BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN006O03

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001274887.1|  cytochrome b-c1 complex subunit 7                  182   6e-55   Solanum tuberosum [potatoes]
ref|XP_009601498.1|  PREDICTED: cytochrome b-c1 complex subunit 7       181   4e-54   Nicotiana tomentosiformis
ref|XP_004245191.1|  PREDICTED: cytochrome b-c1 complex subunit 7       179   1e-53   Solanum lycopersicum
ref|XP_011081925.1|  PREDICTED: cytochrome b-c1 complex subunit 7       176   2e-52   Sesamum indicum [beniseed]
emb|CDP04801.1|  unnamed protein product                                175   4e-52   Coffea canephora [robusta coffee]
ref|XP_011085617.1|  PREDICTED: cytochrome b-c1 complex subunit 7       175   4e-52   Sesamum indicum [beniseed]
ref|XP_007013811.1|  Cytochrome bd ubiquinol oxidase, 14kDa subunit     172   1e-50   
gb|KHG06265.1|  Cytochrome b-c1 complex subunit 7                       171   2e-50   Gossypium arboreum [tree cotton]
gb|EYU29236.1|  hypothetical protein MIMGU_mgv1a016394mg                169   9e-50   Erythranthe guttata [common monkey flower]
gb|EYU21947.1|  hypothetical protein MIMGU_mgv1a016385mg                169   9e-50   Erythranthe guttata [common monkey flower]
ref|XP_006371731.1|  hypothetical protein POPTR_0018s01370g             168   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010048247.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     168   4e-49   Eucalyptus grandis [rose gum]
gb|KJB80690.1|  hypothetical protein B456_013G110700                    167   4e-49   Gossypium raimondii
ref|XP_010048992.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    167   5e-49   Eucalyptus grandis [rose gum]
ref|XP_006483311.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    167   1e-48   Citrus sinensis [apfelsine]
ref|XP_006450499.1|  hypothetical protein CICLE_v10009887mg             167   1e-48   Citrus clementina [clementine]
ref|XP_011026489.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    166   1e-48   Populus euphratica
gb|ABK92701.1|  unknown                                                 166   2e-48   Populus trichocarpa [western balsam poplar]
gb|ACZ54008.1|  ubiquinol-cytochrome C reductase complex 14kD sub...    166   2e-48   Wolffia arrhiza
gb|EPS66003.1|  hypothetical protein M569_08777                         166   3e-48   Genlisea aurea
ref|XP_003564131.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    166   3e-48   Brachypodium distachyon [annual false brome]
ref|XP_010110339.1|  Cytochrome b-c1 complex subunit 7                  165   4e-48   Morus notabilis
ref|XP_002308646.2|  putative ubiquinol-cytochrome c reductase fa...    165   4e-48   
gb|ADB02891.1|  ubiquinol-cytochrome C reductase complex 14 kDa p...    165   5e-48   Jatropha curcas
gb|AEI83504.1|  ubiquinol-cytochrome C reductase complex 14kD sub...    165   6e-48   Wolffia arrhiza
ref|XP_006394798.1|  hypothetical protein EUTSA_v10005137mg             164   8e-48   Eutrema salsugineum [saltwater cress]
emb|CDY05350.1|  BnaC02g40580D                                          164   8e-48   
ref|XP_006657543.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    164   8e-48   Oryza brachyantha
ref|XP_011019762.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    164   9e-48   Populus euphratica
gb|ADY38691.1|  ubiquinol-cytochrome C reductase complex                164   1e-47   Camellia sinensis [black tea]
ref|XP_006650761.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    164   1e-47   Oryza brachyantha
ref|XP_004136342.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    164   2e-47   Cucumis sativus [cucumbers]
ref|XP_004981353.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    163   2e-47   Setaria italica
ref|XP_004981358.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    163   3e-47   Setaria italica
ref|XP_008466386.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     165   3e-47   
ref|XP_009129963.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     163   3e-47   Brassica rapa
ref|XP_002872165.1|  predicted protein                                  163   3e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_008644048.1|  PREDICTED: hypothetical protein isoform X1         162   5e-47   Zea mays [maize]
ref|XP_006858921.1|  hypothetical protein AMTR_s00068p00053420          162   5e-47   Amborella trichopoda
gb|EEC81709.1|  hypothetical protein OsI_25318                          162   8e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_004955785.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    162   9e-47   Setaria italica
gb|ACG38382.1|  ubiquinol-cytochrome c reductase complex 14 kDa p...    162   9e-47   Zea mays [maize]
ref|XP_010421394.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     162   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002459526.1|  hypothetical protein SORBIDRAFT_02g006120          161   1e-46   Sorghum bicolor [broomcorn]
ref|XP_010432714.1|  PREDICTED: cytochrome b-c1 complex subunit 7-1     161   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_004291494.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     161   1e-46   Fragaria vesca subsp. vesca
ref|XP_002284960.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     161   2e-46   Vitis vinifera
ref|NP_001059146.1|  Os07g0205000                                       162   2e-46   
ref|NP_197927.1|  cytochrome bd ubiquinol oxidase                       160   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286400.1|  hypothetical protein CARUB_v10002241mg             161   3e-46   Capsella rubella
ref|XP_007162074.1|  hypothetical protein PHAVU_001G121500g             160   5e-46   Phaseolus vulgaris [French bean]
ref|XP_009108873.1|  PREDICTED: cytochrome b-c1 complex subunit 7-1     160   5e-46   Brassica rapa
emb|CDY39888.1|  BnaC03g67290D                                          160   5e-46   Brassica napus [oilseed rape]
ref|XP_010447382.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    159   7e-46   Camelina sativa [gold-of-pleasure]
ref|XP_003557405.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    159   8e-46   Brachypodium distachyon [annual false brome]
ref|NP_001237139.1|  uncharacterized protein LOC100499867               159   1e-45   Glycine max [soybeans]
gb|ACG26525.1|  ubiquinol-cytochrome c reductase complex 14 kDa p...    159   1e-45   Zea mays [maize]
emb|CDX68850.1|  BnaC01g06030D                                          159   2e-45   
ref|XP_009403163.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    159   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010526201.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    158   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_008671592.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    160   2e-45   
ref|XP_006392333.1|  hypothetical protein EUTSA_v10023759mg             158   2e-45   Eutrema salsugineum [saltwater cress]
gb|AFK42990.1|  unknown                                                 157   5e-45   Lotus japonicus
ref|XP_007225830.1|  hypothetical protein PRUPE_ppa013437mg             157   6e-45   Prunus persica
ref|XP_010254318.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     157   7e-45   Nelumbo nucifera [Indian lotus]
ref|XP_009125952.1|  PREDICTED: cytochrome b-c1 complex subunit 7-1     155   2e-44   Brassica rapa
ref|NP_194973.1|  Cytochrome bd ubiquinol oxidase                       155   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29857.1|  hypothetical protein AALP_AA7G187900                    155   2e-44   Arabis alpina [alpine rockcress]
ref|XP_002867242.1|  hypothetical protein ARALYDRAFT_913201             155   2e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_002324279.1|  putative ubiquinol-cytochrome c reductase fa...    155   3e-44   
ref|XP_003588718.1|  Cytochrome b-c1 complex subunit                    155   3e-44   Medicago truncatula
ref|XP_010454872.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    155   4e-44   Camelina sativa [gold-of-pleasure]
ref|NP_001170375.1|  ubiquinol-cytochrome c reductase complex pro...    155   4e-44   Zea mays [maize]
ref|XP_010249976.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    155   5e-44   Nelumbo nucifera [Indian lotus]
gb|ACG47614.1|  ubiquinol-cytochrome c reductase complex 14 kDa p...    155   5e-44   Zea mays [maize]
ref|XP_010934817.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    154   1e-43   Elaeis guineensis
ref|XP_006284767.1|  hypothetical protein CARUB_v10006035mg             154   1e-43   Capsella rubella
ref|XP_006600154.1|  PREDICTED: uncharacterized protein LOC100527...    153   2e-43   Glycine max [soybeans]
ref|XP_006412471.1|  hypothetical protein EUTSA_v10026575mg             153   3e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010923367.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    152   6e-43   Elaeis guineensis
ref|XP_009416641.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    152   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001051639.1|  Os03g0806900                                       152   7e-43   
ref|XP_008392137.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    151   1e-42   
ref|XP_009334780.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     151   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_008802707.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    153   1e-42   
ref|XP_010670700.1|  PREDICTED: cytochrome b-c1 complex subunit 7-2     151   2e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004498653.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    150   2e-42   Cicer arietinum [garbanzo]
gb|EMT14168.1|  Cytochrome b-c1 complex subunit 7                       150   3e-42   
gb|ABK94034.1|  unknown                                                 149   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008394045.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    147   4e-41   
ref|XP_010526202.1|  PREDICTED: cytochrome b-c1 complex subunit 7-1     140   1e-38   
gb|KCW81433.1|  hypothetical protein EUGRSUZ_C02813                     140   1e-38   Eucalyptus grandis [rose gum]
gb|ACN36794.1|  unknown                                                 130   5e-35   Zea mays [maize]
gb|ABQ42066.1|  ubiquinol-cytochrome C reductase complex 14 kDa p...    129   2e-34   Sonneratia caseolaris
gb|ABQ42065.1|  ubiquinol-cytochrome C reductase complex 14 kDa p...    129   2e-34   Sonneratia alba
ref|XP_011026490.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    129   4e-34   Populus euphratica
gb|KDO61658.1|  hypothetical protein CISIN_1g033311mg                   128   7e-34   Citrus sinensis [apfelsine]
ref|XP_006450500.1|  hypothetical protein CICLE_v10009887mg             128   2e-33   
gb|KJB80691.1|  hypothetical protein B456_013G110700                    127   2e-33   Gossypium raimondii
gb|KJB80692.1|  hypothetical protein B456_013G110700                    127   2e-33   Gossypium raimondii
ref|XP_004981357.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    126   7e-33   
ref|NP_001169405.1|  hypothetical protein                               126   1e-32   Zea mays [maize]
emb|CDY70525.1|  BnaAnng34010D                                          124   4e-32   Brassica napus [oilseed rape]
ref|XP_002515558.1|  Ubiquinol-cytochrome c reductase complex 14 ...    123   7e-32   
gb|ACS68687.1|  ubiquinol-cytochrome C reductase complex 14 kDa p...    121   1e-31   Sonneratia alba
ref|NP_001190394.1|  cytochrome bd ubiquinol oxidase                    122   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ABK22110.1|  unknown                                                 122   3e-31   Picea sitchensis
ref|NP_849484.1|  Cytochrome bd ubiquinol oxidase                       121   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403171.1|  PREDICTED: cytochrome b-c1 complex subunit 7...    120   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235489.1|  uncharacterized protein LOC100527652               120   1e-30   Glycine max [soybeans]
gb|EMS59356.1|  Cytochrome b-c1 complex subunit 7                       120   3e-30   Triticum urartu
ref|XP_003588719.1|  Cytochrome b-c1 complex subunit                    118   6e-30   
gb|KDD73783.1|  hypothetical protein H632_c1840p0                       106   3e-25   Helicosporidium sp. ATCC 50920
gb|EEC83182.1|  hypothetical protein OsI_28424                          102   9e-24   Oryza sativa Indica Group [Indian rice]
gb|AFW67282.1|  hypothetical protein ZEAMMB73_980436                  99.8    5e-23   
ref|XP_001777123.1|  predicted protein                                97.1    1e-21   
gb|KDO61659.1|  hypothetical protein CISIN_1g033311mg                 96.7    1e-21   Citrus sinensis [apfelsine]
ref|NP_001061357.1|  Os08g0246400                                     96.7    1e-21   
ref|XP_001754627.1|  predicted protein                                95.5    3e-21   
ref|XP_008779665.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  93.2    7e-21   
ref|XP_010493801.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  92.4    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010107306.1|  Cytochrome b-c1 complex subunit 7                92.0    3e-20   
ref|XP_005645464.1|  14 kDa subunit of cytochrome bd ubiquinol ox...  92.4    5e-20   Coccomyxa subellipsoidea C-169
ref|XP_002977783.1|  hypothetical protein SELMODRAFT_228505           91.7    8e-20   Selaginella moellendorffii
ref|XP_002986903.1|  hypothetical protein SELMODRAFT_235141           91.7    9e-20   Selaginella moellendorffii
ref|XP_001782160.1|  predicted protein                                89.7    4e-19   
ref|XP_005851167.1|  hypothetical protein CHLNCDRAFT_33822            87.0    5e-18   Chlorella variabilis
ref|XP_003081235.1|  ubiquinol-cytochrome C reductase complex 14 ...  85.1    2e-17   Ostreococcus tauri
ref|XP_001419785.1|  predicted protein                                85.1    2e-17   Ostreococcus lucimarinus CCE9901
ref|XP_009769317.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  83.2    5e-17   Nicotiana sylvestris
ref|XP_007510445.1|  predicted protein                                84.0    6e-17   Bathycoccus prasinos
ref|XP_010255680.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  84.3    8e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008354902.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  82.0    2e-16   
ref|XP_002502572.1|  mitochondrial tRNA import complex                81.3    7e-16   Micromonas commoda
ref|XP_001696308.1|  ubiquinol:cytochrome c oxidoreductase 14 kDa...  79.3    3e-15   Chlamydomonas reinhardtii
ref|XP_009605812.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  78.2    4e-15   Nicotiana tomentosiformis
ref|XP_011398978.1|  Cytochrome b-c1 complex subunit 7                78.6    5e-15   Auxenochlorella protothecoides
ref|XP_003059247.1|  mitochondrial tRNA import complex                75.9    5e-14   Micromonas pusilla CCMP1545
ref|XP_002945797.1|  hypothetical protein VOLCADRAFT_78796            75.1    1e-13   Volvox carteri f. nagariensis
ref|XP_010494051.1|  PREDICTED: uncharacterized protein LOC104771252  72.0    9e-13   Camelina sativa [gold-of-pleasure]
gb|EEE68322.1|  hypothetical protein OsJ_26597                        62.4    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009636648.1|  PREDICTED: cytochrome b-c1 complex subunit 7     55.5    4e-07   Egretta garzetta
gb|KFP15525.1|  Cytochrome b-c1 complex subunit 7                     55.5    7e-07   Egretta garzetta
ref|XP_009556309.1|  PREDICTED: cytochrome b-c1 complex subunit 7     54.7    7e-07   Cuculus canorus
gb|KFO74045.1|  Cytochrome b-c1 complex subunit 7                     55.1    1e-06   Cuculus canorus
ref|XP_005027050.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  54.3    1e-06   
ref|XP_010195129.1|  PREDICTED: cytochrome b-c1 complex subunit 7     54.3    1e-06   Colius striatus
ref|XP_009467582.1|  PREDICTED: cytochrome b-c1 complex subunit 7     54.3    1e-06   Nipponia nippon
gb|EOA96045.1|  Cytochrome b-c1 complex subunit 7                     54.7    2e-06   Anas platyrhynchos [duck]
gb|EMC90685.1|  Cytochrome b-c1 complex subunit 7                     54.3    2e-06   
gb|KFR01718.1|  Cytochrome b-c1 complex subunit 7                     54.3    2e-06   Nipponia nippon
ref|XP_009085276.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.5    2e-06   
ref|XP_009505978.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.5    2e-06   Phalacrocorax carbo [common cormorant]
ref|XP_005499486.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  54.3    2e-06   
ref|XP_008937646.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.9    2e-06   Merops nubicus
gb|KFZ54353.1|  Cytochrome b-c1 complex subunit 7                     53.9    2e-06   Podiceps cristatus
gb|KGL98728.1|  Cytochrome b-c1 complex subunit 7                     53.9    3e-06   Charadrius vociferus
ref|XP_010575383.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  53.5    3e-06   Haliaeetus leucocephalus
ref|XP_005231059.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  53.1    3e-06   Falco peregrinus [peregrine]
gb|KFO92935.1|  Cytochrome b-c1 complex subunit 7                     53.9    3e-06   Buceros rhinoceros silvestris
gb|KFZ54545.1|  Cytochrome b-c1 complex subunit 7                     53.9    3e-06   Antrostomus carolinensis
gb|KFM04960.1|  Cytochrome b-c1 complex subunit 7                     53.9    3e-06   Aptenodytes forsteri
ref|XP_009273783.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.5    3e-06   
ref|XP_009489537.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    3e-06   Pelecanus crispus
gb|KFQ81797.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Phoenicopterus ruber ruber
gb|KFO10749.1|  Cytochrome b-c1 complex subunit 7                     53.5    3e-06   Balearica regulorum gibbericeps
ref|XP_009693581.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    3e-06   Cariama cristata
gb|KFO56846.1|  Cytochrome b-c1 complex subunit 7                     53.5    4e-06   Corvus brachyrhynchos
ref|XP_010004743.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    4e-06   Chaetura pelagica
ref|XP_010403256.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    4e-06   Corvus cornix cornix
ref|XP_010292664.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.5    4e-06   Phaethon lepturus
gb|KFV69193.1|  Cytochrome b-c1 complex subunit 7                     53.1    4e-06   Picoides pubescens
ref|XP_005042381.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  52.8    4e-06   Ficedula albicollis
ref|NP_001232783.1|  cytochrome b-c1 complex subunit 7-like           53.5    4e-06   Taeniopygia guttata
gb|KFU96249.1|  Cytochrome b-c1 complex subunit 7                     53.1    4e-06   Chaetura pelagica
gb|KFQ66398.1|  Cytochrome b-c1 complex subunit 7                     53.1    5e-06   Pelecanus crispus
ref|XP_010128833.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.8    5e-06   Chlamydotis macqueenii
ref|XP_005422967.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  52.8    5e-06   Geospiza fortis
ref|XP_009890227.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    5e-06   Charadrius vociferus
ref|XP_009901258.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    5e-06   Picoides pubescens
ref|XP_005479545.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  52.4    5e-06   
gb|KFP62603.1|  Cytochrome b-c1 complex subunit 7                     52.8    6e-06   Cariama cristata
gb|KFQ33774.1|  Cytochrome b-c1 complex subunit 7                     52.8    6e-06   Mesitornis unicolor
gb|KFV10010.1|  Cytochrome b-c1 complex subunit 7                     52.8    6e-06   Tauraco erythrolophus
ref|XP_008628958.1|  PREDICTED: cytochrome b-c1 complex subunit 7     53.1    7e-06   Corvus brachyrhynchos
ref|XP_008862571.1|  hypothetical protein H310_01284                  52.8    7e-06   Aphanomyces invadans
gb|EWM28744.1|  mitochondrial trna import complex                     53.1    7e-06   Nannochloropsis gaditana
ref|XP_009977162.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.8    7e-06   Tauraco erythrolophus
ref|XP_010180848.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.8    7e-06   Mesitornis unicolor
ref|XP_008608179.1|  hypothetical protein SDRG_04290                  52.4    8e-06   Saprolegnia diclina VS20
gb|KFP92467.1|  Cytochrome b-c1 complex subunit 7                     52.4    9e-06   Apaloderma vittatum
ref|XP_009875125.1|  PREDICTED: cytochrome b-c1 complex subunit 7     52.0    1e-05   Apaloderma vittatum
gb|KDO27696.1|  hypothetical protein SPRG_07325                       52.0    1e-05   Saprolegnia parasitica CBS 223.65
ref|XP_005517066.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  52.0    1e-05   Pseudopodoces humilis [Tibetan ground-jay]
pdb|3CWB|F  Chain F, Chicken Cytochrome Bc1 Complex Inhibited By ...  52.0    1e-05   Gallus gallus [bantam]
dbj|BAN20761.1|  ubiquinol-cytochrome c reductase complex 14 kd p...  51.6    2e-05   Riptortus pedestris
gb|KFW81092.1|  Cytochrome b-c1 complex subunit 7                     51.6    2e-05   Manacus vitellinus
ref|XP_008922299.1|  PREDICTED: cytochrome b-c1 complex subunit 7     51.2    2e-05   Manacus vitellinus
ref|XP_004940015.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.8    3e-05   
pdb|3H1H|F  Chain F, Cytochrome Bc1 Complex From Chicken              50.8    3e-05   Gallus gallus [bantam]
ref|XP_010707455.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.8    3e-05   
ref|XP_004940014.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.8    3e-05   
ref|XP_009674294.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.1    4e-05   Struthio camelus australis
ref|XP_007547796.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.8    4e-05   Poecilia formosa
ref|XP_005760154.1|  ubiquinol-cytochrome C reductase complex 14k...  50.8    4e-05   Emiliania huxleyi CCMP1516
gb|EHB12641.1|  Cytochrome b-c1 complex subunit 7                     50.4    4e-05   Heterocephalus glaber [naked mole rat]
ref|XP_009816014.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.1    5e-05   Gavia stellata
gb|EDM07587.1|  rCG63535                                              49.7    5e-05   Rattus norvegicus [brown rat]
gb|KFV81894.1|  Cytochrome b-c1 complex subunit 7                     50.4    5e-05   Struthio camelus australis
ref|XP_004645372.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.4    5e-05   
ref|XP_003386823.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.4    6e-05   Amphimedon queenslandica
gb|KFP84293.1|  Cytochrome b-c1 complex subunit 7                     50.1    6e-05   Acanthisitta chloris
ref|XP_010009436.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.1    6e-05   Nestor notabilis
gb|KFQ41982.1|  Cytochrome b-c1 complex subunit 7                     50.1    6e-05   Nestor notabilis
ref|XP_418347.4|  PREDICTED: cytochrome b-c1 complex subunit 7-li...  50.8    7e-05   
ref|XP_004631617.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  50.1    7e-05   
ref|XP_009076930.1|  PREDICTED: cytochrome b-c1 complex subunit 7     50.1    7e-05   Acanthisitta chloris
gb|KFV45193.1|  Cytochrome b-c1 complex subunit 7                     50.1    7e-05   Gavia stellata
ref|XP_009821544.1|  hypothetical protein H257_00515                  49.7    8e-05   Aphanomyces astaci
gb|AAB30496.1|  cytochrome-c reductase 14 kda subunit {P1 peptide...  48.5    8e-05   Solanum tuberosum [potatoes]
ref|XP_005150932.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  49.7    1e-04   
ref|NP_001019613.1|  cytochrome b-c1 complex subunit 7                49.7    1e-04   Danio rerio [leopard danio]
ref|NP_001121025.1|  cytochrome b-c1 complex subunit 7                49.7    1e-04   Rattus norvegicus [brown rat]
ref|XP_005797417.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  49.7    1e-04   Xiphophorus maculatus
ref|XP_004638531.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  49.3    1e-04   
ref|NP_080495.1|  cytochrome b-c1 complex subunit 7                   49.3    1e-04   Mus musculus [mouse]
ref|XP_009037032.1|  hypothetical protein AURANDRAFT_26379            48.9    1e-04   Aureococcus anophagefferens
ref|XP_004995655.1|  ubiquinol-cytochrome C reductase                 49.3    1e-04   Salpingoeca rosetta
gb|AAH31607.1|  Ubiquinol-cytochrome c reductase binding protein      49.3    1e-04   Mus musculus [mouse]
sp|Q9D855.3|QCR7_MOUSE  RecName: Full=Cytochrome b-c1 complex sub...  49.3    1e-04   Mus musculus [mouse]
ref|XP_005181276.1|  PREDICTED: cytochrome b-c1 complex subunit 7     49.3    1e-04   Musca domestica
gb|KHN32490.1|  Cytochrome b-c1 complex subunit 7                     48.1    2e-04   Glycine soja [wild soybean]
ref|XP_004635428.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.9    2e-04   
ref|XP_004474746.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.9    2e-04   Dasypus novemcinctus
ref|XP_003479958.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.9    2e-04   Cavia porcellus [guinea pig]
ref|XP_004627307.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.9    2e-04   
ref|XP_002112931.1|  expressed hypothetical protein                   48.9    2e-04   Trichoplax adhaerens
gb|KFP07518.1|  Cytochrome b-c1 complex subunit 7                     48.1    2e-04   Calypte anna
ref|XP_006273293.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.1    2e-04   
emb|CDW54961.1|  cytochrome b c1 complex subunit 7                    48.5    2e-04   Trichuris trichiura
ref|XP_004639579.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.5    2e-04   
gb|EHH64317.1|  Ubiquinol-cytochrome c reductase complex 14 kDa p...  48.5    2e-04   Macaca fascicularis [crab eating macaque]
ref|XP_004580673.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.5    3e-04   Ochotona princeps [southern American pika]
ref|XP_008500690.1|  PREDICTED: cytochrome b-c1 complex subunit 7     48.1    3e-04   Calypte anna
ref|XP_006130634.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.8    3e-04   Pelodiscus sinensis [Chinese softshell turtle]
pdb|1QCR|F  Chain F, Crystal Structure Of Bovine Mitochondrial Cy...  48.1    3e-04   Bos taurus [bovine]
ref|XP_002160238.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  48.1    4e-04   Hydra vulgaris
pdb|1SQP|F  Chain F, Crystal Structure Analysis Of Bovine Bc1 Wit...  48.1    4e-04   Bos taurus [bovine]
ref|XP_001505521.2|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    4e-04   
ref|XP_006727830.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.4    4e-04   Leptonychotes weddellii
pdb|1BGY|F  Chain F, Cytochrome Bc1 Complex From Bovine               47.8    4e-04   Bos taurus [bovine]
gb|ACO13731.1|  Cytochrome b-c1 complex subunit 7                     47.8    4e-04   Esox lucius
ref|XP_006130633.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.8    4e-04   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_002414334.1|  ubiquinol cytochrome C reductase, subunit QC...  47.4    5e-04   Ixodes scapularis [blacklegged tick]
gb|EDL39149.1|  mCG8638                                               47.8    5e-04   Mus musculus [mouse]
pdb|4D6T|F  Chain F, Cytochrome Bc1 Bound To The 4(1h)-pyridone G...  47.8    5e-04   Bos taurus [bovine]
ref|XP_004529599.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.8    5e-04   Ceratitis capitata [medfly]
ref|XP_007886092.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.8    5e-04   Callorhinchus milii [Australian ghost shark]
gb|KFO35256.1|  Cytochrome b-c1 complex subunit 7                     47.4    5e-04   Fukomys damarensis [Damara mole rat]
ref|XP_003938798.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    6e-04   Saimiri boliviensis boliviensis
ref|XP_011138061.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.4    6e-04   Harpegnathos saltator
ref|XP_003408450.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    6e-04   Loxodonta africana [African bush elephant]
ref|XP_011198166.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    6e-04   Bactrocera dorsalis [papaya fruit fly]
ref|XP_010902314.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    6e-04   Esox lucius
ref|XP_010617892.1|  PREDICTED: cytochrome b-c1 complex subunit 7     47.4    6e-04   Fukomys damarensis [Damara mole rat]
dbj|BAE01955.1|  unnamed protein product                              46.6    7e-04   Macaca fascicularis [crab eating macaque]
gb|EFN85398.1|  Cytochrome b-c1 complex subunit 7                     47.0    7e-04   Harpegnathos saltator
ref|XP_010373371.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    7e-04   Rhinopithecus roxellana
ref|XP_006037455.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.4    7e-04   Alligator sinensis
ref|XP_002732317.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.4    7e-04   Saccoglossus kowalevskii
ref|XP_002098712.1|  GE23784                                          47.4    7e-04   Drosophila yakuba
ref|XP_002060147.1|  GJ18506                                          47.4    7e-04   Drosophila virilis
ref|XP_007620668.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  46.6    8e-04   
dbj|BAG34699.1|  unnamed protein product                              47.0    8e-04   Homo sapiens [man]
ref|XP_003268378.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    8e-04   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_009066148.1|  hypothetical protein LOTGIDRAFT_197554           47.4    9e-04   Lottia gigantea
ref|XP_006635922.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    9e-04   Lepisosteus oculatus
ref|XP_006635923.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    0.001   
ref|XP_008253992.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    0.001   
ref|XP_002710750.1|  PREDICTED: cytochrome b-c1 complex subunit 7...  47.0    0.001   
gb|EHJ73854.1|  ubiquinol-cytochrome C reductase complex 14kD sub...  47.0    0.001   



