KHG04802.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22590.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=690

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIA+CAL FWICD+IVTYSLP
Sbjct  573  HAAISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAMCALTFWICDIIVTYSLP  632

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVCVISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  633  VLLKSVGLAGVFGMYAVVCVISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKNN  690



>ref|XP_010432297.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
 ref|XP_010432298.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  622  HAVLSTVSVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YA+VC ISW+FVF++VPETKGMPLEVITEFF++GARQAE AK++
Sbjct  682  VLLKSVGLAGVFGMYAIVCCISWVFVFIKVPETKGMPLEVITEFFSLGARQAEAAKHD  739



>gb|KHG04801.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22589.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=740

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIA+CAL FWICD+IVTYSLP
Sbjct  623  HAAISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAMCALTFWICDIIVTYSLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVCVISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  683  VLLKSVGLAGVFGMYAVVCVISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKNN  740



>gb|KDO68402.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68403.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68404.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=732

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLP
Sbjct  615  HASISTVSVVLYFCCFVMGFGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L+S+GLAGVFG+YAVVCVISWIFVF++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  675  VLLNSVGLAGVFGMYAVVCVISWIFVFIKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>ref|XP_006486570.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486571.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Citrus 
sinensis]
Length=732

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLP
Sbjct  615  HASISTVSVVLYFCCFVMGFGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L+S+GLAGVFG+YAVVCVISWIFVF++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  675  VLLNSVGLAGVFGMYAVVCVISWIFVFIKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>ref|XP_008373385.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=739

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST CVI+YFC FVM YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTYSLP
Sbjct  622  HAVLSTTCVIVYFCVFVMAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML SMGL+G FGIYA VCVIS++F+FL+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  682  VMLDSMGLSGAFGIYAAVCVISFVFIFLKVPETKGMPLEVITEFFSVGARQVAAAKNE  739



>emb|CDY65623.1| BnaCnng48010D [Brassica napus]
Length=675

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  558  HAVLSTVSVVLYFCFFVMGFGPTPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  617

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVC ISW FV+L+VPETKGMPLEVITEFF++GARQAE  KN 
Sbjct  618  VLLKSIGLAGVFGMYAVVCCISWAFVYLKVPETKGMPLEVITEFFSLGARQAEAEKNN  675



>emb|CDX69128.1| BnaC01g03250D [Brassica napus]
Length=683

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  566  HAVLSTVSVVLYFCFFVMGFGPTPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  625

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVC ISW FV+L+VPETKGMPLEVITEFF++GARQAE  KN 
Sbjct  626  VLLKSIGLAGVFGMYAVVCCISWAFVYLKVPETKGMPLEVITEFFSLGARQAEAEKNN  683



>gb|KJB77472.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
 gb|KJB77475.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=740

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIA+CAL FWICD+IVTYSLP
Sbjct  623  HAAISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGICIAMCALTFWICDIIVTYSLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVCVISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  683  VLLKSVGLAGVFGMYAVVCVISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKNN  740



>ref|XP_006422393.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
 gb|ESR35633.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
Length=732

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLP
Sbjct  615  HASISTVSVVLYFCCFVMGFGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVCVISWIFVF++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  675  VLLKSVGLAGVFGMYAVVCVISWIFVFIKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>gb|ABK29442.1| sugar transport protein, partial [Coffea canephora]
Length=134

 Score =   191 bits (485),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
             +A +ST+CV+LYFC FVMG+GP+PNILC+EIFPTRVRG CIA+C L +WI D+IVTY+L
Sbjct  15   GNAAVSTVCVVLYFCFFVMGFGPVPNILCSEIFPTRVRGVCIALCCLTYWIGDIIVTYTL  74

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA-EMAKNE  408
            PVMLSSMGL GVFG YAVVC+ISW F FL+VPETKGMPLEVI+EFF+VGARQA  +AKN 
Sbjct  75   PVMLSSMGLGGVFGTYAVVCIISWFFAFLKVPETKGMPLEVISEFFSVGARQAVAIAKNN  134



>ref|XP_006283193.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 ref|XP_006283194.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16091.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16092.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
Length=740

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  623  HAVLSTVSVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            V+L S+GLAGVFG+YA+VC ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AK
Sbjct  683  VLLKSIGLAGVFGMYAIVCCISWVFVFMKVPETKGMPLEVITEFFSVGARQAEAAK  738



>ref|XP_010094525.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB56279.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=739

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST+CV++YFC F M YGPIPNILC+EIFPTRVRG CIAICALVFW+ D+IVTY+LP
Sbjct  622  HAVISTVCVVVYFCCFAMAYGPIPNILCSEIFPTRVRGLCIAICALVFWVGDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLSS+GLAG+FGIYA+VC+ISWIFVFL+VPETKGMPLEVITEFFA+GAR+   AK +
Sbjct  682  VMLSSIGLAGIFGIYAIVCIISWIFVFLKVPETKGMPLEVITEFFAIGAREVAEAKKD  739



>ref|XP_009103100.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 ref|XP_009103156.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 emb|CDX75492.1| BnaA01g02100D [Brassica napus]
Length=740

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  623  HAVLSTVSVVLYFCFFVMGFGPTPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YAVVC ISW FV+L VPETKGMPLEVITEFF+VGARQAE  KN 
Sbjct  683  VLLKSIGLAGVFGMYAVVCCISWAFVYLEVPETKGMPLEVITEFFSVGARQAEAEKNN  740



>ref|XP_008237926.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=739

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTICVI+YFC FVM YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTYSLP
Sbjct  622  HAALSTICVIIYFCVFVMAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
             +L S+GLAGVFGIYAVVCVIS+IF+FL+VPETKGMPLEVITEFFAVGARQ   AK+E
Sbjct  682  DLLDSIGLAGVFGIYAVVCVISFIFIFLKVPETKGMPLEVITEFFAVGARQVAAAKSE  739



>emb|CBI21577.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA++ST+ V++YFC FVM +GPIPNILC+EIFPTRVRG CIA+CAL FWICD+IVTYSLP
Sbjct  509  HAIISTVSVVVYFCCFVMAFGPIPNILCSEIFPTRVRGLCIAVCALTFWICDIIVTYSLP  568

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM-AKNE  408
            VMLSS+GLAGVFGIYA+VC++SWIFVFL+VPETKGMPLEVI+EFFAVGA+QA   AKN 
Sbjct  569  VMLSSVGLAGVFGIYAIVCILSWIFVFLKVPETKGMPLEVISEFFAVGAKQAATDAKNN  627



>dbj|BAJ87413.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  315  HAVLSTVSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGVCIAICALTFWICDIIVTYSLP  374

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML+++GLAGVFGIYA+VC I+++FV+L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  375  VMLNAIGLAGVFGIYAIVCCIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAQ  427



>ref|XP_004500684.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500685.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI V++YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSL
Sbjct  622  ANASISTISVVIYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYSL  681

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+SMGL GVFG+YAVVC I+W+FV+L+VPETKGMPLEVI EFF+VGA+QAE AK+ 
Sbjct  682  PVMLNSMGLGGVFGLYAVVCFIAWVFVYLKVPETKGMPLEVIIEFFSVGAKQAETAKHN  740



>ref|XP_010090703.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB40422.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=740

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST  V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  623  HATISTASVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML ++GLAGVFG+YAVVC+ISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN+
Sbjct  683  VMLKAVGLAGVFGMYAVVCIISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKND  740



>ref|XP_010266257.1| PREDICTED: monosaccharide-sensing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA+LSTI V++YFC FV G+GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTY+LP
Sbjct  626  HAILSTISVVVYFCCFVTGFGPIPNILCSEIFPTRVRGVCIAICALVFWIGDIIVTYTLP  685

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML+S+GLAGVFGIYAVVC ISW+FVFL+VPETKGMPLEVITEFFAVGARQA  AKN+
Sbjct  686  VMLTSIGLAGVFGIYAVVCCISWVFVFLKVPETKGMPLEVITEFFAVGARQA-AAKND  742



>gb|EYU30848.1| hypothetical protein MIMGU_mgv1a001984mg [Erythranthe guttata]
Length=730

 Score =   203 bits (517),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 90/117 (77%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST  VI+YFC+FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  613  HAVISTGSVIVYFCTFVMGFGPVPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLP  672

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+L+S+GL GVFGIYA VC ++W FV+L+VPETKGMPLEVITEFFAVGA+Q+  A+N
Sbjct  673  VLLNSIGLGGVFGIYAAVCTVAWFFVYLKVPETKGMPLEVITEFFAVGAKQSLAAEN  729



>emb|CBI40753.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST CVI+YFC FV  YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  545  HAAISTACVIIYFCCFVTAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  604

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML+S+GL G+FGIYAVVCVISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  605  VMLTSIGLTGIFGIYAVVCVISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  662



>ref|XP_002276373.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37149.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=742

 Score =   203 bits (517),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA++ST+ V++YFC FVM +GPIPNILC+EIFPTRVRG CIA+CAL FWICD+IVTYSLP
Sbjct  624  HAIISTVSVVVYFCCFVMAFGPIPNILCSEIFPTRVRGLCIAVCALTFWICDIIVTYSLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM-AKNE  408
            VMLSS+GLAGVFGIYA+VC++SWIFVFL+VPETKGMPLEVI+EFFAVGA+QA   AKN 
Sbjct  684  VMLSSVGLAGVFGIYAIVCILSWIFVFLKVPETKGMPLEVISEFFAVGAKQAATDAKNN  742



>ref|XP_010437493.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   203 bits (517),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST  V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  622  HAVLSTASVVLYFCFFVMGFGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            V+L S+GLAGVFG+YA+VC ISW+FVF++VPETKGMPLEVITEFF++GARQAE AK
Sbjct  682  VLLKSVGLAGVFGMYAIVCCISWVFVFIKVPETKGMPLEVITEFFSLGARQAEAAK  737



>gb|AAX47312.1| hexose transporter 6 [Vitis vinifera]
Length=740

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST CVI+YFC FV  YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  623  HAAISTACVIIYFCCFVTAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML+S+GL G+FGIYAVVCVISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  683  VMLTSIGLTGIFGIYAVVCVISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>gb|KJB79728.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=739

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  622  HASISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWICDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            ++L S+GLAGVFG+YAVVCVISW+FVFL+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  682  LLLKSVGLAGVFGMYAVVCVISWVFVFLKVPETKGMPLEVITEFFAVGAKQIAATKDN  739



>gb|AIQ77649.1| tonoplastic transporter 1 [Vitis vinifera]
Length=740

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST CVI+YFC FV  YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  623  HAAISTACVIIYFCCFVTAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML+S+GL G+FGIYAVVCVISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  683  VMLTSIGLTGIFGIYAVVCVISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>gb|KHG05233.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  622  HASISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWICDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            ++L S+GLAGVFG+YAVVCVISW+FVFL+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  682  LLLKSVGLAGVFGMYAVVCVISWVFVFLKVPETKGMPLEVITEFFAVGAKQIAATKDN  739



>emb|CAN59780.1| hypothetical protein VITISV_024656 [Vitis vinifera]
Length=740

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST CVI+YFC FV  YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  623  HAAISTACVIIYFCCFVTAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML+S+GL G+FGIYAVVCVISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  683  VMLTSIGLTGIFGIYAVVCVISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>ref|NP_001267873.1| hexose transporter-like [Vitis vinifera]
 gb|AAY40466.1| putative hexose transporter [Vitis vinifera]
 gb|ADP37147.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=740

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST CVI+YFC FV  YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  623  HAAISTACVIIYFCCFVTAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML+S+GL G+FGIYAVVCVISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  683  VMLTSIGLTGIFGIYAVVCVISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>ref|XP_010680636.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   202 bits (515),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI V++YFC FVMG+GPIPNILC+EIFPTRVRG CIAIC+L FW  D+IVTYSLP
Sbjct  611  HATLSTISVVVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICSLTFWFGDIIVTYSLP  670

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
             +LSS+GLAGVFGIYAVVC++SW FV+  VPETKGMPLEVI+EFF VGARQAE  KN
Sbjct  671  ALLSSIGLAGVFGIYAVVCIVSWFFVYFMVPETKGMPLEVISEFFNVGARQAEAEKN  727