>ref|NP_001274887.1| cytochrome b-c1 complex subunit 7 [Solanum tuberosum]
 sp|P48502.1|QCR7_SOLTU RecName: Full=Cytochrome b-c1 complex subunit 7; AltName: Full=CR14; 
AltName: Full=Complex III subunit 7; AltName: Full=Complex 
III subunit VII; AltName: Full=Ubiquinol-cytochrome c 
reductase complex 14 kDa protein [Solanum tuberosum]
 emb|CAA55863.1| ubiquinol--cytochrome c reductase [Solanum tuberosum]
Length=123

 Score =   182 bits (463),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SSFSRWLVDPK+NPLAAIH KTL SRLR YGLR+DDLYDP YDLD+KEALNRLPREIVDA
Sbjct  3    SSFSRWLVDPKKNPLAAIHMKTLSSRLRNYGLRHDDLYDPMYDLDVKEALNRLPREIVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRL RAMDLSMKH YLPEDLQAMQTPFRNYLQ+MLA+VK+E AEREALGALPLYQRT+
Sbjct  63   RNQRLLRAMDLSMKHQYLPEDLQAMQTPFRNYLQEMLALVKRESAEREALGALPLYQRTL  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_009601498.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nicotiana tomentosiformis]
 ref|XP_009781040.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nicotiana sylvestris]
 ref|XP_009781041.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nicotiana sylvestris]
Length=123

 Score =   181 bits (458),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            S+FS+WLVDPK+NPLAAIHKK+L +RLR YGLRYDDL+DP YDLD+KEALNRLPREIVDA
Sbjct  3    STFSKWLVDPKKNPLAAIHKKSLSARLRNYGLRYDDLHDPMYDLDVKEALNRLPREIVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            R QRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA+VK+ERAEREALGALPLYQRTI
Sbjct  63   RIQRLKRAMDLSMKHQYLPEDLQAMQTPFRSYLQEMLALVKRERAEREALGALPLYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_004245191.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Solanum lycopersicum]
Length=123

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SSFSRWLVDPK+NPLAAIH KTL SRLR YGLRYDDLYDP YDLD+KEALNRLPREIVDA
Sbjct  3    SSFSRWLVDPKKNPLAAIHMKTLSSRLRNYGLRYDDLYDPMYDLDVKEALNRLPREIVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRL RAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +VK+E AEREALGALPLYQRT+
Sbjct  63   RNQRLLRAMDLSMKHQYLPEDLQAMQTPFRSYLQEMLTLVKRESAEREALGALPLYQRTL  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_011081925.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Sesamum indicum]
Length=123

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            S+ ++WLVDP RNPLAA+H KTL  RLRKYGLRYDDLYDP YDLD+KEALNRLPREIVDA
Sbjct  3    SALTKWLVDPNRNPLAALHMKTLSKRLRKYGLRYDDLYDPMYDLDVKEALNRLPREIVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA+VK+E AEREALGALPLYQRTI
Sbjct  63   RNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLALVKRENAEREALGALPLYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>emb|CDP04801.1| unnamed protein product [Coffea canephora]
Length=122

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S +RWLVDPKRNPLAAIHKK LD RLRKYGLRYDDLYDP YDLDIKEALNRLPR IVD
Sbjct  1    MASLARWLVDPKRNPLAAIHKKALDRRLRKYGLRYDDLYDPMYDLDIKEALNRLPRPIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLS+KH YLPEDLQ  QTPFR+YLQ+MLA+VK+ERAEREALGA PLYQRT
Sbjct  61   ARNQRLKRAMDLSLKHQYLPEDLQVQQTPFRSYLQEMLALVKRERAEREALGAQPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_011085617.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Sesamum indicum]
Length=123

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            ++ S+WLVDPKRNPLAA+H KTL +RL KYGLRYDDLYDP YDLD+KEALNRLP+E+VDA
Sbjct  3    AALSKWLVDPKRNPLAALHMKTLSNRLSKYGLRYDDLYDPMYDLDVKEALNRLPKEVVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA++KKE AEREALGALPLYQRTI
Sbjct  63   RNQRLKRAMDLSMKHDYLPEDLQAMQTPFRSYLQEMLALIKKENAEREALGALPLYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_007013811.1| Cytochrome bd ubiquinol oxidase, 14kDa subunit [Theobroma cacao]
 gb|EOY31430.1| Cytochrome bd ubiquinol oxidase, 14kDa subunit [Theobroma cacao]
Length=122