>ref|XP_010066352.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066353.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066354.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066355.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW64228.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=740

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST+ V+LYFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D++VTYSLP
Sbjct  623  HAVISTVSVVLYFCFFVMGFGPVPNILCAEIFPTRVRGLCIAICALTFWIGDIVVTYSLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML S+GLAGVFG+YA+VC+ISW FVF++VPETKGMPLEVITEFF+VGARQA  A+N 
Sbjct  683  VMLKSVGLAGVFGMYAIVCLISWGFVFMKVPETKGMPLEVITEFFSVGARQAVAARNN  740



>gb|KCW64229.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=739

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST+ V+LYFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D++VTYSLP
Sbjct  622  HAVISTVSVVLYFCFFVMGFGPVPNILCAEIFPTRVRGLCIAICALTFWIGDIVVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML S+GLAGVFG+YA+VC+ISW FVF++VPETKGMPLEVITEFF+VGARQA  A+N 
Sbjct  682  VMLKSVGLAGVFGMYAIVCLISWGFVFMKVPETKGMPLEVITEFFSVGARQAVAARNN  739



>ref|XP_007210337.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 ref|XP_007210338.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11536.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11537.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
Length=739

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LS ICVI+YFC FVM YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LP
Sbjct  622  HAALSVICVIVYFCCFVMAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAG+FGIYAVVCVIS+IF+FL+VPETKGMPLEVITEFFAVGARQ   AK+E
Sbjct  682  VLLDSIGLAGIFGIYAVVCVISFIFIFLKVPETKGMPLEVITEFFAVGARQVAAAKSE  739



>ref|XP_011098017.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098018.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098019.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=711

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST+ VI+YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  594  HAVISTVSVIVYFCCFVMGFGPIPNILCSEIFPTRVRGICIAICALTFWIGDIIVTYSLP  653

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ-AEMAKN  405
            VML+S+GLAGVF IYAVVC I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q A  AKN
Sbjct  654  VMLNSIGLAGVFSIYAVVCTIAWVFVFLKVPETKGMPLEVITEFFAVGAKQTAASAKN  711



>ref|XP_007137297.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
 gb|ESW09291.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
Length=739

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+L
Sbjct  619  ANASISTISVIVYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTL  678

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            PVML+S+GLAGVFGIYAVVC I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK
Sbjct  679  PVMLNSIGLAGVFGIYAVVCFIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQVDDAK  735



>ref|XP_006343319.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343320.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=722

 Score =   200 bits (509),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 87/112 (78%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST+ V++YFC+FVMG+GPIPNILC+EIFPT VRG CIAICAL FWI D+IVTYSLP
Sbjct  608  HAVISTVSVVVYFCTFVMGFGPIPNILCSEIFPTSVRGICIAICALTFWIGDIIVTYSLP  667

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            +ML+S+GL GVF IYAVVC ++W+FVFL+VPETKGMPLEVITEFFAVGA++A
Sbjct  668  IMLNSIGLGGVFAIYAVVCAVAWVFVFLKVPETKGMPLEVITEFFAVGAKRA  719



>ref|XP_003604104.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74355.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=744

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI V++YFCSFVMG+GP+PNILCAEIFPTRVRG CIAICAL FWICD+IVTYSL
Sbjct  622  ANASISTISVVVYFCSFVMGFGPVPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYSL  681

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+S+GL GVFG+YAVVC I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  682  PVMLNSVGLGGVFGLYAVVCCIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQIDAAKHN  740



>gb|KDO85210.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=523

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  58   AVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPV  237
            A +ST CVI+YFC FV  YGPIPNILCAEIFPT+VRG CIAICA+ +WICD+IVTY+LPV
Sbjct  409  AGISTACVIIYFCCFVAAYGPIPNILCAEIFPTKVRGICIAICAMAYWICDIIVTYTLPV  468

Query  238  MLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            MLSS+GLAG FG+YAVVC ISW+FVFLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  469  MLSSIGLAGAFGVYAVVCFISWVFVFLRVPETKGMPLEVITEFFAVGARQATKAD  523



>emb|CDI66591.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   200 bits (509),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAVLST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSL
Sbjct  629  AHAVLSTVSVIIYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSL  688

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            PVML+++GLAGVFGIYAVVC+I+++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  689  PVMLNAIGLAGVFGIYAVVCLIAFVFVFLKVPETKGMPLEVITEFFAVGAKQA  741



>ref|XP_003526737.1| PREDICTED: monosaccharide-sensing protein 2-like isoform 1 [Glycine 
max]
Length=738

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+L
Sbjct  620  ANASISTISVIVYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTL  679

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+S+GLAGVFGIYAV C I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  680  PVMLNSLGLAGVFGIYAVACFIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQVDDAKHN  738



>ref|XP_008464819.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464820.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464821.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464822.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
Length=729

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STICV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFW  D+IVTYSLP
Sbjct  612  NAAISTICVVVYFCIFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWTGDIIVTYSLP  671

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VMLS++GLAGVFGIYAVVC+ISWIFV+L+VPETKGMPLEVI EFF+VGARQA
Sbjct  672  VMLSAIGLAGVFGIYAVVCIISWIFVYLKVPETKGMPLEVIAEFFSVGARQA  723



>ref|XP_003543932.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=734

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+L
Sbjct  616  ANASISTISVIVYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTL  675

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+S+GLAGVFGIYAVVC I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  676  PVMLNSVGLAGVFGIYAVVCFIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQFDDAKHN  734



>gb|KHN19961.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=723

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+L
Sbjct  605  ANASISTISVIVYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTL  664

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+S+GLAGVFGIYAV C I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  665  PVMLNSLGLAGVFGIYAVACFIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQVDDAKHN  723



>gb|EMS49950.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=686

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  570  HAVLSTVSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGVCIAICALTFWICDIIVTYSLP  629

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML+++GLAGVFGIYAVVC I+++FV+L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  630  VMLNAIGLAGVFGIYAVVCCIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAQ  682



>ref|NP_001280690.1| monosaccharide-sensing protein 2-like [Solanum lycopersicum]
 dbj|BAO96236.1| tonoplast monosaccharide transporter 1 [Solanum lycopersicum]
Length=725

 Score =   199 bits (507),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 88/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST  V++YFC+FVMG+GPIPNILC+EIFPT VRG CIAICAL FWI D+IVTYSLP
Sbjct  611  HAVISTASVVVYFCTFVMGFGPIPNILCSEIFPTSVRGICIAICALTFWIGDIIVTYSLP  670

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+S+GL GVF IYAVVC ++W+FVFL+VPETKGMPLEVITEFFAVGA++A
Sbjct  671  VMLNSIGLGGVFAIYAVVCAVAWVFVFLKVPETKGMPLEVITEFFAVGAKKA  722



>gb|KHN33643.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=734

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+L
Sbjct  616  ANASISTISVIVYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTL  675

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+S+GLAGVFGIYAVVC I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  676  PVMLNSVGLAGVFGIYAVVCFIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQFDDAKHN  734



>emb|CAN64713.1| hypothetical protein VITISV_043728 [Vitis vinifera]
Length=120

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 2/117 (2%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST  VI+YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  6    HAAISTASVIIYFCCFVMGFGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLP  65

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVFG+YAVVC+ISW+FVFL+VPETKGMPLEVI+EFFAVG+   +  KN
Sbjct  66   LMLTSVGLAGVFGMYAVVCLISWVFVFLKVPETKGMPLEVISEFFAVGSSAGQ--KN  120



>ref|XP_009359630.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STI V++YFC+FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  625  NATISTISVVVYFCTFVMGFGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLP  684

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  685  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  741



>ref|XP_006647093.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647094.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Oryza 
brachyantha]
Length=746

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  630  HAALSTVSVIIYFCCFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLP  689

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            VML+++GLAGVFGIYAVVC+I+++FVFL+VPETKGMPLEVITEFFAVGA+Q + AK
Sbjct  690  VMLNAIGLAGVFGIYAVVCLIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQAAK  745



>ref|XP_009359631.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=742

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STI V++YFC+FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  NATISTISVVVYFCTFVMGFGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  684  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  740



>ref|XP_009359629.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=753

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STI V++YFC+FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  635  NATISTISVVVYFCTFVMGFGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLP  694

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  695  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  751



>ref|XP_010686712.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=735

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+S ICVI+YFC+FVM YGPIPNILC+EIFPTRVRG CIAIC LVFWICD+IVTYSLP
Sbjct  618  HAVISIICVIVYFCTFVMAYGPIPNILCSEIFPTRVRGVCIAICGLVFWICDIIVTYSLP  677

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML+S+GL G+F IYAVVCVIS +FV+L+VPETKGMPLEVITEFF+V  +Q E AK E
Sbjct  678  VMLNSIGLGGIFAIYAVVCVISLVFVYLKVPETKGMPLEVITEFFSVDPKQLEAAKAE  735



>emb|CDI66586.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
 emb|CDI66607.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSL
Sbjct  629  AHAALSTVSVIIYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSL  688

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            PVML+++GLAGVFGIYAVVC+I+++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  689  PVMLNAIGLAGVFGIYAVVCLIAFVFVFLKVPETKGMPLEVITEFFAVGAKQA  741



>gb|EAY85098.1| hypothetical protein OsI_06450 [Oryza sativa Indica Group]
Length=689

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LSTI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSL
Sbjct  572  AHAALSTISVIIYFCCFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSL  631

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            PVML+++GLAGVFGIYAVVC I+++FVFL+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  632  PVMLNAIGLAGVFGIYAVVCSIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQATK  688



>ref|XP_004154526.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=733

 Score =   199 bits (505),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 90/117 (77%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V++YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  616  NASISTVSVVVYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  675

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+L+S+GL GVFG+YAVVC+ISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN
Sbjct  676  VLLNSIGLGGVFGMYAVVCIISWVFVFLKVPETKGMPLEVITEFFSVGAKQLLSAKN  732



>ref|NP_001046359.1| Os02g0229400 [Oryza sativa Japonica Group]
 dbj|BAD26163.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF08273.1| Os02g0229400 [Oryza sativa Japonica Group]
 gb|ADG21983.1| tonoplast monosaccharide transporter 2 [Oryza sativa Japonica 
Group]
Length=746

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LSTI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSL
Sbjct  629  AHAALSTISVIIYFCCFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSL  688

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            PVML+++GLAGVFGIYAVVC I+++FVFL+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  689  PVMLNAIGLAGVFGIYAVVCSIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQATK  745



>ref|XP_004139974.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN46648.1| hypothetical protein Csa_6G118280 [Cucumis sativus]
Length=733

 Score =   199 bits (505),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 90/117 (77%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V++YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  616  NASISTVSVVVYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  675

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+L+S+GL GVFG+YAVVC+ISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN
Sbjct  676  VLLNSIGLGGVFGMYAVVCIISWVFVFLKVPETKGMPLEVITEFFSVGAKQLLSAKN  732



>dbj|BAJ89532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  628  HAVLSTVSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGVCIAICALTFWICDIIVTYSLP  687

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML+++GLAGVFGIYA+VC I+++FV+L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  688  VMLNAIGLAGVFGIYAIVCCIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAQ  740



>ref|XP_002510716.1| sugar transporter, putative [Ricinus communis]
 gb|EEF52903.1| sugar transporter, putative [Ricinus communis]
Length=739

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +ST CV++YFC FV  YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+L
Sbjct  621  ANAAVSTACVVIYFCCFVTAYGPIPNILCSEIFPTRVRGLCIAICALVYWIADIIVTYTL  680

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+S+GL G+F I+AV+C ISW+FVFL+VPETKGMPLEVITEFFAVGARQA+ AKNE
Sbjct  681  PVMLTSIGLEGIFIIFAVMCAISWVFVFLKVPETKGMPLEVITEFFAVGARQADAAKNE  739



>gb|EAZ22316.1| hypothetical protein OsJ_05971 [Oryza sativa Japonica Group]
Length=775

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LSTI VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSL
Sbjct  658  AHAALSTISVIIYFCCFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSL  717