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK++ LAA+H K L +RLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MSSFLQSFLDPKKSWLAALHMKALSTRLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQAMQTPFR+YLQDMLA+VKKERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHKYLPKDLQAMQTPFRSYLQDMLALVKKERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|KHG06265.1| Cytochrome b-c1 complex subunit 7 [Gossypium arboreum]
 gb|KJB83334.1| hypothetical protein B456_013G241600 [Gossypium raimondii]
Length=122

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF + L+DPK++ LA++H K L +RLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MSSFLQSLLDPKKSWLASLHMKALTTRLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQ MQTPFR+YLQDMLA+VKKERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQKMQTPFRSYLQDMLALVKKERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|EYU29236.1| hypothetical protein MIMGU_mgv1a016394mg [Erythranthe guttata]
 gb|EYU29237.1| hypothetical protein MIMGU_mgv1a016394mg [Erythranthe guttata]
 gb|EYU29238.1| hypothetical protein MIMGU_mgv1a016394mg [Erythranthe guttata]
Length=123

 Score =   169 bits (429),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            ++ S+W+VDPKRNPLAA H KTL  RL KYGLRYDDLYDP Y+LD+KEA+NRLPREIVDA
Sbjct  3    TAISKWIVDPKRNPLAAYHMKTLSGRLSKYGLRYDDLYDPMYELDVKEAMNRLPREIVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLP+DLQ MQTPFR+YLQ+MLA VK+E+AEREALGALPLYQRT 
Sbjct  63   RNQRLKRAMDLSMKHQYLPDDLQRMQTPFRSYLQEMLAFVKREQAEREALGALPLYQRTF  122

Query  401  P  403
            P
Sbjct  123  P  123



>gb|EYU21947.1| hypothetical protein MIMGU_mgv1a016385mg [Erythranthe guttata]
Length=123

 Score =   169 bits (429),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            S+ S+WLVDP RNPLA +H KT+ +RL+KYGLR+DDLYDP Y+LD+KEALNRLPREIVDA
Sbjct  3    SAISKWLVDPTRNPLARLHMKTIGNRLKKYGLRHDDLYDPMYELDVKEALNRLPREIVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLP DLQAMQTPFR YLQ+MLA+VK+E AEREALGALPLYQRT+
Sbjct  63   RNQRLKRAMDLSMKHDYLPADLQAMQTPFRTYLQEMLALVKRENAEREALGALPLYQRTL  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_006371731.1| hypothetical protein POPTR_0018s01370g [Populus trichocarpa]
 gb|ERP49528.1| hypothetical protein POPTR_0018s01370g [Populus trichocarpa]
Length=122

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + LVDP++N LA  H KTL SRLR+YGLRYDDLYDPYY+LDIKEALNRLPREIVD
Sbjct  1    MASFLQSLVDPRKNWLAKQHMKTLSSRLRRYGLRYDDLYDPYYELDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +VKKERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLTLVKKERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_010048247.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Eucalyptus grandis]
 gb|KCW80449.1| hypothetical protein EUGRSUZ_C01792 [Eucalyptus grandis]
 gb|KCW80450.1| hypothetical protein EUGRSUZ_C01792 [Eucalyptus grandis]
Length=122

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + L+DPK+N LAA H KT+  RLR YGLRYDDLYDPYYDLD+KEALNRLPREIVD
Sbjct  1    MTSFLQSLLDPKKNWLAAQHMKTISKRLRHYGLRYDDLYDPYYDLDVKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPE+LQAMQTPFR+YLQDMLA+VKKE++EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPENLQAMQTPFRSYLQDMLALVKKEKSEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|KJB80690.1| hypothetical protein B456_013G110700 [Gossypium raimondii]
Length=122

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK++ LAA+H K+L  RLRKYGLRYDDLYDPYYDLDIKEALNRLPREIV+
Sbjct  1    MSSFLQSFLDPKKSWLAALHMKSLSKRLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVN  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPE+LQ MQTPFR+YLQDMLA+VKKERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPENLQQMQTPFRSYLQDMLALVKKERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_010048992.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Eucalyptus 
grandis]
 gb|KCW81434.1| hypothetical protein EUGRSUZ_C02813 [Eucalyptus grandis]
Length=122

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK+N LAA H KT+  RLR YGLRYDDLYD YY+LD+KEALNRLPREIVD
Sbjct  1    MSSFLQSFLDPKKNWLAAQHMKTISKRLRHYGLRYDDLYDGYYELDVKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPE+LQAMQTPFR+YLQDML +VKKERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPENLQAMQTPFRSYLQDMLTLVKKERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_006483311.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Citrus sinensis]
 gb|KDO61657.1| hypothetical protein CISIN_1g033311mg [Citrus sinensis]
Length=122

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + L+DPK+N LAA H KT+  RLR +GLRYDDLYDPYYDLDIKEAL+RLPREIVD
Sbjct  1    MASLLQSLLDPKKNWLAAQHMKTISKRLRNFGLRYDDLYDPYYDLDIKEALDRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFRNYLQDMLA+VK+E+AEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRNYLQDMLALVKREKAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_006450499.1| hypothetical protein CICLE_v10009887mg [Citrus clementina]
 gb|ESR63739.1| hypothetical protein CICLE_v10009887mg [Citrus clementina]
Length=122

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + L+DPK+N LAA H KT+  RLR +GLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MASLLQSLLDPKKNWLAAQHMKTISKRLRNFGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+VK+E+AEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLALVKREKAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_011026489.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 isoform X1 [Populus 
euphratica]
Length=122

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DP++N LA  H K L SRLR+YGLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MASFLQSFIDPRKNWLAKQHMKALSSRLRRYGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +VKKERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLTLVKKERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|ABK92701.1| unknown [Populus trichocarpa]
Length=122

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DP++N LA  H KT+ SRLR+YGLRYDDLYDPYY+LDIKEALNRLPREI+D
Sbjct  1    MASFLQSFIDPRKNWLAKQHMKTISSRLRRYGLRYDDLYDPYYELDIKEALNRLPREIID  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHAYLPEDLQAMQTPFRSYLQEMLAFVKRERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|ACZ54008.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Wolffia 
arrhiza]
Length=124

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  32   MAMSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREI  211
            MAM+ F RWLVDP RN LAA H K +  RLRKYGLRYDDLYDP +DLDIKEAL RLPREI
Sbjct  1    MAMAGFMRWLVDPSRNWLAAQHCKAISRRLRKYGLRYDDLYDPLHDLDIKEALARLPREI  60

Query  212  VDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQ  391
            V ARNQRLKRAMDLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKE+AEREALGA PLYQ
Sbjct  61   VHARNQRLKRAMDLSMKHDYLPEDLQALQTPFRSYLRDMLALVKKEKAEREALGAPPLYQ  120

Query  392  RTIP  403
            RTIP
Sbjct  121  RTIP  124



>gb|EPS66003.1| hypothetical protein M569_08777 [Genlisea aurea]
Length=123

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            S+ ++WLVDP RNPLA IH KT+ +RLR+YGLRYDDLYDP +DLDIKEALNRLP E+V A
Sbjct  3    SAIAKWLVDPTRNPLARIHMKTVGNRLRRYGLRYDDLYDPKFDLDIKEALNRLPNEVVLA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLPE+LQAMQTPFR+YLQ MLA+VK+ERAEREALGALPLYQRTI
Sbjct  63   RNQRLKRAMDLSMKHEYLPENLQAMQTPFRSYLQPMLALVKRERAEREALGALPLYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_003564131.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Brachypodium 
distachyon]
Length=126

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S+FS+W V+P+RNPLA +HK T+ SRL K+GLRYDDLYDPY++LDIKEAL RLPRE+VD
Sbjct  5    LSAFSQWFVNPRRNPLARLHKYTVASRLTKFGLRYDDLYDPYFELDIKEALGRLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+QRLKRAMDLSMKH YLP+DLQA+QTPFR+YL DMLA+VKKE AEREALGALPLY+RT
Sbjct  65   ARHQRLKRAMDLSMKHQYLPDDLQALQTPFRSYLTDMLALVKKEAAEREALGALPLYERT  124

Query  398  IP  403
            +P
Sbjct  125  LP  126



>ref|XP_010110339.1| Cytochrome b-c1 complex subunit 7 [Morus notabilis]
 gb|EXC26026.1| Cytochrome b-c1 complex subunit 7 [Morus notabilis]
Length=122

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF + L+DPK++ LAA+H K+L  RLR YGLRYDDLYDPYYDLD+KEALNRLPREIVD
Sbjct  1    MSSFLQGLLDPKKSRLAAVHMKSLSRRLRNYGLRYDDLYDPYYDLDVKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+QRLKRAMDLSMKH YL EDLQAMQTPFR+YLQ+MLA+VK+ERAEREALGALPLYQR+
Sbjct  61   ARHQRLKRAMDLSMKHQYLAEDLQAMQTPFRSYLQEMLALVKRERAEREALGALPLYQRS  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_002308646.2| putative ubiquinol-cytochrome c reductase family protein [Populus 
trichocarpa]
 gb|EEE92169.2| putative ubiquinol-cytochrome c reductase family protein [Populus 
trichocarpa]
Length=122

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DP++N LA  H KT+ SRLR+YGLRYDDLYDPYY+LDIKEALNRLPREI+D
Sbjct  1    MASFLQSFIDPRKNWLAKQHMKTISSRLRRYGLRYDDLYDPYYELDIKEALNRLPREIID  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHDYLPEDLQAMQTPFRSYLQEMLAFVKRERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|ADB02891.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Jatropha 
curcas]
 gb|KDP33618.1| hypothetical protein JCGZ_07189 [Jatropha curcas]
Length=122

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSS  + L+DP++N  A  H K L  RLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MSSLLQSLIDPRKNWFAKQHMKALSKRLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQA QTPFRNYLQDMLA+VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQARQTPFRNYLQDMLALVKRERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|AEI83504.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Wolffia 
arrhiza]
Length=122

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+ F RWLVDP RN LAA H K +  RLRKYGLRYDDLYDP +DLDIKEAL RLPREIVD
Sbjct  1    MAGFMRWLVDPSRNWLAAQHCKAISRRLRKYGLRYDDLYDPLHDLDIKEALARLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKE+AEREALGA PLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHDYLPEDLQALQTPFRSYLRDMLALVKKEKAEREALGAPPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_006394798.1| hypothetical protein EUTSA_v10005137mg [Eutrema salsugineum]
 gb|ESQ32084.1| hypothetical protein EUTSA_v10005137mg [Eutrema salsugineum]
Length=122

 Score =   164 bits (416),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF ++LVDP++N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKEALNRLPREIVD
Sbjct  1    MASFLQYLVDPRKNFLARLHMKSISNRLRRYGLRYDDLYDPLYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRA+DLSMKH YLP++LQAMQTPFR+YLQ+MLA+VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRALDLSMKHEYLPDNLQAMQTPFRSYLQEMLALVKRERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>emb|CDY05350.1| BnaC02g40580D [Brassica napus]
Length=123

 Score =   164 bits (416),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SSF + LVDPK+N LA +H K++ +RLRKYGLRYDDLYDP YDLDIKEALNRLPRE+VDA
Sbjct  3    SSFLQRLVDPKKNFLARLHMKSVSNRLRKYGLRYDDLYDPMYDLDIKEALNRLPREVVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+VK+ERAEREALGALPLYQRTI
Sbjct  63   RNQRLKRAMDLSMKHEYLPDDLQAVQTPFRSYLQEMLALVKRERAEREALGALPLYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_006657543.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Oryza brachyantha]
Length=123

 Score =   164 bits (416),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +SS S WLV+P+RNPLA +H   + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  2    LSSLSAWLVNPRRNPLARLHMNAVASRLRKYGLRYDDLYDPYHDLDIKEALGRLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP D+QA+QTPFR YL DMLA+VKKE AEREALGALPLYQRT
Sbjct  62   ARNQRLKRAMDLSMKHQYLPADVQAIQTPFRGYLSDMLALVKKEAAEREALGALPLYQRT  121

Query  398  IP  403
            IP
Sbjct  122  IP  123



>ref|XP_011019762.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Populus 
euphratica]
Length=122

 Score =   164 bits (415),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DP++N LA  H KTL SRLR+YGLRYDDLYDPYY+LDIKEALNRLPREIVD
Sbjct  1    MASFLQSFIDPRKNWLAKQHMKTLSSRLRRYGLRYDDLYDPYYELDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+QRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA VK+ERAEREALGA+PLYQRT
Sbjct  61   ARHQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLAFVKRERAEREALGAMPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|ADY38691.1| ubiquinol-cytochrome C reductase complex [Camellia sinensis]
Length=123

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SS  +WLVDPK+N  AA H K++  RLR+YGLRYDDL+DPYYDLD+KEALNRLPREIVDA
Sbjct  3    SSLMKWLVDPKKNWFAAQHMKSISKRLRRYGLRYDDLFDPYYDLDVKEALNRLPREIVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLPE LQAMQTP+R+YLQDMLA+VK+E AEREALGALPLYQRTI
Sbjct  63   RNQRLKRAMDLSMKHDYLPEHLQAMQTPYRSYLQDMLALVKRENAEREALGALPLYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_006650761.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Oryza brachyantha]
Length=126

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S+FS+W V+P+RNPLA IH +T+ SRLRKYGLRYDDLYDP +DLDIKEAL RLPRE+VD
Sbjct  5    LSAFSQWFVNPRRNPLARIHMQTVSSRLRKYGLRYDDLYDPKHDLDIKEALERLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPED QA+QTPFR YL DM+ +VKKER ERE LGALPL+QRT
Sbjct  65   ARNQRLKRAMDLSMKHQYLPEDFQAVQTPFRGYLSDMMDLVKKERLEREELGALPLHQRT  124

Query  398  IP  403
            +P
Sbjct  125  LP  126



>ref|XP_004136342.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Cucumis 
sativus]
 ref|XP_004162051.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Cucumis 
sativus]
 gb|KGN60115.1| hypothetical protein Csa_3G878840 [Cucumis sativus]
Length=122

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF ++LVDPK+N  A  H KTL  RLR YGLRYDDLYDPYYD+D+KEAL+RLPREIVD
Sbjct  1    MASFMQFLVDPKKNWFARQHMKTLTKRLRNYGLRYDDLYDPYYDVDVKEALDRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP++LQAMQTPFR+YLQ+MLA+VKKERAEREALGALPL+QRT
Sbjct  61   ARNQRLKRAMDLSMKHQYLPDNLQAMQTPFRSYLQEMLALVKKERAEREALGALPLFQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_004981353.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Setaria italica]
Length=126

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S+ S WLV+P+RNPLA +H   + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  5    LSALSNWLVNPRRNPLARLHMHAVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR QRLKR+MDLSMKH YLPEDLQA+QTPFR YL DMLA+VKKE AEREALGALPLYQRT
Sbjct  65   ARIQRLKRSMDLSMKHQYLPEDLQAVQTPFRGYLSDMLALVKKENAEREALGALPLYQRT  124

Query  398  IP  403
            IP
Sbjct  125  IP  126



>ref|XP_004981358.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X2 
[Setaria italica]
Length=126

 Score =   163 bits (413),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S+ S WLV+P+RNPLA +H   + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  5    ISALSNWLVNPRRNPLARLHMHAVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR QRLKR+MDLSMKH YLPEDLQA+QTPFR YL DMLA+VKKE AEREALGALPLYQRT
Sbjct  65   ARIQRLKRSMDLSMKHQYLPEDLQAVQTPFRGYLSDMLALVKKENAEREALGALPLYQRT  124

Query  398  IP  403
            IP
Sbjct  125  IP  126



>ref|XP_008466386.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Cucumis melo]
Length=175

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  14   KEEP*KMAMSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALN  193
            +EE  ++ M+SF ++LVDPK+N  A  H K L  RLR YGLRYDDLYDPYYD+D+KEALN
Sbjct  46   QEERREIEMASFMQFLVDPKKNWFARQHMKALTKRLRNYGLRYDDLYDPYYDVDVKEALN  105

Query  194  RLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALG  373
            RLPRE+VDARNQRLKRAMDLSMKH YLP+DLQ MQTPFR+YLQ+MLA+VKKERAERE+LG
Sbjct  106  RLPREVVDARNQRLKRAMDLSMKHQYLPDDLQTMQTPFRSYLQEMLALVKKERAERESLG  165

Query  374  ALPLYQRTIP  403
            ALPLYQRTIP
Sbjct  166  ALPLYQRTIP  175



>ref|XP_009129963.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Brassica rapa]
Length=123

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SSF + LVDPK+N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKEALNRLPRE+VDA
Sbjct  3    SSFLQRLVDPKKNFLARLHMKSVSNRLREYGLRYDDLYDPMYDLDIKEALNRLPREVVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+VK+ERAEREALGALPLYQRTI
Sbjct  63   RNQRLKRAMDLSMKHEYLPDDLQAVQTPFRSYLQEMLALVKRERAEREALGALPLYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_002872165.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48424.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=122

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + LVDP++N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKEALNRLPREIVD
Sbjct  1    MASFLQRLVDPRKNFLARMHMKSVSNRLRRYGLRYDDLYDPLYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP++LQAMQTPFR+YLQD+LA+VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPDNLQAMQTPFRSYLQDILALVKRERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_008644048.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG46882.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
 gb|AFW67284.1| ubiquinol-cytochrome c reductase complex protein [Zea mays]
Length=126

 Score =   162 bits (411),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M++ S WLV+P+RNPLA +H  T+ SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  5    MNALSNWLVNPRRNPLARLHMHTVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+VKKE AEREALGALPLYQRT
Sbjct  65   ARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLSDMLALVKKENAEREALGALPLYQRT  124

Query  398  IP  403
            +P
Sbjct  125  LP  126



>ref|XP_006858921.1| hypothetical protein AMTR_s00068p00053420 [Amborella trichopoda]
 gb|ERN20388.1| hypothetical protein AMTR_s00068p00053420 [Amborella trichopoda]
Length=123

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SSF +W + P+ N  AA H K +  RLRKYGLRYDDLYDP YDLDIKEAL+RLPRE+VDA
Sbjct  3    SSFMKWFMSPRHNWFAAQHCKAISKRLRKYGLRYDDLYDPMYDLDIKEALDRLPREVVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKERAEREALGALPLYQR+I
Sbjct  63   RNQRLKRAMDLSMKHEYLPEDLQALQTPFRSYLRDMLAVVKKERAEREALGALPLYQRSI  122

Query  401  P  403
            P
Sbjct  123  P  123



>gb|EEC81709.1| hypothetical protein OsI_25318 [Oryza sativa Indica Group]
 gb|EEE66772.1| hypothetical protein OsJ_23497 [Oryza sativa Japonica Group]
Length=123

 Score =   162 bits (409),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +SS S WLV+P+RNPLA +H   + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  2    LSSLSAWLVNPRRNPLARLHMNAVASRLRKYGLRYDDLYDPYHDLDIKEALARLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP D QA QTPFR YL DMLA+VKKE AEREALGALPLYQRT
Sbjct  62   ARNQRLKRAMDLSMKHQYLPADAQAKQTPFRGYLSDMLALVKKESAEREALGALPLYQRT  121

Query  398  IP  403
            IP
Sbjct  122  IP  123



>ref|XP_004955785.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Setaria 
italica]
Length=123

 Score =   162 bits (409),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S  S W V+P+RNPLA  H+  + SRLRKYGLRYDDLYDPY+DLDIKEAL+RLPRE+VD
Sbjct  2    LSKLSAWFVNPRRNPLARAHRNAVASRLRKYGLRYDDLYDPYHDLDIKEALSRLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+++QA+QTPFR+YL DMLA+VKKE+AEREALGALPLYQRT
Sbjct  62   ARNQRLKRAMDLSMKHKYLPDEVQAIQTPFRSYLSDMLALVKKEKAEREALGALPLYQRT  121

Query  398  IP  403
            IP
Sbjct  122  IP  123



>gb|ACG38382.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
 gb|ACG46014.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
Length=123

 Score =   162 bits (409),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S  S W V+P+RNPLA +H+  + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  2    LSKLSAWFVNPRRNPLARLHRNAVASRLRKYGLRYDDLYDPYHDLDIKEALARLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+D+QA+QTPFR+YL DMLA+VKKE AEREALGALPLYQRT
Sbjct  62   ARNQRLKRAMDLSMKHQYLPDDVQAIQTPFRSYLFDMLALVKKESAEREALGALPLYQRT  121

Query  398  IP  403
            IP
Sbjct  122  IP  123



>ref|XP_010421394.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Camelina sativa]
Length=122

 Score =   162 bits (409),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + LVDP+ N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKE+LNRLPREIVD
Sbjct  1    MASFLQRLVDPRTNFLARMHMKSVSNRLRRYGLRYDDLYDPLYDLDIKESLNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP DLQA+QTPFR+YLQDMLA+VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPADLQAVQTPFRSYLQDMLALVKRERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_002459526.1| hypothetical protein SORBIDRAFT_02g006120 [Sorghum bicolor]
 gb|EER96047.1| hypothetical protein SORBIDRAFT_02g006120 [Sorghum bicolor]
Length=123

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S  S W ++P+RNPLA +H+  + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  2    LSKLSAWFLNPRRNPLARLHRNAIASRLRKYGLRYDDLYDPYHDLDIKEALARLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+D+QA+QTPFR+YL DMLA+VKKE AEREALGALPLYQRT
Sbjct  62   ARNQRLKRAMDLSMKHKYLPDDVQAIQTPFRSYLSDMLALVKKESAEREALGALPLYQRT  121

Query  398  IP  403
            IP
Sbjct  122  IP  123



>ref|XP_010432714.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Camelina sativa]
 ref|XP_010437908.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Camelina sativa]
Length=122

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK+N LA +H K + +RLR+YGLRYDDLYD YY +DIKEA+NRLPRE+VD
Sbjct  1    MSSFLKSFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQAMQTPFR YLQDMLA+V++E  EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAMQTPFRGYLQDMLALVERESKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_004291494.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Fragaria vesca 
subsp. vesca]
Length=122

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + LVDP++N  A  H K +  RLR YGLRYDDLYDPYYDLDIKEALNRLPR+IVD
Sbjct  1    MASFLQSLVDPRKNWFARQHMKAVSRRLRHYGLRYDDLYDPYYDLDIKEALNRLPRQIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+MLA+VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLALVKRERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_002284960.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Vitis vinifera]
 emb|CBI20998.3| unnamed protein product [Vitis vinifera]
Length=122

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M S  +WLVDPK+N  A  H KT+ +RLRKYGLRYDDLYDP YDLDIKEALNRLPREIVD
Sbjct  1    MESLMKWLVDPKKNWFARQHMKTISTRLRKYGLRYDDLYDPKYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+QRLKRA+DLSMKH YL EDLQAMQTPFR+YLQ+MLA+VK+E AEREALGALPLYQRT
Sbjct  61   ARHQRLKRAIDLSMKHEYLAEDLQAMQTPFRSYLQEMLALVKRENAEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|NP_001059146.1| Os07g0205000 [Oryza sativa Japonica Group]
 dbj|BAF21060.1| Os07g0205000 [Oryza sativa Japonica Group]
Length=175

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +SS S WLV+P+RNPLA +H   + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  54   LSSLSAWLVNPRRNPLARLHMNAVASRLRKYGLRYDDLYDPYHDLDIKEALARLPREVVD  113

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP D QA QTPFR YL DMLA+VKKE AEREALGALPLYQRT
Sbjct  114  ARNQRLKRAMDLSMKHQYLPADAQAKQTPFRGYLSDMLALVKKESAEREALGALPLYQRT  173

Query  398  IP  403
            IP
Sbjct  174  IP  175



>ref|NP_197927.1| cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
 sp|F4JWS8.1|QCR72_ARATH RecName: Full=Cytochrome b-c1 complex subunit 7-2; AltName: Full=Complex 
III subunit VII [Arabidopsis thaliana]
 gb|AED93444.1| cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
Length=122

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + LVDP++N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKEALNRLPREIVD
Sbjct  1    MASFLQRLVDPRKNFLARMHMKSVSNRLRRYGLRYDDLYDPLYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRL RAMDLSMKH YLP++LQA+QTPFR+YLQDMLA+VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLMRAMDLSMKHEYLPDNLQAVQTPFRSYLQDMLALVKRERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_006286400.1| hypothetical protein CARUB_v10002241mg [Capsella rubella]
 gb|EOA19298.1| hypothetical protein CARUB_v10002241mg [Capsella rubella]
Length=133

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  29   KMAMSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPRE  208
            K  M+SF +  +DP++N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKEALNRLPRE
Sbjct  9    KKLMASFLQRFLDPRKNFLARMHMKSVSNRLRRYGLRYDDLYDPLYDLDIKEALNRLPRE  68

Query  209  IVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLY  388
            IVDARNQRLKRAMDLSMKH YLP DLQAMQTPFR+YLQDMLA+V++ER EREALGALPLY
Sbjct  69   IVDARNQRLKRAMDLSMKHEYLPADLQAMQTPFRSYLQDMLALVRRERVEREALGALPLY  128

Query  389  QRTIP  403
            QRTIP
Sbjct  129  QRTIP  133



>ref|XP_007162074.1| hypothetical protein PHAVU_001G121500g [Phaseolus vulgaris]
 gb|ESW34068.1| hypothetical protein PHAVU_001G121500g [Phaseolus vulgaris]
Length=122

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +W +DPK+N LAA H K+L  RLRKYGLRYDDLYDPYYDLD+KEALNRLP+E+VD
Sbjct  1    MASFLQWFLDPKKNWLAAQHMKSLSQRLRKYGLRYDDLYDPYYDLDVKEALNRLPKEVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+ RLKRA+DLSMKH YLP+DLQAMQTPFR YLQDML +VK+ERAER ALG LPLYQR+
Sbjct  61   ARHARLKRAIDLSMKHQYLPDDLQAMQTPFRGYLQDMLTLVKRERAERVALGGLPLYQRS  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_009108873.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Brassica rapa]
 emb|CDY23327.1| BnaA08g12190D [Brassica napus]
Length=122

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK+N LA +H K + +RLR+YGLRYDD YD YY +DIKEALNRLPRE+VD
Sbjct  1    MSSFLKSFLDPKKNFLARMHMKAVSTRLRRYGLRYDDTYDQYYHMDIKEALNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+V++ER EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRSYLQEMLALVERERKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>emb|CDY39888.1| BnaC03g67290D [Brassica napus]
Length=122

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK+N LA +H K + +RLR+YGLRYDD YD YYD+DIKEALNRLPRE+VD
Sbjct  1    MSSFLQSFLDPKKNFLARMHMKAVSTRLRRYGLRYDDTYDQYYDMDIKEALNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+V++ER EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRSYLQEMLALVERERKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_010447382.1| PREDICTED: cytochrome b-c1 complex subunit 7-1-like [Camelina 
sativa]
Length=122

 Score =   159 bits (403),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK+N LA +H K + +RLR+YGLRYDDLYD YY +DIKEA+NRLPRE+VD
Sbjct  1    MSSFLKAFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLS+KH YLP+DLQAMQTPFR YLQDMLA+V++E  EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSVKHEYLPKDLQAMQTPFRGYLQDMLALVERESKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_003557405.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Brachypodium 
distachyon]
Length=123

 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +SS S W V+P+RNPLA +H KT+  RL  YGLRYDDLYDPY DLDIKEAL RLPRE+VD
Sbjct  2    LSSLSAWFVNPRRNPLARLHMKTVAYRLSNYGLRYDDLYDPYNDLDIKEALARLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+D++A+QTPFR+YL DMLA+VKKERAEREALGALPLY+RT
Sbjct  62   ARNQRLKRAMDLSMKHQYLPDDVKALQTPFRSYLADMLALVKKERAEREALGALPLYERT  121

Query  398  IP  403
            +P
Sbjct  122  LP  123



>ref|NP_001237139.1| uncharacterized protein LOC100499867 [Glycine max]
 gb|ACU13972.1| unknown [Glycine max]
Length=122

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +W +DPK+N  AA H K+L  RLRKYGLRYDDLYDPYYDLD+KEALNRLP+E+VD
Sbjct  1    MASFLQWFLDPKKNWFAAQHMKSLSRRLRKYGLRYDDLYDPYYDLDVKEALNRLPKEVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+ RLKRA+DLSMKH YLP++LQAMQTPFR YLQDML +VK+ERAEREALG LPLYQR+
Sbjct  61   ARHARLKRAIDLSMKHEYLPDNLQAMQTPFRGYLQDMLTLVKRERAEREALGGLPLYQRS  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|ACG26525.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
Length=123

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S  S W V+P+RNPLA +H+  + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  2    LSKLSAWFVNPRRNPLARLHRNAVASRLRKYGLRYDDLYDPYHDLDIKEALARLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+D+QA+QTPFR+YL DMLA+VKKE AEREALGALPLYQ T
Sbjct  62   ARNQRLKRAMDLSMKHQYLPDDVQAIQTPFRSYLFDMLALVKKESAEREALGALPLYQIT  121

Query  398  IP  403
            IP
Sbjct  122  IP  123



>emb|CDX68850.1| BnaC01g06030D [Brassica napus]
Length=122

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MS+F + L+DPK+N LA +H   + +RLR+YGLRYDDL+D Y  +DIKEALNRLPRE+VD
Sbjct  1    MSTFLQSLIDPKKNFLARMHMNAVSTRLRRYGLRYDDLFDQYETMDIKEALNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQA+QTPFR YL++MLA+V++ER EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAVQTPFRGYLKEMLALVERERKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_009403163.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=123

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SS+ +WL +P+RN  AA H K L +RL+KYGLRYDDLYDP YDLDIKEAL RLPRE+VDA
Sbjct  3    SSWMQWLTNPRRNWFAAQHYKALSNRLKKYGLRYDDLYDPMYDLDIKEALARLPREVVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRA+DLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKE AEREALGALP+YQRTI
Sbjct  63   RNQRLKRAIDLSMKHEYLPEDLQALQTPFRSYLKDMLALVKKENAEREALGALPVYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_010526201.1| PREDICTED: cytochrome b-c1 complex subunit 7-1-like [Tarenaya 
hassleriana]
Length=122

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK++ LA +H   + +RLR+YGLRYDDLYDPYY++DIKEA+NRLPREI+D
Sbjct  1    MSSFLQSFLDPKKSALARMHMNAVSTRLRRYGLRYDDLYDPYYEMDIKEAMNRLPREIID  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQAMQTPFR+YLQ+MLA+VK+E+AEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAMQTPFRSYLQEMLALVKREKAEREALGALPLYQRT  120

Query  398  IP  403
             P
Sbjct  121  FP  122



>ref|XP_008671592.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like, partial 
[Zea mays]
Length=173

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +2

Query  47   FSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARN  226
             S W V+P+RNPLA +H+  + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VDARN
Sbjct  55   LSAWFVNPRRNPLARLHRNAVASRLRKYGLRYDDLYDPYHDLDIKEALARLPREVVDARN  114

Query  227  QRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            QRLKRAMDLSMKH YLP+D+QA+QTPFR+YL DMLA+VKKE AEREALGALPLYQRTIP
Sbjct  115  QRLKRAMDLSMKHQYLPDDVQAIQTPFRSYLFDMLALVKKESAEREALGALPLYQRTIP  173



>ref|XP_006392333.1| hypothetical protein EUTSA_v10023759mg [Eutrema salsugineum]
 gb|ESQ29619.1| hypothetical protein EUTSA_v10023759mg [Eutrema salsugineum]
Length=122