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            PVML+++GLAGVFGIYAVVC I+++FVFL+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  718  PVMLNAIGLAGVFGIYAVVCSIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQATK  774



>ref|XP_010539774.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539775.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFW+ D+IVTYSLP
Sbjct  606  NAAISTACVVIYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWVGDIIVTYSLP  665

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+LSS+GL GVF IYA VCV+SWIFVFL+VPETKGMPLEVITEFFA GA+Q + AK+
Sbjct  666  VLLSSIGLVGVFSIYAAVCVVSWIFVFLKVPETKGMPLEVITEFFAYGAQQDQSAKD  722



>ref|XP_003518591.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006575765.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006575766.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Glycine 
max]
 gb|KHN29885.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=711

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST  VI+YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWICD+IVTY+LP
Sbjct  592  NAFISTSSVIVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWICDIIVTYTLP  651

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML+S+GL GVFG+YAVVC+I+W+FVFL+VPETKGMPLEVI EFF+VGA+QA++A N
Sbjct  652  VMLNSVGLGGVFGMYAVVCIIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQAQVANN  708



>ref|XP_009390770.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ VI+YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  626  HAVLSTVSVIVYFCCFVMGFGPVPNILCAEIFPTRVRGVCIAICALTFWIGDIIVTYTLP  685

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML ++GLAGVFGIYA+VCVI+++FVFL+VPETKGMPLEVITEFFAVGA+QA  A+N
Sbjct  686  VMLDTIGLAGVFGIYAIVCVIAFVFVFLKVPETKGMPLEVITEFFAVGAKQA-AARN  741



>gb|KHN46863.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=717

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST  VI+YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWICD+IVTY+LP
Sbjct  600  NAFISTSSVIVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWICDIIVTYTLP  659

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML+S+GL GVFG+YAVVC+I+W+FVFL+VPETKGMPLEVI EFF+VGA+QA++A N
Sbjct  660  VMLNSVGLGGVFGMYAVVCIIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQAQVANN  716



>ref|XP_008440928.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Cucumis melo]
Length=725

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI YFC FVMG+GP+PNILC+EIFPTRVRG CIA+CAL FWI D+IVTYSL
Sbjct  609  ANATISTISVIAYFCCFVMGFGPVPNILCSEIFPTRVRGLCIAMCALTFWIGDIIVTYSL  668

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            PVML+S+GL GVFG YA++C+ISWIFVFL+VPETKGMPLEVI++FFAVGA+QA+ A 
Sbjct  669  PVMLNSIGLGGVFGAYAIICIISWIFVFLKVPETKGMPLEVISDFFAVGAKQADNAD  725



>ref|XP_006412119.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412120.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412121.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53572.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53573.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53574.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
Length=734

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V+LYFC FVMG+GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  619  HAVLSTVSVVLYFCFFVMGFGPTPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            V+L S+GLAGVFG+YAVVC ISW+FV+++VPETKGMPLEVITEFF++GARQA
Sbjct  679  VLLKSIGLAGVFGMYAVVCCISWVFVYIQVPETKGMPLEVITEFFSLGARQA  730



>ref|XP_010909820.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909821.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909822.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909823.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909824.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909825.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909826.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909827.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909828.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909829.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=747

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 106/117 (91%), Gaps = 2/117 (2%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ VI YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FW  D+IVTY+LP
Sbjct  633  HAVLSTVSVIAYFCCFVMGFGPIPNILCAEIFPTRVRGVCIAICALTFWFGDIIVTYTLP  692

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VMLSS+GLAGVFGIYA VC+IS +FVFL+VPETKGMPLEVITEFFAVGA+QA  AKN
Sbjct  693  VMLSSIGLAGVFGIYACVCIISLVFVFLKVPETKGMPLEVITEFFAVGAKQA--AKN  747



>emb|CDY31497.1| BnaC05g16060D [Brassica napus]
Length=632

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST+CV+LY C FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWICD+IVTYSLP
Sbjct  514  NAALSTVCVVLYICFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWICDIIVTYSLP  573

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IYA VCVISW+FV+L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  574  VLLSSIGLVGVFSIYAAVCVISWVFVYLKVPETKGMPLEVITDYFAFGAQASAPSKDD  631



>ref|XP_004300112.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465026.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=738

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
             A +ST CV++YFC FVM YGPIPNILC+EIFPTRVRG CIAICALV+WI D+I+TYSLP
Sbjct  621  EAAISTTCVVIYFCVFVMAYGPIPNILCSEIFPTRVRGLCIAICALVYWISDIIITYSLP  680

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAG+FG+YA+VCVIS +F++L+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  681  VLLDSIGLAGIFGLYAIVCVISLVFIYLKVPETKGMPLEVITEFFSVGARQIAAAKNE  738



>gb|KDO85208.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=706

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
             A +ST CVI+YFC FV  YGPIPNILCAEIFPT+VRG CIAICA+ +WICD+IVTY+LP
Sbjct  591  KAGISTACVIIYFCCFVAAYGPIPNILCAEIFPTKVRGICIAICAMAYWICDIIVTYTLP  650

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            VMLSS+GLAG FG+YAVVC ISW+FVFLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  651  VMLSSIGLAGAFGVYAVVCFISWVFVFLRVPETKGMPLEVITEFFAVGARQATKAD  706



>ref|XP_007204446.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
 gb|EMJ05645.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
Length=742

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STI V++YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  NATISTISVVVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QA++A++
Sbjct  684  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQADIAES  740



>gb|EMT06669.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=787

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ VI+YFC FVMG+GPIPNILCAEIFPTR RG CIAICAL FWICD+IVTYSLP
Sbjct  671  HAVLSTVSVIVYFCCFVMGFGPIPNILCAEIFPTRARGVCIAICALTFWICDIIVTYSLP  730

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML+++GLAGVFGIYAVVC I+++FV+L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  731  VMLNAIGLAGVFGIYAVVCCIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAQ  783



>ref|XP_004951395.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=745

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  630  HAALSTVSVIIYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  689

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+++GLAGVFGIYAVVC+IS++FVFL+VPETKGMPLEVI+EFFAVGA+QA
Sbjct  690  VMLNAIGLAGVFGIYAVVCMISFVFVFLKVPETKGMPLEVISEFFAVGAKQA  741



>ref|XP_006435423.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 ref|XP_006473839.1| PREDICTED: monosaccharide-sensing protein 2-like [Citrus sinensis]
 gb|ESR48663.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 gb|KDO85209.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=738

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
             A +ST CVI+YFC FV  YGPIPNILCAEIFPT+VRG CIAICA+ +WICD+IVTY+LP
Sbjct  623  KAGISTACVIIYFCCFVAAYGPIPNILCAEIFPTKVRGICIAICAMAYWICDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            VMLSS+GLAG FG+YAVVC ISW+FVFLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  683  VMLSSIGLAGAFGVYAVVCFISWVFVFLRVPETKGMPLEVITEFFAVGARQATKAD  738



>ref|XP_009340799.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
 ref|XP_009340800.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  619  NASVSTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML S+GLAGVFG+YAVV VI++IF+FL+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  679  VMLKSVGLAGVFGMYAVVSVIAFIFIFLKVPETKGMPLEVITEFFSVGAKQASAAKNN  736



>emb|CDY29502.1| BnaA06g14680D [Brassica napus]
Length=659

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST+CV+LY C FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWICD+IVTYSLP
Sbjct  541  NAALSTVCVVLYICFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWICDIIVTYSLP  600

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IYA VCVISW+FV+L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  601  VLLSSIGLVGVFSIYAAVCVISWVFVYLKVPETKGMPLEVITDYFAFGAQASAPSKDD  658



>ref|XP_008382498.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008382499.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  619  NASVSTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML S+GLAGVFG+YAVV VI++IF+FL+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  679  VMLKSVGLAGVFGMYAVVSVIAFIFIFLKVPETKGMPLEVITEFFSVGAKQASAAKNN  736



>gb|KDP36756.1| hypothetical protein JCGZ_08047 [Jatropha curcas]
Length=739

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +ST+CV++YFC FVM YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY++
Sbjct  621  ANAAISTVCVVIYFCCFVMAYGPIPNILCSEIFPTRVRGLCIAICALVYWIADIIVTYTV  680

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVML+S+GL G+F I+A++C ISW+FVFL+VPETKGMPLEVITEFFAVGARQ   AKNE
Sbjct  681  PVMLNSIGLTGIFIIFAIMCAISWVFVFLKVPETKGMPLEVITEFFAVGARQVAAAKNE  739



>ref|XP_008242106.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=742

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STI V++YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  NATISTISVVVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+++GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QA++A++
Sbjct  684  IMLTTIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQADIAES  740



>ref|XP_009149562.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
 ref|XP_009149563.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=721

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST+CV+LY C FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWICD+IVTYSLP
Sbjct  603  NAALSTVCVVLYICFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWICDIIVTYSLP  662

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IYA VCVISW+FV+L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  663  VLLSSIGLVGVFSIYAAVCVISWVFVYLKVPETKGMPLEVITDYFAFGAQASAPSKDD  720



>ref|XP_008448165.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448166.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448167.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448168.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448169.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448170.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448171.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
Length=733

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V++YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  616  NASISTVSVVVYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  675

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+L+S+GL GVFG+YAVVC+ISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN
Sbjct  676  VLLNSIGLGGVFGMYAVVCIISWVFVFLKVPETKGMPLEVITEFFSVGAKQLLAAKN  732



>ref|XP_011040809.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040810.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040811.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LP
Sbjct  621  NASISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLP  680

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML S+GLAGVFG+YAVVC+IS++FV+L+VPETKGMPLEVI+EFFAVGA+Q   AK  
Sbjct  681  VMLKSVGLAGVFGLYAVVCIISFVFVYLKVPETKGMPLEVISEFFAVGAKQVAAAKEN  738



>ref|XP_010459775.1| PREDICTED: monosaccharide-sensing protein 1-like [Camelina sativa]
Length=655

 Score =   195 bits (496),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CV+LYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  536  NAALSTSCVVLYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  595

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IYA VCVISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  596  VLLSSIGLVGVFSIYAAVCVISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  653



>ref|XP_009589978.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009589979.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=721

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+STI V++YFC+FVMG+GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLP
Sbjct  607  HAVISTISVVVYFCTFVMGFGPIPNILCSEIFPTSVRGICIAICALTFWFGDIIVTYSLP  666

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+S+GL GVFGIYAVVC ++W+FV+L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  667  VMLTSIGLGGVFGIYAVVCALAWVFVYLKVPETKGMPLEVITEFFAVGAKQA  718



>ref|XP_008392888.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=471

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 7/125 (6%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STI V++YFC+FV+G+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  353  NATISTISVVVYFCTFVLGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  412

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE*M  414
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+  E       
Sbjct  413  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKHTE-------  465

Query  415  NERKL  429
            N+ KL
Sbjct  466  NDEKL  470



>ref|XP_003571780.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=749

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  633  HAVLSTVSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  692

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            VML+++GLAGVFGIYAVVC I+++FV+L+VPETKGMPLEVITEFFAVGA+QA   K
Sbjct  693  VMLNAIGLAGVFGIYAVVCCIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAMTNK  748



>gb|AIN39841.1| hypothetical protein [Zoysia matrella]
Length=744

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICA+ FWI D+IVTYSLP
Sbjct  629  HAALSTVSVIIYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICAMTFWIGDIIVTYSLP  688

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+++GLAGVFGIYAVVC I+++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  689  VMLNAIGLAGVFGIYAVVCAIAFVFVFLKVPETKGMPLEVITEFFAVGAKQA  740



>ref|XP_002520608.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41781.1| sugar transporter, putative [Ricinus communis]
Length=740

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  623  NASISTASVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML S+GLAGVFG+YAVVC+IS +FV+L+VPETKGMPLEVITEFF+VGARQA  AK+ 
Sbjct  683  VMLKSIGLAGVFGLYAVVCIISLVFVYLKVPETKGMPLEVITEFFSVGARQAAAAKDN  740



>gb|AFW59276.1| hypothetical protein ZEAMMB73_154299 [Zea mays]
Length=640

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA+LST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICA  FWI D+IVTYSL
Sbjct  524  AHALLSTVSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICAFTFWIGDIIVTYSL  583