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DP +N LA +H + + +RLR+YGLRYDDLYD YY +DIKEA+NRLPRE+VD
Sbjct  1    MSSFLKSFIDPSKNFLARMHMRAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQ+MLA+V++ER EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQEMLALVERERLEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>gb|AFK42990.1| unknown [Lotus japonicus]
Length=122

 Score =   157 bits (398),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  +  +DPK+N LA +H KT+  RLR+YGLRYDDLYDPYYDLDIKEALNRLP+E+VD
Sbjct  1    MASLLQSFIDPKKNWLARVHMKTISQRLRRYGLRYDDLYDPYYDLDIKEALNRLPKEVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+ RLKRA+DLSMKH YLPEDLQAMQTPFR+YLQDML  VKKERAEREALG LPLYQRT
Sbjct  61   ARHARLKRAIDLSMKHEYLPEDLQAMQTPFRSYLQDMLTFVKKERAEREALGGLPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_007225830.1| hypothetical protein PRUPE_ppa013437mg [Prunus persica]
 ref|XP_008219895.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Prunus mume]
 gb|EMJ27029.1| hypothetical protein PRUPE_ppa013437mg [Prunus persica]
Length=122

 Score =   157 bits (397),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + LVDP++N  A  H K +  RLR YGLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MASFLQSLVDPRKNWFARQHMKAVSQRLRHYGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPE LQA QTPFR+YLQ+MLA+VK+E+AEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEHLQAQQTPFRSYLQEMLALVKREKAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_010254318.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Nelumbo nucifera]
Length=123

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SS  +  ++P +N  AA H K+L  RLRKYGLRYDDLYDP YDLDIKEAL RLPREIVDA
Sbjct  3    SSMLQSFLNPSKNWFAAQHMKSLSKRLRKYGLRYDDLYDPMYDLDIKEALARLPREIVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRAMDLS+KH YLPEDLQAMQTPFR+YLQDMLA++KKERAEREALGALPLYQRTI
Sbjct  63   RNQRLKRAMDLSLKHEYLPEDLQAMQTPFRSYLQDMLALIKKERAEREALGALPLYQRTI  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|XP_009125952.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Brassica rapa]
 emb|CDX75248.1| BnaA01g04540D [Brassica napus]
Length=122

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MS+  + L+DPK+N LA +H K + +RLR+YGLRYDDL+D Y  +DIKEALNRLPRE+VD
Sbjct  1    MSTLLQSLIDPKKNFLARMHMKAVSTRLRRYGLRYDDLFDQYESMDIKEALNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YL++MLA+V++ER EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLKEMLALVERERKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|NP_194973.1| Cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
 sp|Q9SUU5.1|QCR71_ARATH RecName: Full=Cytochrome b-c1 complex subunit 7-1; AltName: Full=Complex 
III subunit VII [Arabidopsis thaliana]
 gb|AAG40060.1|AF324709_1 AT4g32470 [Arabidopsis thaliana]
 gb|AAG41456.1|AF326874_1 putative ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
 gb|AAK00377.1|AF339695_1 putative ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
 gb|AAK32851.1|AF361839_1 AT4g32470/F8B4_170 [Arabidopsis thaliana]
 emb|CAA22574.1| ubiquinol-cytochrome c reductase-like protein [Arabidopsis thaliana]
 emb|CAB79964.1| ubiquinol-cytochrome c reductase-like protein [Arabidopsis thaliana]
 gb|AAL47417.1| AT4g32470/F8B4_170 [Arabidopsis thaliana]
 gb|AAM64883.1| ubiquinol-cytochrome c reductase-like protein [Arabidopsis thaliana]
 gb|AEE86065.1| Cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
Length=122

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  +  +DPK+N LA +H K + +RLR+YGLRYDDLYD YY +DIKEA+NRLPRE+VD
Sbjct  1    MASLLKAFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQDMLA+V++E  EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQDMLALVERESKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>gb|KFK29857.1| hypothetical protein AALP_AA7G187900 [Arabis alpina]
Length=122

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DPK+N LA IH +T+ +RLR+YGLRYDDLYD YY LDIKEA+NRLPRE+VD
Sbjct  1    MASFIQAFIDPKKNFLARIHMRTISTRLRRYGLRYDDLYDQYYHLDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YL +DLQA+QTPFR YLQ+MLA+V++E  EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLSKDLQAVQTPFRGYLQEMLALVQREAKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_002867242.1| hypothetical protein ARALYDRAFT_913201 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43501.1| hypothetical protein ARALYDRAFT_913201 [Arabidopsis lyrata subsp. 
lyrata]
Length=122

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  +  +DPK+N LA +H K + +RLR+YGLRYDDLYD YY +DIKEA+NRLPRE+VD
Sbjct  1    MASLLKSFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQDMLA+V++E  EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQDMLALVERESKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_002324279.1| putative ubiquinol-cytochrome c reductase family protein [Populus 
trichocarpa]
 gb|EEF02844.1| putative ubiquinol-cytochrome c reductase family protein [Populus 
trichocarpa]
Length=118

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 4/122 (3%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + LVDP++N LA  H KTL SRLR+YGLRYDDLYDPYY+LDIKEALNRLPREIVD
Sbjct  1    MASFLQSLVDPRKNWLAKQHMKTLSSRLRRYGLRYDDLYDPYYELDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQ+ML +    RAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQEMLTL----RAEREALGALPLYQRT  116

Query  398  IP  403
            IP
Sbjct  117  IP  118



>ref|XP_003588718.1| Cytochrome b-c1 complex subunit [Medicago truncatula]
 gb|ACJ84014.1| unknown [Medicago truncatula]
 gb|AES58969.1| cytochrome B-c1 complex subunit 7 [Medicago truncatula]
 gb|AFK47778.1| unknown [Medicago truncatula]
Length=122

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + +VDPK+N  AA H K +  RLRKYGLRYDDLYDPYYDLDIKEALNRLP+E+VD
Sbjct  1    MASLLQAIVDPKKNWFAAQHMKAVSKRLRKYGLRYDDLYDPYYDLDIKEALNRLPKEVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+ RLKRA+DLSMKH YLPEDLQAMQTPFR+YLQDML  VK+ERAEREALG LPLYQRT
Sbjct  61   ARHARLKRAIDLSMKHEYLPEDLQAMQTPFRSYLQDMLTFVKRERAEREALGGLPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_010454872.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Camelina 
sativa]
Length=122

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + LVDP+ N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKE+LNRLP+EIVD
Sbjct  1    MASLLQRLVDPRTNFLARMHMKSVSNRLRRYGLRYDDLYDPLYDLDIKESLNRLPKEIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP DLQA+QTPFR+YLQDMLA+VK+ERAEREALGALPLYQ T
Sbjct  61   ARNQRLKRAMDLSMKHEYLPADLQAVQTPFRSYLQDMLALVKRERAEREALGALPLYQIT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|NP_001170375.1| ubiquinol-cytochrome c reductase complex protein [Zea mays]
 gb|ACG35659.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
 tpg|DAA52033.1| TPA: ubiquinol-cytochrome c reductase complex protein [Zea mays]
Length=126

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M++ + WL +P+RNPLA +H   + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  5    MNALANWLANPRRNPLARLHMHAVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+VKKE AER++LGALPLYQRT
Sbjct  65   ARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLGDMLALVKKESAERQSLGALPLYQRT  124

Query  398  IP  403
            +P
Sbjct  125  LP  126



>ref|XP_010249976.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Nelumbo 
nucifera]
Length=123

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +2

Query  32   MAMSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREI  211
            MA S F  +L +P +N  AA H K L  RLRKYGLRYDDLYDP YDLDIKEAL RLPREI
Sbjct  1    MASSLFQSFL-NPSKNWFAAQHMKALSKRLRKYGLRYDDLYDPMYDLDIKEALARLPREI  59

Query  212  VDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQ  391
            VDAR QRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDML +VKKERAEREALGALPLYQ
Sbjct  60   VDARIQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLTLVKKERAEREALGALPLYQ  119

Query  392  RTIP  403
            RTIP
Sbjct  120  RTIP  123



>gb|ACG47614.1| ubiquinol-cytochrome c reductase complex 14 kDa protein [Zea 
mays]
Length=123

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M++ + WL +P+RNPLA +H   + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  2    MNALANWLANPRRNPLARLHMHAVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+VKKE AER++LGALPLYQRT
Sbjct  62   ARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLGDMLALVKKESAERQSLGALPLYQRT  121

Query  398  IP  403
            +P
Sbjct  122  LP  123



>ref|XP_010934817.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Elaeis guineensis]
Length=126

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = +2

Query  38   MSSFSRWL----VDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPR  205
            M+S S WL    ++P+RN  AA H K +  RL+KYGLRYDDLYDP YDLDIKEAL RLPR
Sbjct  1    MASSSSWLQSFFLNPRRNWFAAQHYKAVSKRLKKYGLRYDDLYDPMYDLDIKEALARLPR  60

Query  206  EIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPL  385
            E+VDARNQRLKRA+DLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKERAEREALGALPL
Sbjct  61   EVVDARNQRLKRALDLSMKHEYLPEDLQALQTPFRSYLKDMLALVKKERAEREALGALPL  120

Query  386  YQRTIP  403
            YQR IP
Sbjct  121  YQRNIP  126



>ref|XP_006284767.1| hypothetical protein CARUB_v10006035mg [Capsella rubella]
 gb|EOA17665.1| hypothetical protein CARUB_v10006035mg [Capsella rubella]
Length=122

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  +  +DPK+N LA +H K + +RLR+YGLRYDDLYD YY +DIKEA+NRLPRE+VD
Sbjct  1    MASLLKSFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQ+MLA+V++E  EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQEMLALVERESKEREALGALPLYQRT  120

Query  398  IP  403
            +P
Sbjct  121  LP  122



>ref|XP_006600154.1| PREDICTED: uncharacterized protein LOC100527652 isoform X1 [Glycine 
max]
 gb|KHN06657.1| Cytochrome b-c1 complex subunit 7 [Glycine soja]
Length=122

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DPK+N  AA H K+L  RLRKYGLRYDDLYDPYYDLD+KEALNRLP+E+VD
Sbjct  1    MASFLQSFLDPKKNWFAAQHMKSLSKRLRKYGLRYDDLYDPYYDLDVKEALNRLPKEVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+ RLKRA+DLSMKH YLP++LQ+MQTPFR YLQDML +VK+ERAEREALG LPLYQR+
Sbjct  61   ARHARLKRAIDLSMKHEYLPDNLQSMQTPFRGYLQDMLTLVKRERAEREALGGLPLYQRS  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_006412471.1| hypothetical protein EUTSA_v10026575mg [Eutrema salsugineum]
 gb|ESQ53924.1| hypothetical protein EUTSA_v10026575mg [Eutrema salsugineum]
Length=122

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MS      +DPK+N LA +H K + +RLR+YGLRYDDLYD YY +DIKEA+NRLPRE+VD
Sbjct  1    MSKLLETFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+DLQ  QTPFR YLQ+MLA+V++ER EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQEKQTPFRGYLQEMLALVERERKEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_010923367.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Elaeis guineensis]
Length=128

 Score =   152 bits (384),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  56   WLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRL  235
            + ++P+RN  AA H K L  RL+KYGLRYDDLYDP YDLDIKEAL RLPRE+VDARNQRL
Sbjct  13   FFLNPRRNWFAAQHYKALTKRLKKYGLRYDDLYDPMYDLDIKEALVRLPREVVDARNQRL  72

Query  236  KRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            KRA+DLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKERAEREALGALPLYQRTIP
Sbjct  73   KRALDLSMKHEYLPEDLQALQTPFRSYLKDMLALVKKERAEREALGALPLYQRTIP  128



>ref|XP_009416641.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Musa acuminata 
subsp. malaccensis]
Length=123

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SS+ +WL++P+RN  AA H K L +RL+KYGLRY+DLYDP YDLDIK AL RLPRE+VDA
Sbjct  3    SSWMQWLINPRRNWFAAQHYKALCNRLKKYGLRYEDLYDPLYDLDIKVALARLPREVVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            RNQRLKRA+DLS KH YLPEDLQA+QTPFR+YL+DMLA+VKKE AEREALGALPLYQR+ 
Sbjct  63   RNQRLKRAIDLSTKHEYLPEDLQALQTPFRSYLKDMLALVKKENAEREALGALPLYQRSF  122

Query  401  P  403
            P
Sbjct  123  P  123



>ref|NP_001051639.1| Os03g0806900 [Oryza sativa Japonica Group]
 gb|AAP21435.1| putative ubiquinol-cytochrome c reductase [Oryza sativa Japonica 
Group]
 gb|ABF99449.1| Ubiquinol-cytochrome c reductase complex 14 kDa protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13553.1| Os03g0806900 [Oryza sativa Japonica Group]
 gb|EAY92265.1| hypothetical protein OsI_13986 [Oryza sativa Indica Group]
 gb|EAZ28987.1| hypothetical protein OsJ_13033 [Oryza sativa Japonica Group]
 dbj|BAH00617.1| unnamed protein product [Oryza sativa Japonica Group]
Length=126

 Score =   152 bits (383),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S+FS+W V+P+RNPLA +H + + SRLRKYGLRYDDLYDP +DLDIKEAL RLPRE+VD
Sbjct  5    LSAFSQWFVNPRRNPLARLHMQAISSRLRKYGLRYDDLYDPKHDLDIKEALERLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+QRLKRAMDLSMKH YL E+ QA QTPFR YL DM+ +VKKER ERE LGALPL+QRT
Sbjct  65   ARHQRLKRAMDLSMKHQYLSENDQAQQTPFRGYLSDMMDLVKKERLEREELGALPLHQRT  124

Query  398  IP  403
            +P
Sbjct  125  LP  126



>ref|XP_008392137.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Malus domestica]
 ref|XP_008392138.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Malus domestica]
Length=122

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + LVDP +N  A  H K +  RLR YGLRYDDLYDPYYDLDIKEAL+RLPREIVD
Sbjct  1    MASLLKSLVDPXKNWFARQHMKAVSQRLRHYGLRYDDLYDPYYDLDIKEALSRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPE LQA QTPFR+YLQ+MLA+VK+ER EREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEHLQAQQTPFRSYLQEMLALVKREREEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_009334780.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Pyrus x bretschneideri]
 ref|XP_009345290.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Pyrus x bretschneideri]
Length=122

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + LVDP+ N  A  H K +  RLR YGLRYDDLYDPYYDLDIKEAL+RLPREIVD
Sbjct  1    MASLLKSLVDPRTNWFARQHMKAVSQRLRHYGLRYDDLYDPYYDLDIKEALSRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+ LQA QTPFR+YLQ+ML +VKKERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPDHLQAQQTPFRSYLQEMLTLVKKERAEREALGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_008802707.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like, partial 
[Phoenix dactylifera]
Length=185

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  68   PKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRAM  247
            P+RN  AA H K +  RL+KYGLRYDDLYDP Y+LDIKEAL RLPRE+VDARNQRLKRAM
Sbjct  74   PRRNWFAAQHYKAVSKRLKKYGLRYDDLYDPMYELDIKEALARLPREVVDARNQRLKRAM  133

Query  248  DLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            DLSMKH YLPEDLQA+QTPFR+YL+DMLA+VKKERAEREALGALPLYQRTIP
Sbjct  134  DLSMKHEYLPEDLQALQTPFRSYLKDMLALVKKERAEREALGALPLYQRTIP  185



>ref|XP_010670700.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 [Beta vulgaris 
subsp. vulgaris]
Length=128

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  65   DPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRA  244
            DPK+N  AA+HK   D RLRKYGLR+DDLYDP  DLDIKEAL+RLPREIVDARNQRLKRA
Sbjct  16   DPKKNIFAAMHKSATDKRLRKYGLRFDDLYDPLEDLDIKEALDRLPREIVDARNQRLKRA  75

Query  245  MDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            +DLSMKH YL +DLQAMQTPFR+Y+Q+MLA+VK+ER EREALGALPLYQR+IP
Sbjct  76   IDLSMKHEYLTDDLQAMQTPFRSYIQEMLALVKREREEREALGALPLYQRSIP  128



>ref|XP_004498653.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Cicer arietinum]
Length=122