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            PVML+++GLAGVF IYAVVC+IS++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  584  PVMLNAIGLAGVFSIYAVVCLISFVFVFLKVPETKGMPLEVITEFFAVGAKQA  636



>ref|XP_008645619.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 ref|XP_008645620.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 gb|AFW59275.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_154299 [Zea 
mays]
 gb|AFW71237.1| hypothetical protein ZEAMMB73_210614 [Zea mays]
Length=745

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA+LST+ VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICA  FWI D+IVTYSL
Sbjct  629  AHALLSTVSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICAFTFWIGDIIVTYSL  688

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            PVML+++GLAGVF IYAVVC+IS++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  689  PVMLNAIGLAGVFSIYAVVCLISFVFVFLKVPETKGMPLEVITEFFAVGAKQA  741



>ref|XP_010537220.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537221.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537222.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
Length=735

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST CV++YFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFW+ D+IVTYSLP
Sbjct  618  NAAISTGCVVIYFCCFVMGYGPIPNILCSEIFPTRVRGLCIAICAIVFWVGDIIVTYSLP  677

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+L S+GL GVFGIYA VC++SWIFVFL+VPETKGMPLEVITEFFA GA+Q   AK+
Sbjct  678  VLLGSIGLVGVFGIYAAVCIVSWIFVFLKVPETKGMPLEVITEFFAYGAQQDLSAKD  734



>ref|XP_009608796.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608797.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608798.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=734

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A A +ST+CV++YFCSFVMG+GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTY+L
Sbjct  617  AKAAISTVCVVMYFCSFVMGFGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYTL  676

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            PVMLSS+GLAGVFGIYA+VCVISWIFVFL+VPETKGMPLEVI+EFFA+GARQA  AKN
Sbjct  677  PVMLSSIGLAGVFGIYAIVCVISWIFVFLKVPETKGMPLEVISEFFALGARQAAAAKN  734



>ref|XP_010548175.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548176.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548177.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548178.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
Length=742

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST+ ++LYFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FW  ++I+TY+LP
Sbjct  625  HAALSTVSIVLYFCFFVMGFGPVPNILCAEIFPTRVRGICIAICALAFWTGNIIITYTLP  684

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+L S+GLAGVFG+YA+VC +SWIFVF++VPETKGMPLEVI+EFF+VGARQA  AK++
Sbjct  685  VLLKSIGLAGVFGMYAIVCCVSWIFVFVKVPETKGMPLEVISEFFSVGARQAAAAKDD  742



>ref|XP_009763350.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763351.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763352.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=734

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A A +ST+CV++YFCSFVMG+GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTY+L
Sbjct  617  AKAAISTVCVVMYFCSFVMGFGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYTL  676

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            PVMLSS+GLAGVFGIYA+VCVISWIFVFL+VPETKGMPLEVI+EFFA+GARQA  AKN
Sbjct  677  PVMLSSIGLAGVFGIYAIVCVISWIFVFLKVPETKGMPLEVISEFFALGARQAAAAKN  734



>ref|XP_009775817.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775879.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775941.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=721

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST+ V++YFC+FVMG+GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLP
Sbjct  607  HAVISTVSVVVYFCTFVMGFGPIPNILCSEIFPTSVRGICIAICALTFWFGDIIVTYSLP  666

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+S+GL GVFGIYAVVC ++W+FV+L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  667  VMLTSIGLGGVFGIYAVVCALAWVFVYLKVPETKGMPLEVITEFFAVGAKQA  718



>ref|XP_011099908.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011099909.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=709

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  594  HAVISTASVIVYFCCFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYTLP  653

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            VML+ +GLAGVFGIYAVVC ++W+FVF++VPETKGMPLEVITEFFAVGA+Q
Sbjct  654  VMLNQIGLAGVFGIYAVVCAVAWVFVFVKVPETKGMPLEVITEFFAVGAKQ  704



>emb|CDP14489.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
             +A +ST+CV+LYFC FVMG+GP+PNILC+EIFPTRVRG CIA+C L +WI D+IVTY+L
Sbjct  623  GNAAVSTVCVVLYFCFFVMGFGPVPNILCSEIFPTRVRGVCIALCCLTYWIGDIIVTYTL  682

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA-EMAKNE  408
            PVMLSSMGL GVFG YAVVC+ISW F FL+VPETKGMPLEVI+EFF+VGARQA  +AKN 
Sbjct  683  PVMLSSMGLGGVFGTYAVVCIISWFFAFLKVPETKGMPLEVISEFFSVGARQAVAIAKNN  742



>gb|KDP47010.1| hypothetical protein JCGZ_10737 [Jatropha curcas]
Length=740

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST  VI+YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  623  NASISTASVIIYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML SMGLAGVFG+YAVVC+IS  FV+L+VPETKGMPLEVITEFF++GA+QA  AKN+
Sbjct  683  VMLKSMGLAGVFGLYAVVCIISLGFVYLKVPETKGMPLEVITEFFSLGAKQAAAAKND  740



>ref|XP_004169167.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2-like [Cucumis sativus]
Length=722

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI YFC FVMG+GP+PNILC+EIFPTRVRG CIA+CAL FW  D+IVTYSL
Sbjct  609  ANATISTISVIAYFCCFVMGFGPVPNILCSEIFPTRVRGLCIAMCALTFWTGDIIVTYSL  668

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            PVML+S+GL GVFG YA++C+ISWIFVFL+VPETKGMPLEVI++FFAVGA+QA+
Sbjct  669  PVMLNSIGLGGVFGAYAIICIISWIFVFLKVPETKGMPLEVISDFFAVGAKQAD  722



>ref|XP_004134823.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=722

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI YFC FVMG+GP+PNILC+EIFPTRVRG CIA+CAL FW  D+IVTYSL
Sbjct  609  ANATISTISVIAYFCCFVMGFGPVPNILCSEIFPTRVRGLCIAMCALTFWTGDIIVTYSL  668

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            PVML+S+GL GVFG YA++C+ISWIFVFL+VPETKGMPLEVI++FFAVGA+QA+
Sbjct  669  PVMLNSIGLGGVFGAYAIICIISWIFVFLKVPETKGMPLEVISDFFAVGAKQAD  722



>ref|XP_010690557.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690558.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST+ V+LYFC FVMG+GPIPNILCAEIFPTR+RG CIAICAL FWI D+IVT +LP
Sbjct  622  HAVISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRIRGVCIAICALTFWIGDIIVTDTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            +ML+++GLAGVFG YAVV VI+WIF+FL+VPETKGMPLEVITEFFA+GARQ    K+ 
Sbjct  682  IMLNAVGLAGVFGFYAVVSVIAWIFIFLKVPETKGMPLEVITEFFALGARQPSEDKDN  739



>ref|XP_008778122.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778123.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778124.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778125.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778126.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=747

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHAVLST  VI YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FW  D+IVTY+L
Sbjct  632  AHAVLSTFSVIAYFCCFVMGFGPVPNILCAEIFPTRVRGVCIAICALTFWFGDIIVTYTL  691

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            PVML+S+GLAGVFGIYA VCVIS +FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  692  PVMLTSIGLAGVFGIYACVCVISLVFVFLKVPETKGMPLEVITEFFAVGAKQA  744



>ref|XP_002467580.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
 gb|EER94578.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
Length=740

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI VI+YFC FVMG+GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  623  HAALSTISVIVYFCFFVMGFGPIPNILCAEIFPTTVRGICIAICALTFWIGDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML+++GLAGVFGIYAVVC+++ +FVF++VPETKGMPLEVITEFF+VGA+QA+ A+ +
Sbjct  683  VMLNAIGLAGVFGIYAVVCILALVFVFIKVPETKGMPLEVITEFFSVGAKQAKEARED  740



>gb|KGN49001.1| hypothetical protein Csa_6G509700 [Cucumis sativus]
Length=768

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A +STI VI YFC FVMG+GP+PNILC+EIFPTRVRG CIA+CAL FW  D+IVTYSL
Sbjct  655  ANATISTISVIAYFCCFVMGFGPVPNILCSEIFPTRVRGLCIAMCALTFWTGDIIVTYSL  714

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            PVML+S+GL GVFG YA++C+ISWIFVFL+VPETKGMPLEVI++FFAVGA+QA+
Sbjct  715  PVMLNSIGLGGVFGAYAIICIISWIFVFLKVPETKGMPLEVISDFFAVGAKQAD  768



>ref|XP_003574265.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=741

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI VI+YFC FVMG+GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  625  HAALSTISVIVYFCFFVMGFGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLP  684

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML+++GLAGVFGIYAVVC+++++FV+++VPETKGMPLEVITEFF+VGA+Q + A++
Sbjct  685  VMLNAIGLAGVFGIYAVVCILAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEARD  741



>ref|XP_009776539.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009776540.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=722

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+STI V++YFC FV G+GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLP
Sbjct  608  HAVISTISVVVYFCCFVTGFGPIPNILCSEIFPTSVRGLCIAICALTFWFGDIIVTYSLP  667

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+S+GLAGVFGIYA+VC I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q+
Sbjct  668  VMLTSIGLAGVFGIYAIVCAIAWVFVFLKVPETKGMPLEVITEFFAVGAKQS  719



>ref|XP_009622210.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622211.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622212.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=722

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+STI V++YFC FV G+GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLP
Sbjct  608  HAVISTISVVVYFCCFVTGFGPIPNILCSEIFPTSVRGLCIAICALTFWFGDIIVTYSLP  667

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+S+GLAGVFGIYA+VC I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q+
Sbjct  668  VMLTSIGLAGVFGIYAIVCAIAWVFVFLKVPETKGMPLEVITEFFAVGAKQS  719



>ref|XP_006416357.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 ref|XP_006416358.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34710.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34711.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
Length=733

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CV+LYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  616  NAALSTACVVLYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  675

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+LSS+GL GVF IYA VCVISWIFV+L+VPETKGMPLEVIT++FA GA+ +  +K+
Sbjct  676  VLLSSIGLVGVFSIYAAVCVISWIFVYLKVPETKGMPLEVITDYFAFGAQASAPSKD  732



>dbj|BAJ33724.1| unnamed protein product [Thellungiella halophila]
Length=733

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CV+LYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  616  NAALSTACVVLYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  675

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+LSS+GL GVF IYA VCVISWIFV+L+VPETKGMPLEVIT++FA GA+ +  +K+
Sbjct  676  VLLSSIGLVGVFSIYAAVCVISWIFVYLKVPETKGMPLEVITDYFAFGAQASAPSKD  732



>emb|CAD58958.1| hexose transporter [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI VI+YFC FVMG+GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  627  HAALSTISVIVYFCFFVMGFGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLP  686

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML+++GLAGVFGIYAVVC+I+++FV+++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  687  VMLNAIGLAGVFGIYAVVCMIAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>dbj|BAJ90138.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI VI+YFC FVMG+GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  627  HAALSTISVIVYFCFFVMGFGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLP  686

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML+++GLAGVFGIYAVVC+I+++FV+++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  687  VMLNAIGLAGVFGIYAVVCMIAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>ref|XP_009401004.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401005.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V++YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  HAVLSTVSVVIYFCCFVMGFGPIPNILCAEIFPTRVRGVCIAICALTFWIGDIIVTYTLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+S+GLAGVFGIYAVVC I+ +FVFL+VPETKGMPLEVI E FAVGA+QA
Sbjct  684  VMLNSIGLAGVFGIYAVVCTIALVFVFLKVPETKGMPLEVIMEIFAVGAKQA  735



>gb|EPS57524.1| hypothetical protein M569_17293, partial [Genlisea aurea]
Length=693

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ST+ VI+YFC FVMG+GP+PNILCAEIFPTRVRG CI ICAL FWI D+IVTYSLP
Sbjct  583  HAVVSTLSVIVYFCCFVMGFGPVPNILCAEIFPTRVRGLCIGICALTFWIGDIIVTYSLP  642

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            VML S+GLAGVFGIYA VC  +W FVFL+VPETKGMPLEVIT+FFAVGAR+
Sbjct  643  VMLGSIGLAGVFGIYAAVCTAAWFFVFLKVPETKGMPLEVITDFFAVGARR  693