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + +VDPK+N  AA H K + +RLRKYGLRYDDLYDP YD+DIKEALNRLP+E+VD
Sbjct  1    MASLLQAIVDPKKNWFAAQHMKAVSNRLRKYGLRYDDLYDPLYDVDIKEALNRLPKEVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+ RLKRA+DLS+KH YLPEDLQAMQTPFR YLQ+ML  VK+E+AEREALGALPLYQRT
Sbjct  61   ARHARLKRAIDLSLKHEYLPEDLQAMQTPFRGYLQEMLTFVKREKAEREALGALPLYQRT  120

Query  398  IP  403
             P
Sbjct  121  FP  122



>gb|EMT14168.1| Cytochrome b-c1 complex subunit 7 [Aegilops tauschii]
Length=126

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S+FS W V+P+RNPLA IH  T+ +RL+ YGLRYDDLYDPY+DLDIKEAL RLPRE+ D
Sbjct  5    LSAFSSWFVNPRRNPLARIHMLTISNRLKNYGLRYDDLYDPYFDLDIKEALGRLPREVGD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR+ RLKRAMDLSMKH YLP+D++A+QTPF++YL DMLA+VKKE AER+ALGALPLY+RT
Sbjct  65   ARHPRLKRAMDLSMKHQYLPDDVRALQTPFKSYLSDMLALVKKEAAERKALGALPLYERT  124

Query  398  IP  403
            +P
Sbjct  125  LP  126



>gb|ABK94034.1| unknown [Populus trichocarpa]
Length=102

 Score =   149 bits (375),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +2

Query  101  KTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPE  280
            KTL SRLR+YGLRYDDLYDPYY+LDIKEALNRLPREIVDARNQRLKRAMDLSMKH YLPE
Sbjct  2    KTLSSRLRRYGLRYDDLYDPYYELDIKEALNRLPREIVDARNQRLKRAMDLSMKHEYLPE  61

Query  281  DLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            DLQAMQTPFR+YLQ+ML +VKKERAEREALGALPLYQRTIP
Sbjct  62   DLQAMQTPFRSYLQEMLTLVKKERAEREALGALPLYQRTIP  102



>ref|XP_008394045.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Malus domestica]
 ref|XP_008352052.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Malus domestica]
Length=122

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + LVDP+ N  A  H K +  RLR YGLRYDDLYDPYYDLDIKEAL+RLPREIVD
Sbjct  1    MASLLKSLVDPRTNWFARQHMKAVSQRLRHYGLRYDDLYDPYYDLDIKEALSRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLP+ LQA QTPFR+YLQ+ML +VKKE AERE LGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPDHLQAQQTPFRSYLQEMLTLVKKESAEREXLGALPLYQRT  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_010526202.1| PREDICTED: cytochrome b-c1 complex subunit 7-1 [Tarenaya hassleriana]
Length=104

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  92   IHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRAMDLSMKHLY  271
            +H   + +RLR+YGLRYDDLYDPYY++DIKEA+NRLPREI+DARNQRLKRAMDLSMKH Y
Sbjct  1    MHMNAVSTRLRRYGLRYDDLYDPYYEMDIKEAMNRLPREIIDARNQRLKRAMDLSMKHEY  60

Query  272  LPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            LP+DLQAMQTPFR+YLQ+MLA+VKKE+AERE LGALPLYQRT P
Sbjct  61   LPKDLQAMQTPFRSYLQEMLALVKKEKAERETLGALPLYQRTFP  104



>gb|KCW81433.1| hypothetical protein EUGRSUZ_C02813 [Eucalyptus grandis]
Length=89

 Score =   140 bits (352),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 83/122 (68%), Gaps = 33/122 (27%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK+N LA                                 LNRLPREIVD
Sbjct  1    MSSFLQSFLDPKKNWLA---------------------------------LNRLPREIVD  27

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPE+LQAMQTPFR+YLQDML +VKKERAEREALGALPLYQRT
Sbjct  28   ARNQRLKRAMDLSMKHEYLPENLQAMQTPFRSYLQDMLTLVKKERAEREALGALPLYQRT  87

Query  398  IP  403
            IP
Sbjct  88   IP  89



>gb|ACN36794.1| unknown [Zea mays]
Length=102

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  104  TLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPED  283
             + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VDAR QRLKRAMDLSMKH YLPED
Sbjct  3    AVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVDARIQRLKRAMDLSMKHQYLPED  62

Query  284  LQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            LQA Q PFR YL DMLA+VKKE AER++LGALPLYQRT+P
Sbjct  63   LQAQQVPFRGYLSDMLALVKKESAERQSLGALPLYQRTLP  102



>gb|ABQ42066.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
caseolaris]
Length=92

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +2

Query  86   AAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRAMDLSMKH  265
            AA+H KTL  RLR YGLRYDDLYDPYYDLD+KEALNRLPREIVDARNQRLKRAMDLSMKH
Sbjct  1    AALHMKTLSRRLRNYGLRYDDLYDPYYDLDVKEALNRLPREIVDARNQRLKRAMDLSMKH  60

Query  266  LYLPEDLQAMQTPFRNYLQDMLAIVKKERAER  361
             YLPEDLQAMQTPFR+YLQDMLA+VKKERAER
Sbjct  61   QYLPEDLQAMQTPFRSYLQDMLALVKKERAER  92



>gb|ABQ42065.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
alba]
 gb|ABQ42067.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
ovata]
 gb|ABQ42068.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
apetala]
Length=92

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +2

Query  86   AAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRAMDLSMKH  265
            AA+H KTL  RLR YGLRYDDLYDPYYDLD+KEALNRLPREIVDARNQRLKRAMDLSMKH
Sbjct  1    AALHMKTLSRRLRNYGLRYDDLYDPYYDLDVKEALNRLPREIVDARNQRLKRAMDLSMKH  60

Query  266  LYLPEDLQAMQTPFRNYLQDMLAIVKKERAER  361
             YLPEDLQAMQTPFR+YLQDMLA+VKKERAER
Sbjct  61   EYLPEDLQAMQTPFRSYLQDMLALVKKERAER  92



>ref|XP_011026490.1| PREDICTED: cytochrome b-c1 complex subunit 7-2 isoform X2 [Populus 
euphratica]
Length=106

 Score =   129 bits (323),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 96/122 (79%), Gaps = 16/122 (13%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DP++N LA  H K L SRLR+YGLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MASFLQSFIDPRKNWLAKQHMKALSSRLRRYGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRLKRAMDLSMKH YLPEDLQ                VKKERAEREALGALPLYQRT
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQ----------------VKKERAEREALGALPLYQRT  104

Query  398  IP  403
            IP
Sbjct  105  IP  106



>gb|KDO61658.1| hypothetical protein CISIN_1g033311mg [Citrus sinensis]
Length=119

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + L+DPK+N LAA H KT+  RLR +GLRYDDLYDPYYDLDIKEAL+RLPREIVD
Sbjct  1    MASLLQSLLDPKKNWLAAQHMKTISKRLRNFGLRYDDLYDPYYDLDIKEALDRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIV  340
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFRNYLQDMLA+V
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRNYLQDMLALV  101



>ref|XP_006450500.1| hypothetical protein CICLE_v10009887mg [Citrus clementina]
 gb|ESR63740.1| hypothetical protein CICLE_v10009887mg [Citrus clementina]
Length=129

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + L+DPK+N LAA H KT+  RLR +GLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MASLLQSLLDPKKNWLAAQHMKTISKRLRNFGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIV  340
            ARNQRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+V
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLALV  101



>gb|KJB80691.1| hypothetical protein B456_013G110700 [Gossypium raimondii]
Length=103

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK++ LAA+H K+L  RLRKYGLRYDDLYDPYYDLDIKEALNRLPREIV+
Sbjct  1    MSSFLQSFLDPKKSWLAALHMKSLSKRLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVN  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIV  340
            ARNQRLKRAMDLSMKH YLPE+LQ MQTPFR+YLQDMLA+V
Sbjct  61   ARNQRLKRAMDLSMKHEYLPENLQQMQTPFRSYLQDMLALV  101



>gb|KJB80692.1| hypothetical protein B456_013G110700 [Gossypium raimondii]
Length=125

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF +  +DPK++ LAA+H K+L  RLRKYGLRYDDLYDPYYDLDIKEALNRLPREIV+
Sbjct  1    MSSFLQSFLDPKKSWLAALHMKSLSKRLRKYGLRYDDLYDPYYDLDIKEALNRLPREIVN  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIV  340
            ARNQRLKRAMDLSMKH YLPE+LQ MQTPFR+YLQDMLA+V
Sbjct  61   ARNQRLKRAMDLSMKHEYLPENLQQMQTPFRSYLQDMLALV  101



>ref|XP_004981357.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X1 
[Setaria italica]
Length=130

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 94/124 (76%), Gaps = 7/124 (6%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S+ S WLV+P+RNPLA +H   + SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  5    ISALSNWLVNPRRNPLARLHMHAVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR QRLKR+MDLSMKH YLPEDLQA+QTPFR YL DMLA+V           A  L   T
Sbjct  65   ARIQRLKRSMDLSMKHQYLPEDLQAVQTPFRGYLSDMLALV-------SIFSAACLCHFT  117

Query  398  IP*C  409
             P C
Sbjct  118  CPKC  121



>ref|NP_001169405.1| hypothetical protein [Zea mays]
 gb|ACN33651.1| unknown [Zea mays]
 gb|AFW67283.1| hypothetical protein ZEAMMB73_980436 [Zea mays]
Length=143

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M++ S WLV+P+RNPLA +H  T+ SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  5    MNALSNWLVNPRRNPLARLHMHTVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVK  343
            AR QRLKRAMDLSMKH YLPEDLQA Q PFR YL DMLA+V+
Sbjct  65   ARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLSDMLALVR  106



>emb|CDY70525.1| BnaAnng34010D [Brassica napus]
 emb|CDY05492.1| BnaA02g31990D [Brassica napus]
Length=139

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SSF + LVDPK+N LA +H K++ +RLRKYGLRYDDLYDP YDLDIKEALNRLPRE+VDA
Sbjct  3    SSFLQRLVDPKKNFLARLHMKSVSNRLRKYGLRYDDLYDPMYDLDIKEALNRLPREVVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKK  346
            RNQRLKRAMDLSMKH YLP+DLQA+QTPFR+YLQ+MLA+V +
Sbjct  63   RNQRLKRAMDLSMKHEYLPDDLQAVQTPFRSYLQEMLALVSR  104



>ref|XP_002515558.1| Ubiquinol-cytochrome c reductase complex 14 kDa protein, putative 
[Ricinus communis]
 gb|EEF47007.1| Ubiquinol-cytochrome c reductase complex 14 kDa protein, putative 
[Ricinus communis]
Length=126

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DP++N LA  H K + +RLR+YGLRYDDLYDPYYDLDIKEALNRLPREIVD
Sbjct  1    MASFLQSFLDPRKNWLAKQHMKAVSTRLRRYGLRYDDLYDPYYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            AR QRLKRAMDLSMKH YLPEDLQAMQTPFR+YLQDMLA+V+      +   +LP  Q  
Sbjct  61   ARVQRLKRAMDLSMKHEYLPEDLQAMQTPFRSYLQDMLALVRNIFFNYKFSYSLPDLQID  120

Query  398  IP*C  409
             P C
Sbjct  121  SPSC  124



>gb|ACS68687.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Sonneratia 
alba]
 gb|ACS68758.1| ubiquinol-cytochrome C reductase complex 14 kDa protein, partial 
[Sonneratia alba]
Length=88

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  92   IHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRAMDLSMKHLY  271
            +H KTL  RLR YGLRYDDLYDPYYDLD+KEALNRLPREIVDARNQRLKRAMDLSMKH Y
Sbjct  1    LHMKTLSRRLRNYGLRYDDLYDPYYDLDVKEALNRLPREIVDARNQRLKRAMDLSMKHEY  60

Query  272  LPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            LPEDLQAMQTPFR+YLQDMLA+VKKERA
Sbjct  61   LPEDLQAMQTPFRSYLQDMLALVKKERA  88



>ref|NP_001190394.1| cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
 gb|AED93445.1| cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
Length=106

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 97/122 (80%), Gaps = 16/122 (13%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF + LVDP++N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKEALNRLPREIVD
Sbjct  1    MASFLQRLVDPRKNFLARMHMKSVSNRLRRYGLRYDDLYDPLYDLDIKEALNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
            ARNQRL RAMDLSMKH YLP++LQ                VK+ERAEREALGALPLYQRT
Sbjct  61   ARNQRLMRAMDLSMKHEYLPDNLQ----------------VKRERAEREALGALPLYQRT  104

Query  398  IP  403
            IP
Sbjct  105  IP  106



>gb|ABK22110.1| unknown [Picea sitchensis]
 gb|ABK23193.1| unknown [Picea sitchensis]
Length=127

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  83   LAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKRAMDLSMK  262
            +A I    + +RLRKYGLRY+DLYD    LD+ EALNRLP E+VDARNQR+KRAMDLSMK
Sbjct  21   VAIIQCTHVGNRLRKYGLRYEDLYDQTDSLDVDEALNRLPPEVVDARNQRIKRAMDLSMK  80

Query  263  HLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            H YLP++LQA+QTPFR+YLQDML +V  ER EREALGA PL++R++P
Sbjct  81   HDYLPKELQAVQTPFRSYLQDMLELVIAERKEREALGATPLHERSLP  127



>ref|NP_849484.1| Cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
 gb|AEE86066.1| Cytochrome bd ubiquinol oxidase [Arabidopsis thaliana]
Length=101

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  +  +DPK+N LA +H K + +RLR+YGLRYDDLYD YY +DIKEA+NRLPRE+VD
Sbjct  1    MASLLKAFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAI  337
            ARNQRLKRAMDLSMKH YLP+DLQA+QTPFR YLQDMLA+
Sbjct  61   ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQDMLAL  100



>ref|XP_009403171.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=109

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +2

Query  41   SSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDA  220
            SS+ +WL +P+RN  AA H K L +RL+KYGLRYDDLYDP YDLDIKEAL RLPRE+VDA
Sbjct  3    SSWMQWLTNPRRNWFAAQHYKALSNRLKKYGLRYDDLYDPMYDLDIKEALARLPREVVDA  62

Query  221  RNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKER  352
            RNQRLKRA+DLSMKH YLPEDLQA+QTPFR+YL+DMLA++   R
Sbjct  63   RNQRLKRAIDLSMKHEYLPEDLQALQTPFRSYLKDMLALLGATR  106



>ref|NP_001235489.1| uncharacterized protein LOC100527652 [Glycine max]
 gb|ACU16783.1| unknown [Glycine max]
Length=107

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+SF +  +DPK+N  AA H K+L  RLRKYGLRYDDLYDPYYDLD+KEALNRLP+E+VD
Sbjct  1    MASFLQSFLDPKKNWFAAQHMKSLSKRLRKYGLRYDDLYDPYYDLDVKEALNRLPKEVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKE  349
            AR+ RLKRA+DLSMKH YLP++LQ+MQTPFR YLQDML +VK+E
Sbjct  61   ARHARLKRAIDLSMKHEYLPDNLQSMQTPFRGYLQDMLTLVKRE  104



>gb|EMS59356.1| Cytochrome b-c1 complex subunit 7 [Triticum urartu]
Length=152

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 7/118 (6%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            +S+FS W V+P+RNPLA IH  T+ +RL+ YGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  2    LSAFSSWFVNPRRNPLARIHMLTISNRLKNYGLRYDDLYDPYFDLDIKEALCRLPREVVD  61

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQ  391
            AR+QRLKRAMDLSMKH YLP+D++A+QTPF++YL DMLA+          +G LP ++
Sbjct  62   ARHQRLKRAMDLSMKHQYLPDDVRALQTPFKSYLSDMLALAPY-------IGGLPGHE  112



>ref|XP_003588719.1| Cytochrome b-c1 complex subunit [Medicago truncatula]
 gb|AES58970.1| cytochrome B-c1 complex subunit 7 [Medicago truncatula]
Length=111