>gb|EMS63940.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=743

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI VI+YFC FVMG+GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  627  HAALSTISVIVYFCFFVMGFGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLP  686

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML+++GLAGVFGIYA+VCV++++FV+++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  687  VMLNAIGLAGVFGIYAIVCVLAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>gb|EMT29091.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=743

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI VI+YFC FVMG+GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  627  HAALSTISVIIYFCFFVMGFGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLP  686

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML+++GLAGVFGIYA+VC+++++FV+++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  687  VMLNAIGLAGVFGIYAIVCILAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>ref|NP_001065182.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|AAG46115.1|AC073166_13 putative sugar transporter [Oryza sativa Japonica Group]
 gb|ABB47937.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27096.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|EAZ16837.1| hypothetical protein OsJ_32308 [Oryza sativa Japonica Group]
 gb|ADG21982.1| tonoplast monosaccharide transporter 1 [Oryza sativa Japonica 
Group]
Length=740

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST+ VILYFC FVMG+GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  626  HASLSTVSVILYFCFFVMGFGPIPNILCAEIFPTTVRGICIAICALTFWIGDIIVTYTLP  685

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML+++GLAGVFGIYAVVC+++++FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  686  VMLNAIGLAGVFGIYAVVCILAFLFVFMKVPETKGMPLEVITEFFSVGAKQAK  738



>ref|XP_007142576.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
 gb|ESW14570.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
Length=732

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 107/115 (93%), Gaps = 2/115 (2%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ VI+YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWICD+IVTY+LP
Sbjct  613  NAFISTLSVIVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWICDIIVTYTLP  672

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVG--ARQAE  393
            VML+S+GL GVFG+YAVVC+++W+FVFL+VPETKGMPLEVITEFF+VG  A+QAE
Sbjct  673  VMLNSVGLGGVFGMYAVVCIVAWVFVFLKVPETKGMPLEVITEFFSVGAKAKQAE  727



>gb|EEC67373.1| hypothetical protein OsI_34495 [Oryza sativa Indica Group]
Length=718

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST+ VILYFC FVMG+GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  604  HASLSTVSVILYFCFFVMGFGPIPNILCAEIFPTTVRGICIAICALTFWIGDIIVTYTLP  663

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML+++GLAGVFGIYAVVC+++++FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  664  VMLNAIGLAGVFGIYAVVCILAFLFVFMKVPETKGMPLEVITEFFSVGAKQAK  716



>emb|CBI37732.3| unnamed protein product [Vitis vinifera]
Length=644

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST  VI+YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  529  HAAISTASVIIYFCCFVMGFGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLP  588

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVFG+YAVVC+ISW+FVFL+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  589  LMLTSVGLAGVFGMYAVVCLISWVFVFLKVPETKGMPLEVISEFFAVGA-SAGQKKN  644



>ref|XP_009392211.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA+ STICV++YFC FVMG+GPIPNILC+EIFPTRVRG CIAIC+L FW CD+IVTYSL
Sbjct  617  AHAIFSTICVVVYFCCFVMGFGPIPNILCSEIFPTRVRGVCIAICSLTFWFCDIIVTYSL  676

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            PVML+++GLAGVFGIYA+VCVI+ +FVFL++PETKGMPLEVI EFF VG++Q
Sbjct  677  PVMLNTIGLAGVFGIYAIVCVIALVFVFLKIPETKGMPLEVIIEFFNVGSKQ  728



>tpg|DAA46101.1| TPA: hypothetical protein ZEAMMB73_051534 [Zea mays]
Length=336

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LST  VI+YFC FVMG+GP+PNILCAEIFPT VRG CIAICAL FW+ D+IVTY+L
Sbjct  213  AHAALSTASVIVYFCFFVMGFGPVPNILCAEIFPTTVRGVCIAICALAFWLGDIIVTYTL  272

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            PVML+ +GLAGVFG+YAVVCV++  FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  273  PVMLNVVGLAGVFGVYAVVCVLALAFVFVKVPETKGMPLEVITEFFSVGAKQAK  326



>ref|XP_002282975.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37148.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=739

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST  VI+YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  HAAISTASVIIYFCCFVMGFGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVFG+YAVVC+ISW+FVFL+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  684  LMLTSVGLAGVFGMYAVVCLISWVFVFLKVPETKGMPLEVISEFFAVGA-SAGQKKN  739



>ref|XP_010678631.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678632.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +AV+ST+ V+LYFC FVMG+GPIPNILCAEIFPT++RG CIAICAL FWICD+IVTY+LP
Sbjct  622  YAVVSTVAVVLYFCFFVMGFGPIPNILCAEIFPTKIRGVCIAICALTFWICDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            +ML ++GLAG+FG YAVV +I+WIF+FL+VPETKGMPLEVITEFFA+GARQA
Sbjct  682  MMLKAVGLAGLFGFYAVVILIAWIFIFLKVPETKGMPLEVITEFFALGARQA  733



>ref|XP_009397963.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397964.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397965.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ V++YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FW  D+IVTY+LP
Sbjct  624  HAVLSTVSVVVYFCCFVMGFGPIPNILCAEIFPTRVRGVCIAICALTFWFGDIIVTYTLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM  396
            V+L+ +GLAGVFGIYAVVC ++ +FVFL+VPETKGMPLEVITEFFAVGA+QA +
Sbjct  684  VLLNMIGLAGVFGIYAVVCTLALVFVFLKVPETKGMPLEVITEFFAVGAKQAAL  737



>ref|XP_010029562.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56480.1| hypothetical protein EUGRSUZ_I02208 [Eucalyptus grandis]
Length=731

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST  VI+YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  615  NAMISTTSVIVYFCFFVMGFGPIPNILCSEIFPTRVRGICIAICALTFWIGDIIVTYTLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +MLSS+GL GVF IYAVVC+ SW FVFL+VPETKGMPLEVI+EFFAVGA+QA  A +
Sbjct  675  LMLSSIGLIGVFAIYAVVCIASWFFVFLKVPETKGMPLEVISEFFAVGAKQASTATD  731



>gb|AFP89954.1| tonoplastic transporter 2 [Vitis vinifera]
Length=739

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST  VI+YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  HAAISTASVIIYFCCFVMGFGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVFG+YA+VC+ISW+FVFL+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  684  LMLTSVGLAGVFGMYAIVCLISWVFVFLKVPETKGMPLEVISEFFAVGA-SAGQKKN  739



>ref|XP_010477336.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
 ref|XP_010477338.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
Length=734

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CV+LYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  615  NAALSTSCVVLYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IYA VCVISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  675  VLLSSIGLVGVFSIYAAVCVISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>tpg|DAA46100.1| TPA: hypothetical protein ZEAMMB73_051534 [Zea mays]
Length=457

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LST  VI+YFC FVMG+GP+PNILCAEIFPT VRG CIAICAL FW+ D+IVTY+L
Sbjct  334  AHAALSTASVIVYFCFFVMGFGPVPNILCAEIFPTTVRGVCIAICALAFWLGDIIVTYTL  393

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            PVML+ +GLAGVFG+YAVVCV++  FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  394  PVMLNVVGLAGVFGVYAVVCVLALAFVFVKVPETKGMPLEVITEFFSVGAKQAK  447



>ref|XP_004983796.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=739

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI VI+YFC FVMG+GP+PNILCAEIFPT VRG CIAICAL FWI D+IVTY+LP
Sbjct  625  HAALSTISVIVYFCFFVMGFGPVPNILCAEIFPTTVRGLCIAICALTFWIGDIIVTYTLP  684

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML+++GLAGVFGIYAVVC+++ +FV+++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  685  VMLNAIGLAGVFGIYAVVCILALVFVYMKVPETKGMPLEVITEFFSVGAKQAK  737



>gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CV+LYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  615  NAALSTGCVVLYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IYA VCVISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  675  VLLSSIGLVGVFSIYAAVCVISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>ref|NP_173508.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
 sp|Q96290.2|MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1; AltName: Full=Monosaccharide 
transporter 1; AltName: Full=Sugar transporter 
MSSP1; AltName: Full=Sugar transporter MT1 [Arabidopsis thaliana]
 gb|AAF80627.1|AC069251_20 F2D10.36 [Arabidopsis thaliana]
 gb|AEE30030.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
Length=734

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CV+LYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  615  NAALSTGCVVLYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IYA VCVISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  675  VLLSSIGLVGVFSIYAAVCVISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>ref|XP_009372620.1| PREDICTED: monosaccharide-sensing protein 2 [Pyrus x bretschneideri]
Length=739

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTICV++YFC FVM YGPIPNILC+EIFPTRVRG CIAICALV+WI D+I+TYSLP
Sbjct  622  HAALSTICVVVYFCVFVMAYGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIITYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML SMGL+G FGIYAVVCVIS++FVFL+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  682  VMLDSMGLSGAFGIYAVVCVISFVFVFLKVPETKGMPLEVITEFFSVGARQVAAAKNE  739



>ref|XP_010270527.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
 ref|XP_010270528.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
Length=740

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST  V++YFC FVMG+GPIPNILC+EIFPTRVRG CIAICALVFW  D+IVTYSLP
Sbjct  624  HAVLSTASVLVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALVFWTGDIIVTYSLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            +ML+S+GL+GVFGIY+ VC I+ +FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  684  MMLNSIGLSGVFGIYSAVCCIALVFVFLKVPETKGMPLEVITEFFAVGAKQA  735



>ref|XP_010063149.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW70342.1| hypothetical protein EUGRSUZ_F03585 [Eucalyptus grandis]
Length=740

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +1

Query  64   LSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVML  243
            ++TICV++YFC F+  YGPIPNILC+EIFPTRVRG CI ICALVFW+ D+IVT +LPV+L
Sbjct  626  IATICVVVYFCCFMTAYGPIPNILCSEIFPTRVRGLCITICALVFWLGDIIVTDTLPVLL  685

Query  244  SSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
             S+GLAG+FGIYA VCVISW+FVFL+VPETKGMPLEVITEFF+VGA+Q    KNE
Sbjct  686  ESIGLAGIFGIYAAVCVISWVFVFLKVPETKGMPLEVITEFFSVGAKQIATTKNE  740



>ref|XP_002307812.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
 gb|EEE94808.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
Length=738

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A + T CVI++ C FV  YGPIPNILC+EIFPTRVRG CIAICA+V+WI D+IVTY+LP
Sbjct  622  NAAILTACVIIFICCFVSAYGPIPNILCSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VMLSS+GL G+FGIYAVVC ISWIFVFL+VPETKGMPLEVITEFFAVGA+QA   K 
Sbjct  682  VMLSSIGLVGIFGIYAVVCAISWIFVFLKVPETKGMPLEVITEFFAVGAKQAAAKKE  738



>gb|AAO37640.1| putative sugar transporter type 2a [Saccharum hybrid cultivar 
Q117]
Length=745

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLSTI VI Y C F MG+GPIPNILCAE FPTRVRG CIAICAL+FW+ D+IVTYSLP
Sbjct  630  HAVLSTISVITYLCCFKMGFGPIPNILCAEFFPTRVRGICIAICALIFWVGDIIVTYSLP  689

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML+++GL GVFGIYAV C I+++FV+L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  690  VMLNAIGLEGVFGIYAVACAIAFVFVYLKVPETKGMPLEVITEFFAVGAKQA  741



>emb|CAN80213.1| hypothetical protein VITISV_042076 [Vitis vinifera]
Length=739

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST  VI+YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  HAAISTASVIIYFCCFVMGFGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLP  683

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            +ML+S+GLAGVFG+YA VC+ISW+FVFL+VPETKGMPLEVI+EFFAVG   A   KN
Sbjct  684  LMLTSVGLAGVFGMYAXVCLISWVFVFLKVPETKGMPLEVISEFFAVGX-SAGQKKN  739



>ref|XP_009110209.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=726

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CVILYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  607  NAALSTACVILYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  666

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IY  VCVISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  667  VLLSSIGLVGVFIIYGAVCVISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  724



>emb|CDX96618.1| BnaA08g21610D [Brassica napus]
Length=725

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CVILYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  606  NAALSTACVILYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  665

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IY  VCVISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  666  VLLSSIGLVGVFIIYGAVCVISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  723



>emb|CDY33650.1| BnaC08g19500D [Brassica napus]
Length=697

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CVILYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  578  NAALSTACVILYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  637

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            V+LSS+GL GVF IY  VCVISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  638  VLLSSIGLVGVFIIYGAVCVISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  695



>ref|XP_009333794.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  619  NASVSTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVG  378
            VML S+GLAGVFG+YAVVCVI++IFVFL+VPETKGMPLEVITEFF+VG
Sbjct  679  VMLKSVGLAGVFGMYAVVCVIAFIFVFLKVPETKGMPLEVITEFFSVG  726



>ref|XP_004290074.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458100.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST  V++YFCSFVMG+GP+PNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP
Sbjct  622  NAAISTGSVVIYFCSFVMGFGPVPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFF  369
            V+L S+GL+GVFG+YAVVCVI+WIFVF++VPETKGMPLEVITEFF
Sbjct  682  VLLKSVGLSGVFGMYAVVCVIAWIFVFIKVPETKGMPLEVITEFF  726



>ref|XP_006306868.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306869.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306870.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39766.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39767.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39768.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
Length=736

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CV+LYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  615  NAALSTSCVVLYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVG  378
            V+LSS+GL GVF IYA VCVISWIFV+++VPETKGMPLEVIT++FA G
Sbjct  675  VLLSSIGLVGVFSIYAAVCVISWIFVYMKVPETKGMPLEVITDYFAFG  722



>ref|XP_008377843.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008377844.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  619  NASVSTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVG  378
            VML S+GLAGVFG+YAVVCVI++IFVFL+VPETKGMPLEVITEFF+VG
Sbjct  679  VMLKSVGLAGVFGMYAVVCVIAFIFVFLKVPETKGMPLEVITEFFSVG  726



>ref|XP_010940242.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=745

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 2/117 (2%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLSTI VI+YFC FVMG+GPIPNILCAE+FPTRVRG CIAIC+L FW  D+IVTY+LP
Sbjct  631  HAVLSTISVIVYFCCFVMGFGPIPNILCAELFPTRVRGMCIAICSLTFWFGDIIVTYTLP  690

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML ++GLAGVFGIYAVVCVI+ +F+FL+VPETKGMPLEVI EFF VGA+ A  A+N
Sbjct  691  VMLKTVGLAGVFGIYAVVCVIALVFIFLKVPETKGMPLEVIIEFFNVGAKLA--ARN  745



>ref|NP_001151936.1| LOC100285573 [Zea mays]
 ref|XP_008680244.1| PREDICTED: LOC100285573 isoform X1 [Zea mays]
 gb|ACG45075.1| hexose transporter [Zea mays]
 tpg|DAA46098.1| TPA: hexose transporter isoform 1 [Zea mays]
 tpg|DAA46099.1| TPA: hexose transporter isoform 2 [Zea mays]
Length=747

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LST  VI+YFC FVMG+GP+PNILCAEIFPT VRG CIAICAL FW+ D+IVTY+L
Sbjct  624  AHAALSTASVIVYFCFFVMGFGPVPNILCAEIFPTTVRGVCIAICALAFWLGDIIVTYTL  683

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            PVML+ +GLAGVFG+YAVVCV++  FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  684  PVMLNVVGLAGVFGVYAVVCVLALAFVFVKVPETKGMPLEVITEFFSVGAKQAK  737



>ref|XP_007201798.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201799.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201800.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02997.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02998.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02999.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
Length=736

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  619  NASVSTVSVVLYFCFFVMGFGPVPNILCAEIFPTRVRGLCIAICALAFWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVG  378
            VML S+GL GVFG+YAVVCVI+W+FVFL+VPETKGMPLEVI EFF+VG
Sbjct  679  VMLKSVGLGGVFGMYAVVCVIAWVFVFLKVPETKGMPLEVIIEFFSVG  726



>ref|XP_002893133.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69392.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
Length=735

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LST CV+LYFC FVMGYGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLP
Sbjct  614  NAALSTGCVVLYFCFFVMGYGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLP  673

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVG  378
            V+LSS+GL GVF IYA VCVISWIFV+++VPETKGMPLEVIT++FA G
Sbjct  674  VLLSSIGLVGVFSIYAAVCVISWIFVYMKVPETKGMPLEVITDYFAFG  721



>ref|XP_009341490.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  619  NASVSTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVG  378
            VML S+GLAGVFG+YAVVCVI++IFVFL+VPETKGMPLEVITEFF+VG
Sbjct  679  VMLKSVGLAGVFGMYAVVCVIAFIFVFLKVPETKGMPLEVITEFFSVG  726



>ref|XP_008235816.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
 ref|XP_008235817.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=736

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  619  NASVSTVSVVLYFCFFVMGFGPVPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVG  378
            VML S+GL GVFG+Y VVCVI+W+FVFL+VPETKGMPLEVI EFF+VG
Sbjct  679  VMLKSVGLGGVFGMYGVVCVIAWVFVFLKVPETKGMPLEVIIEFFSVG  726



>emb|CDY16303.1| BnaC01g23380D [Brassica napus]
Length=670

 Score =   184 bits (466),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 80/116 (69%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A++ST  V++Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+L
Sbjct  547  ANALISTASVMVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTL  606

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            PVML S+GLAGVFGIYA VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+  + +
Sbjct  607  PVMLKSLGLAGVFGIYAFVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKHQDAS  662



>ref|XP_006384856.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP62653.1| transporter-related family protein [Populus trichocarpa]
Length=739

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LP
Sbjct  622  NASISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFF  369
            VML S+GLAGVFG+YAVVCVIS++FV+L+VPETKGMPLEVI+EFF
Sbjct  682  VMLKSVGLAGVFGLYAVVCVISFVFVYLKVPETKGMPLEVISEFF  726



>ref|XP_002312798.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE86753.1| transporter-related family protein [Populus trichocarpa]
Length=740

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LP
Sbjct  623  NASISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFF  369
            VML S+GLAGVFG+YA+VCVIS++FV+L+VPETKGMPLEVI+EFF
Sbjct  683  VMLKSIGLAGVFGLYAIVCVISFVFVYLKVPETKGMPLEVISEFF  727



>ref|XP_006403910.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
 gb|ESQ45363.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
Length=739

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++STI V++Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LP
Sbjct  618  NALMSTISVMVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLP  677

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            VML S+GLAGVFGIYA VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q ++A
Sbjct  678  VMLKSLGLAGVFGIYAFVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDLA  732



>ref|XP_009148978.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=741

 Score =   183 bits (465),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A++ST  V++Y   FVMG G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+L
Sbjct  618  ANALISTASVMVYLSCFVMGLGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTL  677

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            PVML S+GLAGVFGIYA VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+  + +
Sbjct  678  PVMLKSLGLAGVFGIYAFVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKHQDAS  733



>ref|XP_011000869.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000870.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000871.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST+ V+LYFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LP
Sbjct  623  NASISTVSVVLYFCFFVMGFGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLP  682

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFF  369
            VML S+GLAGVFG+YA+VC+IS++FV+L+VPETKGMPLEVI+EFF
Sbjct  683  VMLKSIGLAGVFGLYAIVCIISFVFVYLKVPETKGMPLEVISEFF  727



>ref|XP_004978456.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Setaria 
italica]
 ref|XP_004978457.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Setaria 
italica]
 ref|XP_004978458.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Setaria 
italica]
Length=710

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI +ILYFC FVMG+GPIPNILCAEIFPT VRG CIAICA   WI D+IVTY+LP
Sbjct  596  HAALSTISLILYFCFFVMGFGPIPNILCAEIFPTTVRGICIAICAFTSWIGDIIVTYTLP  655

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML+S+GLAGVFGIYAV C+I+ +FV+++VPETKGMPLEVI EFF+VGA+QA+
Sbjct  656  VMLNSIGLAGVFGIYAVFCIIALVFVYMKVPETKGMPLEVIIEFFSVGAKQAK  708



>ref|XP_010503840.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=740

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST  V +Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LP
Sbjct  619  NALISTASVTVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLP  678

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            VML S+GLAGVFGIYAVVC +SW+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  679  VMLKSLGLAGVFGIYAVVCAVSWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  733



>dbj|BAI94493.1| sugar transporter [Dianthus caryophyllus]
Length=733

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST+ ++LY C F+MG+ P+PNILCAEIFPTRVRG CIAICAL FWI D+IVT +LP
Sbjct  620  HAVLSTLSLVLYICFFMMGFAPVPNILCAEIFPTRVRGVCIAICALTFWISDIIVTDTLP  679

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            ++L+S+GLAGVFGIYAV  VI+W+F+FL+VPETKGMPLEVITEFFA+GAR+
Sbjct  680  LLLNSVGLAGVFGIYAVFSVIAWVFIFLKVPETKGMPLEVITEFFALGARK  730



>ref|XP_010426703.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=738

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A+LST  V +Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LP
Sbjct  617  NALLSTASVTVYLSCFVMGFGSIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLP  676

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            VML S+GLAGVFGIYA VC ++W+FV+LRVPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  677  VMLKSLGLAGVFGIYAFVCAVAWVFVYLRVPETKGMPLEVISEFFSVGAKQQDAA  731



>ref|NP_001147067.1| hexose transporter [Zea mays]
 gb|ACN33422.1| unknown [Zea mays]
 gb|AFW69612.1| hexose transporter [Zea mays]
Length=763

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA+LST CV++YFC FVMG+GPIPNILCAEIFPTRVRG CIA+C+L FWICD+IVT SLP
Sbjct  640  HALLSTACVVVYFCCFVMGFGPIPNILCAEIFPTRVRGICIAVCSLTFWICDIIVTNSLP  699

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML ++GLAGVFG YA VC +S +FV+LRVPETKG PLEVI EFF VGA+  +  ++E
Sbjct  700  VMLRTIGLAGVFGSYAFVCCLSLVFVYLRVPETKGFPLEVIIEFFNVGAKAQKPEQHE  757



>gb|ACG25339.1| hexose transporter [Zea mays]
Length=763

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA+LST CV++YFC FVMG+GPIPNILCAEIFPTRVRG CIA+C+L FWICD+IVT SLP
Sbjct  640  HALLSTACVVVYFCCFVMGFGPIPNILCAEIFPTRVRGICIAVCSLTFWICDIIVTNSLP  699

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VML ++GLAGVFG YA VC +S +FV+LRVPETKG PLEVI EFF VGA+  +  ++E
Sbjct  700  VMLRTIGLAGVFGSYAFVCCLSLVFVYLRVPETKGFPLEVIIEFFNVGAKAQKPEQHE  757



>gb|KCW55684.1| hypothetical protein EUGRSUZ_I01534 [Eucalyptus grandis]
Length=282

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ TI V+LY C FVMG+GP PN+LCAEIFPTRVRG C+AIC L FW+ +VIVTYSLP
Sbjct  165  HAVICTIGVVLYICFFVMGFGPAPNVLCAEIFPTRVRGVCVAICGLAFWMGNVIVTYSLP  224

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            +ML S GLA +FG++ VVC++SW FVFL+VPETKGMPLEVITEFF +G +Q    K+E
Sbjct  225  LMLRSAGLASIFGMFTVVCLLSWAFVFLKVPETKGMPLEVITEFFCLGMKQTFAVKDE  282



>ref|XP_009115837.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=731

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A++ST  V++Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+L
Sbjct  611  ANALISTASVMVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTL  670

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            PVML S+GLAGVFGIYA VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  671  PVMLKSLGLAGVFGIYAFVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  726



>emb|CDX78009.1| BnaA09g32040D [Brassica napus]
Length=669

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A++ST  V++Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+L
Sbjct  549  ANALISTASVMVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTL  608

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            PVML S+GLAGVFGIYA VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A 
Sbjct  609  PVMLKSLGLAGVFGIYAFVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAAS  665



>ref|XP_008812559.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812567.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812574.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812580.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=745