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + +VDPK+N  AA H K +  RLRKYGLRYDDLYDPYYDLDIKEALNRLP+E+VD
Sbjct  1    MASLLQAIVDPKKNWFAAQHMKAVSKRLRKYGLRYDDLYDPYYDLDIKEALNRLPKEVVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIV  340
            AR+ RLKRA+DLSMKH YLPEDLQAMQTPFR+YLQDML  V
Sbjct  61   ARHARLKRAIDLSMKHEYLPEDLQAMQTPFRSYLQDMLTFV  101



>gb|KDD73783.1| hypothetical protein H632_c1840p0 [Helicosporidium sp. ATCC 50920]
Length=124

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +2

Query  32   MAMSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREI  211
            MA  S    L DP    +A  ++  + S LRKYGLRY+DL D  +DL++ EAL RLP+++
Sbjct  1    MAQRSMLAKLFDPLVAVIAPRYQAAVGSSLRKYGLRYEDLMDHEHDLNVNEALRRLPQDV  60

Query  212  VDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQ  391
            VDARNQR+KRA+DLSMKH  LP++LQA+QTPF +YLQ  L +V+ ERAEREALGA   Y 
Sbjct  61   VDARNQRIKRALDLSMKHAELPKELQAVQTPFESYLQATLDVVRAERAEREALGAPMPYD  120

Query  392  RTIP  403
            R +P
Sbjct  121  RQLP  124



>gb|EEC83182.1| hypothetical protein OsI_28424 [Oryza sativa Indica Group]
Length=119

 Score =   102 bits (253),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglry--ddlydpyydldIKEALNRLPREI  211
            +S  S WLV+P+RNPLA +H   + SRL KYGLRY        Y+ LDIKEAL RLPRE+
Sbjct  2    LSCLSAWLVNPRRNPLARLHMNVVASRLHKYGLRYDDLFDAYQYHGLDIKEALARLPREV  61

Query  212  VDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAE  358
            VDA NQRLKR MDLS KH YLP D QAMQT  R YL +  +IV    ++
Sbjct  62   VDAHNQRLKRTMDLSTKHQYLPTDEQAMQTTLRGYLSEKQSIVTGTSSQ  110



>gb|AFW67282.1| hypothetical protein ZEAMMB73_980436 [Zea mays]
Length=109

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M++ S WLV+P+RNPLA +H  T+ SRLRKYGLRYDDLYDPY+DLDIKEAL RLPRE+VD
Sbjct  5    MNALSNWLVNPRRNPLARLHMHTVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPREVVD  64

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPF  307
            AR QRLKRAMDLSMKH YLPEDLQ     F
Sbjct  65   ARIQRLKRAMDLSMKHQYLPEDLQVRAPSF  94



>ref|XP_001777123.1| predicted protein [Physcomitrella patens]
 gb|EDQ58116.1| predicted protein [Physcomitrella patens]
Length=125

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            IKEAL+RLP++ VD RNQRLKRAMD SMKH YLP+DLQA QTP+  YLQD L +VK+ER 
Sbjct  50   IKEALSRLPQQEVDLRNQRLKRAMDYSMKHQYLPKDLQAKQTPYEPYLQDALQLVKEERK  109

Query  356  EREALGALPLYQRTIP  403
            E   LG+   Y R++P
Sbjct  110  EHAELGSDLPYTRSLP  125



>gb|KDO61659.1| hypothetical protein CISIN_1g033311mg [Citrus sinensis]
Length=114

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + L+DPK+N LAA H KT+  RLR +GLRYDDLYDPYYDLDIKEAL+RLPREIVD
Sbjct  1    MASLLQSLLDPKKNWLAAQHMKTISKRLRNFGLRYDDLYDPYYDLDIKEALDRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAM  295
            ARNQRLKRAMDLSMKH YLPEDLQ +
Sbjct  61   ARNQRLKRAMDLSMKHEYLPEDLQVL  86



>ref|NP_001061357.1| Os08g0246400 [Oryza sativa Japonica Group]
 dbj|BAF23271.1| Os08g0246400 [Oryza sativa Japonica Group]
 dbj|BAG89888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=127

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglry--ddlydpyydldIKEALNRLPREI  211
            +S  S WLV+ +RNPLA +H   + S L KYGLRY        Y+ LDIKEAL RLPRE+
Sbjct  2    LSCLSAWLVNLRRNPLARLHMNVVASHLHKYGLRYDDLFDAYQYHGLDIKEALARLPREV  61

Query  212  VDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAERE  364
            VDA NQRLKR MDLS KH YLP D QAMQT  R YL D  A +   R  RE
Sbjct  62   VDAHNQRLKRTMDLSTKHQYLPADEQAMQTTLRGYLSD--AYLSSHRVWRE  110



>ref|XP_001754627.1| predicted protein [Physcomitrella patens]
 gb|EDQ80597.1| predicted protein [Physcomitrella patens]
Length=124

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            IKEAL+RLP+E VD RNQRLKRAMD SMKH YLP++LQA QTP+  YLQD L +VK+ER 
Sbjct  49   IKEALSRLPQEEVDLRNQRLKRAMDYSMKHQYLPKELQAKQTPYEPYLQDALQLVKEERR  108

Query  356  EREALGALPLYQRTIP  403
            E   LG+   Y R++P
Sbjct  109  EHAELGSDLPYTRSLP  124



>ref|XP_008779665.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like, partial 
[Phoenix dactylifera]
Length=68

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAI  337
            IKEAL RLPRE+ DARNQRLKRAMDLS+KH YLPEDLQA+Q PFR+YL+DMLA+
Sbjct  15   IKEALARLPREVADARNQRLKRAMDLSLKHEYLPEDLQALQAPFRSYLKDMLAL  68



>ref|XP_010493801.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Camelina 
sativa]
Length=94

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + LVDP+ N LA +H K++ +RLR+YGLRYDDLYDP YDLDIKE+LNRLPREIVD
Sbjct  1    MASLLQRLVDPRNNFLARMHMKSVSNRLRRYGLRYDDLYDPLYDLDIKESLNRLPREIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTP  304
            ARNQRLKRAMDLSMKH YLP DLQ   +P
Sbjct  61   ARNQRLKRAMDLSMKHEYLPADLQVCMSP  89



>ref|XP_010107306.1| Cytochrome b-c1 complex subunit 7 [Morus notabilis]
 gb|EXC14786.1| Cytochrome b-c1 complex subunit 7 [Morus notabilis]
Length=97

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MSSF + L+DPK+N  A  H K L  RLR YGLRYDDLYDPYYDLD+KEALNRLPR+IVD
Sbjct  1    MSSFLQSLIDPKKNWFALQHMKVLSKRLRNYGLRYDDLYDPYYDLDVKEALNRLPRQIVD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYL  319
            AR+QRLKRAMDLSMKH YLP DLQ        +L
Sbjct  61   ARHQRLKRAMDLSMKHQYLPNDLQVYCFSISTFL  94



>ref|XP_005645464.1| 14 kDa subunit of cytochrome bd ubiquinol oxidase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE20920.1| 14 kDa subunit of cytochrome bd ubiquinol oxidase [Coccomyxa 
subellipsoidea C-169]
Length=123

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            + EAL RLP+E VDAR QRLKRAMDLS+KH+YLP++LQA+QTP+ +Y+ D++  V+ E  
Sbjct  48   VDEALKRLPQEEVDARTQRLKRAMDLSLKHVYLPKELQAVQTPYNSYVMDVIEQVEAENK  107

Query  356  EREALGALPLYQRTIP  403
            E+  LG    Y R+IP
Sbjct  108  EKAQLGTGTTYDRSIP  123



>ref|XP_002977783.1| hypothetical protein SELMODRAFT_228505 [Selaginella moellendorffii]
 gb|EFJ21121.1| hypothetical protein SELMODRAFT_228505 [Selaginella moellendorffii]
Length=120

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  44   SFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDAR  223
              ++ L+ P  N  A  +K  ++  LRK+GLRY+DL DP  D D++EAL+RLP+  +D R
Sbjct  2    GLAKTLLGPTFNYFARRYKANVEKELRKFGLRYEDLLDPMGDPDLEEALSRLPQHELDLR  61

Query  224  NQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            NQRLKRAMDLSMKH +L +++QA QTPF  Y+QD L  V+ ER EREALG+   Y R I
Sbjct  62   NQRLKRAMDLSMKHTHLSKEMQAKQTPFLPYVQDQLQQVRAERKEREALGSDVPYTRAI  120



>ref|XP_002986903.1| hypothetical protein SELMODRAFT_235141 [Selaginella moellendorffii]
 gb|EFJ11985.1| hypothetical protein SELMODRAFT_235141 [Selaginella moellendorffii]
Length=120

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  44   SFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDAR  223
              ++ L+ P  N  A  +K  ++  LRK+GLRYDDL DP  D D++EAL+RLP+  +D R
Sbjct  2    GLAKTLLGPTFNYFARRYKANVEKELRKFGLRYDDLLDPMGDPDLEEALSRLPQHELDFR  61

Query  224  NQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTI  400
            NQRLKRAMDLSMKH +L +++QA QTPF  Y+QD L  V+ ER EREALG+   Y R I
Sbjct  62   NQRLKRAMDLSMKHTHLSKEMQAKQTPFLPYVQDQLQQVRAERKEREALGSDVPYTRAI  120



>ref|XP_001782160.1| predicted protein [Physcomitrella patens]
 gb|EDQ53054.1| predicted protein [Physcomitrella patens]
Length=112

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            I EAL+RLP ++ D R QRLKRAMD   KH YL + +QA QTPF  YLQD LA VK+ER 
Sbjct  37   IMEALHRLPTQVTDYRYQRLKRAMDCGFKHKYLDKKMQAKQTPFEFYLQDTLAQVKRERI  96

Query  356  EREALGALPLYQRTIP  403
            EREA G+   YQR +P
Sbjct  97   EREAQGSAMPYQREMP  112



>ref|XP_005851167.1| hypothetical protein CHLNCDRAFT_33822 [Chlorella variabilis]
 gb|EFN59065.1| hypothetical protein CHLNCDRAFT_33822 [Chlorella variabilis]
Length=125

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            + EAL RLP++++DARNQRLKRA DL+MKH  LP+DLQ +QTP+  YL+D L +V+ E  
Sbjct  50   VDEALKRLPQDVLDARNQRLKRAHDLNMKHSELPKDLQQLQTPYSFYLKDALELVRLESD  109

Query  356  EREALGALPLYQRTIP  403
            ER ALGA   Y+R  P
Sbjct  110  ERLALGAGKPYERHFP  125



>ref|XP_003081235.1| ubiquinol-cytochrome C reductase complex 14 kDa protein, putative 
(ISS) [Ostreococcus tauri]
 emb|CAL55404.1| Cytochrome b-c1 complex subunit 7 [Ostreococcus tauri]
Length=122

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = +2

Query  59   LVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLK  238
            + +P  + L+  +K  + + LRK GLRYDDL D   DLD+ EAL RL  E  D R QRLK
Sbjct  8    MFEPWLDALSKSYKAQVGNELRKVGLRYDDLLDEGQDLDVGEALKRLTPEARDMRAQRLK  67

Query  239  RAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            RA+DLSMKH YL ++ QA+QTPF  YL  ++A VK+ERAER ALG    Y R IP
Sbjct  68   RAIDLSMKHAYLSKEEQALQTPFDFYLTPIVAQVKRERAERAALGQGQPYNRQIP  122



>ref|XP_001419785.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98078.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=122

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            MS   R +++P    ++  +++T+   LRKYGLRYDDL D   DLD+ EAL RL  E  D
Sbjct  1    MSRAMRKMLEPMLKSMSVNYRRTVGDELRKYGLRYDDLLDEGQDLDVGEALKRLTAEERD  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRT  397
             R QRLKRA+DLSMKH YL ++ QA QTPF  YL  ++  VK ERAER ALG    Y R 
Sbjct  61   MRAQRLKRAIDLSMKHSYLTKEEQATQTPFDFYLTPIVERVKAERAERTALGGSQPYNRQ  120

Query  398  IP  403
            IP
Sbjct  121  IP  122



>ref|XP_009769317.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Nicotiana 
sylvestris]
Length=87

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  32   MAMSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREI  211
            MA  S+   L++P++N LA++H K + +RLRKYGLR+DDL+DP  D+DIKEAL RLPRE+
Sbjct  1    MAAPSWILSLLNPRKNVLASMHMKCVSTRLRKYGLRFDDLFDPMEDMDIKEALRRLPREV  60

Query  212  VDARNQRLKRAMDLSMKHLYLPEDLQA  292
            VDAR+QRL RAMDLSMKH YLP+DLQ 
Sbjct  61   VDARHQRLLRAMDLSMKHQYLPDDLQV  87



>ref|XP_007510445.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17978.1| predicted protein [Bathycoccus prasinos]
Length=122

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 86/125 (69%), Gaps = 6/125 (5%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAI---HKKTLDSRLRKyglryddlydpyydldIKEALNRLPRE  208
            MSSF   L+     PL+A+   +++T+   L KYGLRYDDL D   +LD++EAL+RLP+E
Sbjct  1    MSSF---LLKVFAGPLSAMSNYYRRTVGYELSKYGLRYDDLLDETQNLDVQEALDRLPKE  57

Query  209  IVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLY  388
              + R QRLKRAMDLSMKH+YL ++    QTPF +YL  +LA V+ E++E+ ALG+   Y
Sbjct  58   EREMRTQRLKRAMDLSMKHIYLDKETMEKQTPFDHYLSPVLAEVEAEKSEKVALGSDVSY  117

Query  389  QRTIP  403
             R IP
Sbjct  118  NRQIP  122



>ref|XP_010255680.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Nelumbo 
nucifera]
Length=155

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  62   VDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLKR  241
            ++P +N   A H K+L    +KYGLRYDDLYDP YDLDI++A+ RLP E VDA NQRLK 
Sbjct  9    LNPSKNSFTAQHMKSLSKCFKKYGLRYDDLYDPMYDLDIRKAMARLPCETVDATNQRLKD  68

Query  242  AMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGA  376
            A+DL +KH YLP+DLQAM+T FR YLQD +   K+ +  R+ LGA
Sbjct  69   AVDLLVKHKYLPDDLQAMKTSFRKYLQD-VGSCKEGKGIRKTLGA  112



>ref|XP_008354902.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like, partial 
[Malus domestica]
Length=99

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 67/83 (81%), Gaps = 3/83 (4%)
 Frame = +2

Query  59   LVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLK  238
            LVDP+ N  A  H K +  RLR YGLRYDDLYDPYYDLDIKEAL+RLPREIVDARNQRLK
Sbjct  3    LVDPRTNWFARQHMKAVSQRLRHYGLRYDDLYDPYYDLDIKEALSRLPREIVDARNQRLK  62

Query  239  RAMDLSMKHLYLPEDLQAMQTPF  307
            RAMDLSMKH YLP+ L   Q PF
Sbjct  63   RAMDLSMKHEYLPDHL---QVPF  82



>ref|XP_002502572.1| mitochondrial tRNA import complex [Micromonas sp. RCC299]
 gb|ACO63830.1| mitochondrial tRNA import complex [Micromonas sp. RCC299]
Length=122

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            + EAL RLP+E  D R QRLKRAMDLSMKH+YL  ++Q  QTPF+ Y++ +L  V+ ER 
Sbjct  47   VAEALKRLPQEERDLRMQRLKRAMDLSMKHVYLDAEMQKKQTPFKWYIKPVLEEVEAERD  106

Query  356  EREALGALPLYQRTIP  403
            ER ALG    Y R IP
Sbjct  107  ERAALGTGQPYNRQIP  122



>ref|XP_001696308.1| ubiquinol:cytochrome c oxidoreductase 14 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP08285.1| ubiquinol:cytochrome c oxidoreductase 14 kDa subunit [Chlamydomonas 
reinhardtii]
Length=123

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S  + +  P  N LA  ++  + ++L KYGLR+DDL DP  D D+ EAL RLP ++V 
Sbjct  1    MTSLLKQVALPVFNSLATTYRSVVGAKLAKYGLRFDDLQDPLKDEDVAEALRRLPPDVVV  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQR  394
            ARN RL+RA+DLS KH  LP+DL   QTP  +YLQD+L  V+ ER ER  LGA   Y R
Sbjct  61   ARNCRLRRALDLSCKHEALPKDLLEKQTPELSYLQDVLNEVRAERRERAQLGAPAPYTR  119