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 2/117 (2%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST  VI+YFC FVMG+GPIPNILCAE+FPTRVRG CIAIC+L FW  D+IVTY+LP
Sbjct  631  HAVLSTFSVIIYFCCFVMGFGPIPNILCAELFPTRVRGVCIAICSLAFWFGDIIVTYTLP  690

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML++ GLAG FGIYAVVCVI+ +FVFL+VPETKGMPLEVI EFF+VG + A  A+N
Sbjct  691  VMLNTTGLAGAFGIYAVVCVIALVFVFLKVPETKGMPLEVIIEFFSVGTKLA--ARN  745



>ref|XP_010515555.1| PREDICTED: monosaccharide-sensing protein 3 [Camelina sativa]
Length=738

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST  V +Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LP
Sbjct  617  NALISTASVTVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLP  676

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            VML S+GLAGVFGIYAVVC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  677  VMLKSLGLAGVFGIYAVVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  731



>emb|CDX73717.1| BnaC08g22860D [Brassica napus]
Length=681

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A++ST  V++Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+L
Sbjct  561  ANALISTASVMVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTL  620

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            PVML S+GLAGVFGIYA VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A 
Sbjct  621  PVMLKSLGLAGVFGIYAFVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAAS  677



>ref|XP_006292750.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
 gb|EOA25648.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
Length=729

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST  V +Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LP
Sbjct  608  NALISTASVTVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLP  667

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            VML S+GLAGVFGIYA+VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  668  VMLKSLGLAGVFGIYAIVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  722



>gb|KFK34392.1| hypothetical protein AALP_AA5G139300 [Arabis alpina]
Length=739

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A+LST  V++Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+L
Sbjct  617  ANALLSTASVMVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTL  676

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            PVML S+GLAGVFGIYA VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q +
Sbjct  677  PVMLKSLGLAGVFGIYAFVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQD  730



>ref|NP_001190054.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 gb|AEE78799.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=737

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST  V +Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LP
Sbjct  616  NALISTASVTVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLP  675

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            VML S+G+AGVFGIYA+VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  676  VMLKSIGIAGVFGIYAIVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  730



>ref|NP_190717.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 sp|Q9SD00.1|MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3; AltName: Full=Sugar 
transporter MSSP3 [Arabidopsis thaliana]
 emb|CAB63013.1| sugar transporter-like protein [Arabidopsis thaliana]
 emb|CAD58693.1| monosaccharide sensing protein 3 [Arabidopsis thaliana]
 gb|AEE78798.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=729

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST  V +Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LP
Sbjct  608  NALISTASVTVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLP  667

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            VML S+G+AGVFGIYA+VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  668  VMLKSIGIAGVFGIYAIVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  722



>ref|XP_002877807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54066.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST  V +Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LP
Sbjct  609  NALISTASVTVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLP  668

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  393
            VML S+G+AGVFGIYA+VC ++W+FV+LRVPETKGMPLEVI+EFF+VGA+Q +
Sbjct  669  VMLKSIGIAGVFGIYAIVCAVAWVFVYLRVPETKGMPLEVISEFFSVGAKQQD  721



>ref|XP_004144248.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_004171132.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN47521.1| hypothetical protein Csa_6G355400 [Cucumis sativus]
Length=729

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +STICV++YFC FVM YGPIPNILC+EIFPTRVRG CIAIC++VFW  D+IVTYSLP
Sbjct  612  NAAISTICVVVYFCVFVMAYGPIPNILCSEIFPTRVRGLCIAICSMVFWTGDIIVTYSLP  671

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            VMLS++GLAGVFGIYA VC+ISWIFV+L+VPETKGMPLEVI EFF+VGARQA    N 
Sbjct  672  VMLSAIGLAGVFGIYAFVCIISWIFVYLKVPETKGMPLEVIAEFFSVGARQAAKGSNN  729



>emb|CDY33276.1| BnaA01g19430D [Brassica napus]
Length=668

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A+A++ST  V++Y   FVMG+G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+L
Sbjct  545  ANALISTASVMVYLSCFVMGFGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTL  604

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  399
            PVML S+GLAGVFGIYA VC ++W+FV+L+VPETKGMPLEVI+EFF+VGA+  + +
Sbjct  605  PVMLKSLGLAGVFGIYAFVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKHQDAS  660



>ref|XP_006855646.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
 gb|ERN17113.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
Length=743

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            A A +S + V++YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+L
Sbjct  626  AQAAISCLGVVVYFCFFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTL  685

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFF  369
            P +L+++GL+GVFGIYAVVCVISWIFVFL+VPETKGMPLEVITEFF
Sbjct  686  PSLLTAIGLSGVFGIYAVVCVISWIFVFLKVPETKGMPLEVITEFF  731



>ref|XP_008786687.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786688.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786689.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786690.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=744

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST  V+ Y C FVMG+GPIPNILCAEIFPTRVRG CIAICA+ +W  ++I+TY+LP
Sbjct  630  HAVLSTGSVVAYLCCFVMGFGPIPNILCAEIFPTRVRGVCIAICAITYWFGNIIITYTLP  689

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            VML ++GL GVFGIYA VC++S +FV+L+VPETKGMPLEVI+EFFA+G++QA
Sbjct  690  VMLDAIGLTGVFGIYAAVCILSLVFVYLKVPETKGMPLEVISEFFALGSKQA  741



>gb|EMT28528.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=531

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIA+C+L FWI D+IVTYSLP
Sbjct  415  HAALSTGSVIIYFCCFVMGFGPIPNILCAEIFPTRVRGLCIALCSLTFWIGDIIVTYSLP  474

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGAR  384
            VML+S+GLAGVFGIYA VC ++ +FV L+VPETKG+PLEVI EFF VGA+
Sbjct  475  VMLNSIGLAGVFGIYACVCCLALVFVALKVPETKGLPLEVIIEFFNVGAK  524



>ref|NP_001067890.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|ABA93553.1| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28253.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|EAZ18344.1| hypothetical protein OsJ_33873 [Oryza sativa Japonica Group]
 dbj|BAH00841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=757

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSL
Sbjct  637  AHAALSTGSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICSLTFWLGDIAVTYSL  696

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GLAGVF  YA VC ++ +FV L+VPETKG+PLEVI EFF VGA+   +   E
Sbjct  697  PVMLSSVGLAGVFSFYAAVCCVALVFVALKVPETKGLPLEVIIEFFNVGAKAGTLPDEE  755



>gb|EAY80902.1| hypothetical protein OsI_36080 [Oryza sativa Indica Group]
Length=763

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
            AHA LST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSL
Sbjct  643  AHAALSTGSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICSLTFWLGDIAVTYSL  702

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            PVMLSS+GLAGVF  YA VC ++ +FV L+VPETKG+PLEVI EFF VGA+   +   E
Sbjct  703  PVMLSSVGLAGVFSFYAAVCCVALVFVALKVPETKGLPLEVIIEFFNVGAKAGTLPDEE  761



>ref|XP_006662557.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=717

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST+ VILYFC FVMG+GPIPNI CAEIFPT VRG CIAIC++ FWI D+IVTY+LP
Sbjct  599  HASLSTVSVILYFCFFVMGFGPIPNIFCAEIFPTTVRGICIAICSMTFWIGDIIVTYTLP  658

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VML+S+GLAGVFGIYAVVC+++ +FV+ +VPETKGMPLEVITE F++G +     ++
Sbjct  659  VMLNSIGLAGVFGIYAVVCILALLFVYTKVPETKGMPLEVITEVFSLGTQPKHDKED  715



>ref|XP_011041174.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A + T CVI++ C FV  YGPIPNILC+EIFPTRVRG CIAICA+V+WI D+IVTY+LP
Sbjct  622  NAAILTACVIIFICCFVSAYGPIPNILCSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFF  369
            VMLSS+GL G+FGIYAVVC ISWIFVFL+VPETKGMPLEVITEFF
Sbjct  682  VMLSSIGLVGIFGIYAVVCAISWIFVFLKVPETKGMPLEVITEFF  726



>ref|XP_010028861.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Eucalyptus grandis]
Length=730

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAV+ TI V+LY C FVMG+GP PN+LCAEIFPTRVRG C+AIC L FW+ +VIVTYSLP
Sbjct  613  HAVICTIGVVLYICFFVMGFGPAPNVLCAEIFPTRVRGVCVAICGLAFWMGNVIVTYSLP  672

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            +ML S GLA +FG++ VVC++SW FVFL+VPETKGMPLEVITEFF +G +Q    K+E
Sbjct  673  LMLRSAGLASIFGMFTVVCLLSWAFVFLKVPETKGMPLEVITEFFCLGMKQTFAVKDE  730



>ref|XP_004964709.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=748

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLP
Sbjct  625  HAALSTGSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLP  684

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGAR  384
            VMLSS+GLAGVFG YAVVC ++ IFV+++VPETKG PLEVI EFF +GA+
Sbjct  685  VMLSSVGLAGVFGFYAVVCCLALIFVYIKVPETKGFPLEVIIEFFNIGAK  734



>ref|XP_007203009.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
 gb|EMJ04208.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
Length=738

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST  V++Y C FVM +G IPNILCAEIFPTR+RG CIAICAL FWI D+++TYS P
Sbjct  622  NATISTASVVVYLCCFVMAFGVIPNILCAEIFPTRIRGLCIAICALTFWIGDIVITYSFP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VMLSS+G AGVFGIY   C+I+W FV+L+VPETKGMPLEVI++FFA G +QA  A N
Sbjct  682  VMLSSIGFAGVFGIYVAGCIIAWFFVYLKVPETKGMPLEVISDFFAAGVKQAADASN  738



>ref|XP_011034826.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034827.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034828.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034829.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  58   AVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPV  237
            A + T CVI++ C FV  YGPIPNILC+EIFPTRVRG CIAICA+V+WI D+IVTY+LPV
Sbjct  623  AAILTACVIIFICCFVSAYGPIPNILCSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPV  682

Query  238  MLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            ML+S+GL G+FGIYA VC+ISWIFVFL+VPETKGMPLEVITEFFAVGARQA  AKN
Sbjct  683  MLTSIGLVGIFGIYAAVCIISWIFVFLKVPETKGMPLEVITEFFAVGARQAAAAKN  738



>ref|XP_003560303.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=770

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAIC+L FWI D++VTYSLP
Sbjct  654  HAALSTGSVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICSLTFWIGDIVVTYSLP  713

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGAR  384
            VMLSS+GLAGVFG YA VC ++ +FV L+VPETKG+PLEVI EFF VGA+
Sbjct  714  VMLSSVGLAGVFGFYAFVCCLALVFVALKVPETKGLPLEVIIEFFNVGAK  763



>ref|XP_004977696.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=198

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA LSTI +ILYFC FVMG+GPIPNILCAEIFPT VRG CIAICA   WI D+IVTY+LP
Sbjct  95   HAALSTISLILYFCFFVMGFGPIPNILCAEIFPTTVRGICIAICAFTSWIGDIIVTYTLP  154

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITE  363
            VML+S+GLAGVFGIYAV C+I+ +FV+++VPETKGMPLEV+ +
Sbjct  155  VMLNSIGLAGVFGIYAVFCIIALVFVYMKVPETKGMPLEVLVK  197



>dbj|BAK02857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   172 bits (437),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +ST  VI+Y C+FVMG+GPIP ILC+EIFPTRVRG CIAIC+L FW+ D+ VTYS+P
Sbjct  611  HAAVSTTSVIVYICTFVMGFGPIPGILCSEIFPTRVRGMCIAICSLAFWLSDIAVTYSMP  670

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGAR  384
            VML S+GLAGVF IYA VC ++  FV LRVPETKG+PLEVI EFF VGA+
Sbjct  671  VMLDSLGLAGVFSIYAAVCCVALAFVALRVPETKGLPLEVIAEFFNVGAK  720



>ref|XP_008242155.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=738

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST  V++Y C FVM +G IPNILCAEIFPTRVR  CIAICAL FWI D+I+TYS P
Sbjct  622  NAAISTDSVVVYLCCFVMAFGVIPNILCAEIFPTRVRSLCIAICALTFWIGDIIITYSFP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            VMLSS+G AGVFGIY   C+I+W FV+L+VPETKGMPLEVI++FFA G +QA  A N
Sbjct  682  VMLSSIGFAGVFGIYVAGCIIAWFFVYLKVPETKGMPLEVISDFFAAGVKQAADASN  738



>ref|XP_002300629.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
 gb|EEE79902.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
Length=738

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  58   AVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPV  237
            A + T CVI++ C FV  YGPIPNILC+EIFPTRVRG CIAICA+V+WI D+IVTY+LPV
Sbjct  623  AAILTACVIIFICCFVSAYGPIPNILCSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPV  682

Query  238  MLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            ML+S+GL G+F IYA VCVISWIFVFL+VPETKGMPLEVITEFFAVGARQA  AKN
Sbjct  683  MLTSIGLVGIFSIYAAVCVISWIFVFLKVPETKGMPLEVITEFFAVGARQAAAAKN  738



>ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
 gb|EER90435.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
Length=767

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HAVLST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLP
Sbjct  645  HAVLSTASVIVYFCCFVMGFGPIPNILCAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLP  704

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGAR  384
            VML ++GLAGVFG YA VC ++ IFV+L+VPETKG PLEVI EFF +GA+
Sbjct  705  VMLKAIGLAGVFGFYAFVCCLALIFVYLKVPETKGFPLEVIIEFFNIGAK  754



>gb|KJB12351.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
 gb|KJB12353.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=734

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LSTI V+L F  FVMG+GPIPNILC EIFPTRVRG CIA+C L+ WIC++IVTYSLP
Sbjct  622  NAALSTISVVLCFFFFVMGFGPIPNILCTEIFPTRVRGICIAVCFLISWICNIIVTYSLP  681

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            V+L S+GLAG+FG+YAVVC ISW+FVFL+VPETKGMPLEVI + F+VGA++
Sbjct  682  VLLKSIGLAGLFGMYAVVCAISWVFVFLKVPETKGMPLEVIMDVFSVGAKR  732



>gb|KJB12354.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=758

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LSTI V+L F  FVMG+GPIPNILC EIFPTRVRG CIA+C L+ WIC++IVTYSLP
Sbjct  646  NAALSTISVVLCFFFFVMGFGPIPNILCTEIFPTRVRGICIAVCFLISWICNIIVTYSLP  705

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            V+L S+GLAG+FG+YAVVC ISW+FVFL+VPETKGMPLEVI + F+VGA++
Sbjct  706  VLLKSIGLAGLFGMYAVVCAISWVFVFLKVPETKGMPLEVIMDVFSVGAKR  756



>ref|XP_009359632.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A +ST  V++Y C FVM +G IPNILCAEIFPTRVRG CIAICAL  WI D+I+TYS P
Sbjct  614  NATISTASVVVYLCCFVMAFGVIPNILCAEIFPTRVRGLCIAICALALWIGDIIITYSFP  673

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE*M  414
            V+LSS+G AGVFGIY V C++SW+FV+L+VPETKGMPLEVI+EFFA G + A    +   
Sbjct  674  VLLSSVGFAGVFGIYVVGCIVSWVFVYLKVPETKGMPLEVISEFFAAGVKPATADTSADS  733

Query  415  NER  423
            N++
Sbjct  734  NDK  736



>ref|XP_004289030.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=714

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +1

Query  58   AVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPV  237
            A +ST  V++Y C FVMG+G IPNILCAEIFPT VRG CIAICAL +WI D+I+TYS PV
Sbjct  601  ATISTASVVIYLCCFVMGFGVIPNILCAEIFPTPVRGLCIAICALTYWIGDIIITYSFPV  660

Query  238  MLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  390
            MLSS+G AGVFG+Y + C+ISWIFV+L+VPETKGMPLEVI+EFFA G + A
Sbjct  661  MLSSIGFAGVFGVYVLGCIISWIFVYLKVPETKGMPLEVISEFFAAGVKPA  711



>gb|EYU40481.1| hypothetical protein MIMGU_mgv1a001997mg [Erythranthe guttata]
Length=728

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  52   AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  231
              A +ST+ VI Y C F MG+GPIPNILCAEIFPTRVRG CI IC + FWIC++++TYSL
Sbjct  610  GKAAVSTVSVITYSCFFAMGFGPIPNILCAEIFPTRVRGVCIGICGITFWICNIMITYSL  669

Query  232  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            P+MLS +GL GVF I+AV  ++SW FV+L+VPETKGMPLEVITEFF++GA+ A    N
Sbjct  670  PMMLSWIGLGGVFSIFAVASLVSWGFVYLKVPETKGMPLEVITEFFSLGAKPAAAPPN  727



>gb|KJB31963.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31964.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31965.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31966.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31967.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
Length=737

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
             + +ST+ V+L  C +VMG+GPIP+ILCAEIFPTRVRG CIAI +LV+WI ++IV YSLP
Sbjct  615  RSAISTVSVVLSCCVYVMGFGPIPSILCAEIFPTRVRGTCIAIVSLVYWISNIIVAYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+L ++GLAGVFG++  VC+ S++FVFL+VPETKGMPLEVITEFF+VG++QA  AKN
Sbjct  675  VLLKTIGLAGVFGMFGTVCLASFVFVFLKVPETKGMPLEVITEFFSVGSKQAITAKN  731



>gb|KHG00737.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=726

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A LSTI V+L F  FVMG+GPIPNILC+EIFPTRVRG CIA+C L+ WIC++IVTYSLP
Sbjct  614  NAALSTISVVLCFFFFVMGFGPIPNILCSEIFPTRVRGICIAVCFLISWICNIIVTYSLP  673

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            V+L S+GL G+FG+YAVVC +SW+FVF++VPETKGMPLEVI + F+VGA++
Sbjct  674  VLLKSIGLGGLFGMYAVVCAVSWVFVFVKVPETKGMPLEVIMDVFSVGAKR  724



>gb|KHG14026.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=737

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
             + +ST+ V+L  C + MG+GPIP+ILCAEIFPTRVRG CIAI +LV+WI ++IV YSLP
Sbjct  615  RSAISTVSVVLSCCVYAMGFGPIPSILCAEIFPTRVRGTCIAIVSLVYWISNIIVAYSLP  674

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  405
            V+L ++GLAGVFG++  VC+ S++FVFL+VPETKGMPLEVITEFF+VG++QA  AKN
Sbjct  675  VLLKTVGLAGVFGMFGTVCLASFVFVFLKVPETKGMPLEVITEFFSVGSKQAITAKN  731



>ref|XP_010097645.1| Monosaccharide-sensing protein 3 [Morus notabilis]
 gb|EXB70345.1| Monosaccharide-sensing protein 3 [Morus notabilis]
Length=737

 Score =   167 bits (423),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            +A++ST  VI+Y C FVM +G IPNILCAEIFPTRVRG+CIA+C+L +WI ++++TYS P
Sbjct  628  NALISTSSVIVYECCFVMAFGVIPNILCAEIFPTRVRGRCIALCSLTYWIGNILITYSFP  687

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAV  375
             M   +GLAGV GIYA+ C++SWIFVFL+VPETKGMPLEVI+EFFA+
Sbjct  688  TMFKLIGLAGVIGIYAIGCIVSWIFVFLKVPETKGMPLEVISEFFAL  734



>ref|XP_006653836.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=727

 Score =   165 bits (417),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA +S +CVI+Y C FVMG+GPIPNILCAEIFPTRVR  C+ +C+L FWICD IVTY  P
Sbjct  602  HATISALCVIVYQCIFVMGFGPIPNILCAEIFPTRVRAICLVLCSLTFWICDTIVTYIFP  661

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  408
            +++  +GLAGVFGI+A+VC ++ +FV+ +VPETKG+PLEV++E +A     +  +K+E
Sbjct  662  ILMEKIGLAGVFGIFAIVCALAVLFVYFKVPETKGIPLEVMSECYACTDSTSRPSKDE  719



>ref|XP_011022133.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011022134.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=719

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
             AV+ST  V++Y   FVMG+G IPNILCAEIFPTRVRG CI IC+L +WI ++ +TYSLP
Sbjct  608  KAVISTGSVMMYLSCFVMGFGVIPNILCAEIFPTRVRGICITICSLTYWIGNITITYSLP  667

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            VML+  GL+GVF IYA+ C +SWIFVFL+VPETKGMPLEVITEFFAVG++ 
Sbjct  668  VMLNFFGLSGVFTIYAIGCAVSWIFVFLKVPETKGMPLEVITEFFAVGSKN  718



>ref|XP_002306419.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
 gb|EEE93415.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
Length=719

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
             AV+ST  V++Y   FVMG+G IPNILCAEIFPTRVRG CI IC+L +WI ++ +TYSLP
Sbjct  608  KAVISTGSVMIYLSCFVMGFGVIPNILCAEIFPTRVRGICITICSLTYWIGNITITYSLP  667

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  387
            VML+  GL+GVF IYA+ C +SWIFVFL+VPETKGMPLEVITEFFAVG++ 
Sbjct  668  VMLNFFGLSGVFTIYAIGCAVSWIFVFLKVPETKGMPLEVITEFFAVGSKN  718



>gb|EMT02609.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=760

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA+LST+ V +YFC FVMG+GPIPNI C+EIFP +VR  C+AIC+L+FWICD+IVTY+LP
Sbjct  586  HALLSTMSVGIYFCIFVMGFGPIPNIFCSEIFPNKVRAICLAICSLIFWICDIIVTYTLP  645

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  402
            V+L  +GLAGVFG+YA+VCV++++FV L+VPETK +P+EVI EF+A+G      AK
Sbjct  646  VLLRYIGLAGVFGVYAIVCVLAFVFVCLKVPETKNIPIEVIAEFYALGGSDYVKAK  701



>ref|XP_006649210.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=668

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +1

Query  70   TICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSS  249
            T  V++Y C FVMG+GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS
Sbjct  550  TGSVVVYLCCFVMGFGPIPNILCAEIFPTRVRGLCIAICSLAFWLADIAVTYSLPVMLSS  609

Query  250  MGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGAR  384
            +GLAGVF IYA VC ++  FV LRVPETKG+PLEVI +FF VGA+
Sbjct  610  LGLAGVFAIYAAVCCVALAFVALRVPETKGLPLEVIIDFFNVGAK  654



>ref|XP_004954530.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=707

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +1

Query  70   TICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSS  249
            T  V+ Y C FVMG+GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVML+ 
Sbjct  579  TGSVMTYLCCFVMGFGPIPNILCAEIFPTRVRGLCIAICSLAFWLADIAVTYSLPVMLNC  638

Query  250  MGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGAR  384
            +GLAGVFG YAVVC ++  FV LRVPETKG+PLEVITEFF VGAR
Sbjct  639  VGLAGVFGFYAVVCCLALAFVALRVPETKGLPLEVITEFFNVGAR  683



>gb|EMS63099.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=714

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = +1

Query  55   HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  234
            HA+LST+ V +YFC FVMG+GPIPNI C+EIFP +VR  C+AIC+L+FWICD+IVTY+LP
Sbjct  587  HALLSTMSVGIYFCIFVMGFGPIPNIFCSEIFPNKVRAICLAICSLIFWICDIIVTYTLP  646

Query  235  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAE-MAKNE*  411
            V+L  +GLAGVFG+YA+VCV++++FV L+VPETK +P+EVI EF+A+G    + + + + 
Sbjct  647  VLLRYIGLAGVFGVYAIVCVLAFVFVCLKVPETKNIPIEVIAEFYALGGSGTQIIQERQK  706

Query  412  MNERKL  429
             N  KL
Sbjct  707  ENSEKL  712



>ref|XP_003573173.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=709

 Score =   163 bits (412),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 69/98 (70%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  88   YFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGV  267
            Y C FVMG+GP+PNILCAEIFPTR RG CIA+C+L FW+ D+ VTYSLPVML S+GLAG+
Sbjct  602  YLCCFVMGFGPVPNILCAEIFPTRARGVCIAVCSLAFWLSDIAVTYSLPVMLGSLGLAGL  661

Query  268  FGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGA  381
            F +YA VC ++++FV LRVPETKG+PLEVI +FF VGA
Sbjct  662  FSVYAAVCCVAFVFVLLRVPETKGLPLEVIADFFTVGA  699



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400