>ref|XP_009605812.1| PREDICTED: cytochrome b-c1 complex subunit 7-2-like [Nicotiana 
tomentosiformis]
Length=87

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  32   MAMSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREI  211
            MA  S+ + L++ ++  LA++H K + +RLRKYGLR++DL+DP  D+DIKEAL RLPRE+
Sbjct  1    MAAPSWIQSLLNHRKKVLASMHMKCVSTRLRKYGLRFEDLFDPMEDMDIKEALRRLPREV  60

Query  212  VDARNQRLKRAMDLSMKHLYLPEDLQA  292
            VDAR+QRL RAMDLSMKH YLP+D+Q 
Sbjct  61   VDARHQRLLRAMDLSMKHQYLPDDIQV  87



>ref|XP_011398978.1| Cytochrome b-c1 complex subunit 7 [Auxenochlorella protothecoides]
 gb|KFM26082.1| Cytochrome b-c1 complex subunit 7 [Auxenochlorella protothecoides]
Length=126

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 75/115 (65%), Gaps = 0/115 (0%)
 Frame = +2

Query  59   LVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVDARNQRLK  238
            L DP    LA  ++  + + LRK GLRY+DLYDP +DLD  EAL RL  + V ARNQRLK
Sbjct  12   LFDPLVARLAPAYQAAVGNELRKVGLRYEDLYDPEFDLDTAEALRRLSPDEVHARNQRLK  71

Query  239  RAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            R MD+SMKH  LP ++Q  QTPF  YL + LA VK E  ER+ LG+   Y R +P
Sbjct  72   RGMDMSMKHSELPHEIQEQQTPFNFYLDETLAQVKAENEERKQLGSGRPYDRHLP  126



>ref|XP_003059247.1| mitochondrial tRNA import complex [Micromonas pusilla CCMP1545]
 gb|EEH56379.1| mitochondrial tRNA import complex [Micromonas pusilla CCMP1545]
Length=121

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            + EAL RLP+E  D R QRLKRAMDLSMKH+ L ++ QA QTPF  Y+  +L  V+ ER 
Sbjct  46   VAEALKRLPQEERDLRMQRLKRAMDLSMKHINLSKEEQAKQTPFLWYVTPVLREVEAERD  105

Query  356  EREALGALPLYQRTIP  403
            ER ALG    Y R IP
Sbjct  106  ERAALGTGQPYNRQIP  121



>ref|XP_002945797.1| hypothetical protein VOLCADRAFT_78796 [Volvox carteri f. nagariensis]
 gb|EFJ52792.1| hypothetical protein VOLCADRAFT_78796 [Volvox carteri f. nagariensis]
Length=123

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLPREIVD  217
            M+S       P    LA  ++  L  +L  YGLR+DDL DP  D D+ EAL RLP ++V 
Sbjct  1    MTSLLTQFTRPLYESLARTYRAALGEKLAHYGLRFDDLQDPLKDEDVAEALRRLPPDVVV  60

Query  218  ARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQR  394
            ARN RL+RA+DLS+KH  LP DL A QTP  +Y+Q++LA V+ ER ER  LGA   Y R
Sbjct  61   ARNCRLRRALDLSLKHEGLPADLLAKQTPELSYMQEVLAEVRAERRERAQLGAPAPYTR  119



>ref|XP_010494051.1| PREDICTED: uncharacterized protein LOC104771252 [Camelina sativa]
Length=105

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  275  PEDLQAMQTPFRNYLQDMLAIVKKERAEREALGALPLYQRTIP  403
            P + +AMQTPFR YLQDMLA+V++E  EREALGALPLYQRT+P
Sbjct  63   PTNQRAMQTPFRGYLQDMLALVERESKEREALGALPLYQRTLP  105



>gb|EEE68322.1| hypothetical protein OsJ_26597 [Oryza sativa Japonica Group]
Length=93

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQ  289
            IKEAL RLPRE+VDA NQRLKR MDLS KH YLP D Q
Sbjct  49   IKEALARLPREVVDAHNQRLKRTMDLSTKHQYLPADEQ  86



>ref|XP_009636648.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Egretta garzetta]
Length=79

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP +I + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEDIYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>gb|KFP15525.1| Cytochrome b-c1 complex subunit 7, partial [Egretta garzetta]
Length=105

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP +I + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEDIYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>ref|XP_009556309.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Cuculus canorus]
Length=79

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEDVYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>gb|KFO74045.1| Cytochrome b-c1 complex subunit 7, partial [Cuculus canorus]
Length=108

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEDVYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_005027050.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Anas platyrhynchos]
Length=79

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEDLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_010195129.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Colius striatus]
Length=79

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERH  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_009467582.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nipponia nippon]
Length=79

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEDLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>gb|EOA96045.1| Cytochrome b-c1 complex subunit 7, partial [Anas platyrhynchos]
Length=108

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEDLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>gb|EMC90685.1| Cytochrome b-c1 complex subunit 7, partial [Columba livia]
Length=104

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  37   VKEALKRLPEHVYNERMFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  96

Query  356  EREAL  370
            EREA 
Sbjct  97   EREAW  101



>gb|KFR01718.1| Cytochrome b-c1 complex subunit 7, partial [Nipponia nippon]
Length=108

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEDLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_009085276.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Serinus canaria]
Length=79

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERQ  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_009505978.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Phalacrocorax carbo]
 ref|XP_009576015.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Fulmarus glacialis]
 ref|XP_009910888.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Haliaeetus albicilla]
 ref|XP_009941836.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Opisthocomus hoazin]
 ref|XP_009949556.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Leptosomus discolor]
 ref|XP_009960875.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Tyto alba]
 ref|XP_010139607.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Buceros rhinoceros 
silvestris]
 ref|XP_010162268.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Caprimulgus carolinensis]
 ref|XP_010300455.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Balearica regulorum 
gibbericeps]
 ref|XP_010575384.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X3 [Haliaeetus 
leucocephalus]
Length=79

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_005499486.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Columba livia]
Length=111

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHVYNERMFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  103

Query  356  EREAL  370
            EREA 
Sbjct  104  EREAW  108



>ref|XP_008937646.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Merops 
nubicus]
 gb|KFQ18425.1| Cytochrome b-c1 complex subunit 7, partial [Merops nubicus]
Length=105

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERH  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>gb|KFZ54353.1| Cytochrome b-c1 complex subunit 7, partial [Podiceps cristatus]
Length=105

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERH  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>gb|KGL98728.1| Cytochrome b-c1 complex subunit 7, partial [Charadrius vociferus]
Length=108

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_010575383.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X2 [Haliaeetus 
leucocephalus]
Length=87

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  20   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  79

Query  356  EREALG  373
            EREA  
Sbjct  80   EREAWN  85



>ref|XP_005231059.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Falco peregrinus]
 ref|XP_005445443.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Falco cherrug]
Length=79

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>gb|KFO92935.1| Cytochrome b-c1 complex subunit 7, partial [Buceros rhinoceros 
silvestris]
Length=105

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>gb|KFZ54545.1| Cytochrome b-c1 complex subunit 7, partial [Caprimulgus carolinensis]
Length=108

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>gb|KFM04960.1| Cytochrome b-c1 complex subunit 7, partial [Aptenodytes forsteri]
 gb|KFP99216.1| Cytochrome b-c1 complex subunit 7, partial [Haliaeetus albicilla]
 gb|KFQ82165.1| Cytochrome b-c1 complex subunit 7, partial [Phaethon lepturus]
 gb|KFR17762.1| Cytochrome b-c1 complex subunit 7, partial [Opisthocomus hoazin]
 gb|KFW67371.1| Cytochrome b-c1 complex subunit 7, partial [Pygoscelis adeliae]
Length=108

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_009273783.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Aptenodytes 
forsteri]
 ref|XP_009322720.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Pygoscelis 
adeliae]
Length=107

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  40   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  99

Query  356  EREAL  370
            EREA 
Sbjct  100  EREAW  104



>ref|XP_009489537.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Pelecanus crispus]
Length=79

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>gb|KFQ81797.1| Cytochrome b-c1 complex subunit 7, partial [Phoenicopterus ruber 
ruber]
Length=105

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>gb|KFO10749.1| Cytochrome b-c1 complex subunit 7, partial [Balearica regulorum 
gibbericeps]
 gb|KFQ11419.1| Cytochrome b-c1 complex subunit 7, partial [Leptosomus discolor]
 gb|KFV45916.1| Cytochrome b-c1 complex subunit 7, partial [Tyto alba]
 gb|KFV92258.1| Cytochrome b-c1 complex subunit 7, partial [Fulmarus glacialis]
 gb|KFW96839.1| Cytochrome b-c1 complex subunit 7, partial [Phalacrocorax carbo]
Length=105

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>ref|XP_009693581.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Cariama cristata]
Length=79

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKRYLEPYLKEVIRERF  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>gb|KFO56846.1| Cytochrome b-c1 complex subunit 7, partial [Corvus brachyrhynchos]
Length=108

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERH  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_010004743.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Chaetura pelagica]
Length=95

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  28   VKEALRRLPEHLYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  87

Query  356  EREALG  373
            EREA  
Sbjct  88   EREAWN  93



>ref|XP_010403256.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Corvus cornix cornix]
Length=99

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  32   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERH  91

Query  356  EREALG  373
            EREA  
Sbjct  92   EREAWN  97



>ref|XP_010292664.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Phaethon lepturus]
 ref|XP_010575382.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X1 [Haliaeetus 
leucocephalus]
Length=111

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  103

Query  356  EREAL  370
            EREA 
Sbjct  104  EREAW  108



>gb|KFV69193.1| Cytochrome b-c1 complex subunit 7, partial [Picoides pubescens]
Length=108

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALRRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_005042381.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Ficedula albicollis]
Length=79

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERH  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>ref|NP_001232783.1| cytochrome b-c1 complex subunit 7-like [Taeniopygia guttata]
 gb|ACH44435.1| putative ubiquinol-cytochrome C reductase complex variant 2 [Taeniopygia 
guttata]
 gb|ACH44436.1| putative ubiquinol-cytochrome C reductase complex variant 2 [Taeniopygia 
guttata]
Length=111

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERQ  103

Query  356  EREAL  370
            EREA 
Sbjct  104  EREAW  108



>gb|KFU96249.1| Cytochrome b-c1 complex subunit 7, partial [Chaetura pelagica]
Length=108

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALRRLPEHLYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>gb|KFQ66398.1| Cytochrome b-c1 complex subunit 7, partial [Pelecanus crispus]
Length=105

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>ref|XP_010128833.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Chlamydotis macqueenii]
Length=79

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKHRILPKDQWVKYEEDKRYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_005422967.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Geospiza fortis]
Length=79

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERQ  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_009890227.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Charadrius vociferus]
Length=118

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  51   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  110

Query  356  EREAL  370
            EREA 
Sbjct  111  EREAW  115



>ref|XP_009901258.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Picoides pubescens]
Length=113

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  46   VKEALRRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKHYLEPYLKEVIRERL  105

Query  356  EREAL  370
            EREA 
Sbjct  106  EREAW  110



>ref|XP_005479545.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Zonotrichia 
albicollis]
Length=79

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERQ  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>gb|KFP62603.1| Cytochrome b-c1 complex subunit 7, partial [Cariama cristata]
Length=105

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKRYLEPYLKEVIRERF  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>gb|KFQ33774.1| Cytochrome b-c1 complex subunit 7, partial [Mesitornis unicolor]
Length=105

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWLKYEEDKHYLEPYLKEVIRERL  97

Query  356  EREAL  370
            EREA 
Sbjct  98   EREAW  102



>gb|KFV10010.1| Cytochrome b-c1 complex subunit 7, partial [Tauraco erythrolophus]
Length=108

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKRYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_008628958.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Corvus brachyrhynchos]
Length=130

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  63   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERH  122

Query  356  EREAL  370
            EREA 
Sbjct  123  EREAW  127



>ref|XP_008862571.1| hypothetical protein H310_01284 [Aphanomyces invadans]
 gb|ETW08766.1| hypothetical protein H310_01284 [Aphanomyces invadans]
Length=102

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLA  334
            ++ A++ L R+   AR +RL RA DLS K  YLPE++Q +Q PF  YLQD +A
Sbjct  35   VQRAVHWLNRDQSLARTRRLSRAADLSFKRAYLPEEIQNIQEPFNFYLQDKVA  87



>gb|EWM28744.1| mitochondrial trna import complex [Nannochloropsis gaditana]
Length=143

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            + +A++ L  E   AR +R+KRA+++S+K  YLP DLQ MQTP + YL   L  V+ E  
Sbjct  77   VTKAIHHLSPEEQVARERRIKRAIEISLKKKYLPADLQKMQTPLKPYLSHALDEVEAEET  136

Query  356  EREAL  370
            ER+ L
Sbjct  137  ERKLL  141



>ref|XP_009977162.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Tauraco 
erythrolophus]
Length=104

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        + YL+  L  V +ER 
Sbjct  37   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDKRYLEPYLKEVIRERL  96

Query  356  EREAL  370
            EREA 
Sbjct  97   EREAW  101



>ref|XP_010180848.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Mesitornis unicolor]
Length=111

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWLKYEEDKHYLEPYLKEVIRERL  103

Query  356  EREAL  370
            EREA 
Sbjct  104  EREAW  108



>ref|XP_008608179.1| hypothetical protein SDRG_04290 [Saprolegnia diclina VS20]
 gb|EQC38587.1| hypothetical protein SDRG_04290 [Saprolegnia diclina VS20]
Length=101

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            + +A++ L +E   AR +RL RA DLS K  YLPED+QA+Q P   YL D +  V+K   
Sbjct  34   VNKAVSWLGKEEKVARQRRLVRASDLSFKRAYLPEDIQAIQEPMNFYLDDKVEEVRKLGD  93

Query  356  EREAL  370
            ER  L
Sbjct  94   ERNKL  98



>gb|KFP92467.1| Cytochrome b-c1 complex subunit 7, partial [Apaloderma vittatum]
Length=108

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEAVKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_009875125.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Apaloderma 
vittatum]
Length=104

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  37   VKEAVKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  96

Query  356  EREAL  370
            EREA 
Sbjct  97   EREAW  101



>gb|KDO27696.1| hypothetical protein SPRG_07325 [Saprolegnia parasitica CBS 223.65]
Length=101

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            + +A++ L +E   AR +RL RA DLS K  YLPED+QA+Q P   YL D +  ++K   
Sbjct  34   VNKAVSWLGKEEKVARQRRLVRASDLSFKRAYLPEDIQAIQEPMNFYLDDKVEEIRKLGD  93

Query  356  EREAL  370
            ER  L
Sbjct  94   ERNKL  98



>ref|XP_005517066.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Pseudopodoces 
humilis]
Length=111

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERVFRIKRALDLSLKHQILPKDQWVKYEEDHPYLEPYLKEVIRERH  103

Query  356  EREAL  370
            EREA 
Sbjct  104  EREAW  108



>pdb|3CWB|F Chain F, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated 
Analogue Of The Polyketide Crocacin-d
 pdb|3CWB|S Chain S, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated 
Analogue Of The Polyketide Crocacin-d
 pdb|3H1L|F Chain F, Chicken Cytochrome Bc1 Complex With Ascochlorin Bound 
At Qo And Qi Sites
 pdb|3H1L|S Chain S, Chicken Cytochrome Bc1 Complex With Ascochlorin Bound 
At Qo And Qi Sites
Length=110

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP+++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  43   VKEALKRLPKDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  102

Query  356  EREAL  370
            EREA 
Sbjct  103  EREAW  107



>dbj|BAN20761.1| ubiquinol-cytochrome c reductase complex 14 kd protein [Riptortus 
pedestris]
Length=112

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  I+  RN R+ RA+ LS++H YLP++          YL  ++  VKKE+A
Sbjct  44   VKEALRRLPENILHERNFRIVRAVQLSIQHDYLPKEQWTKYEEDVKYLSPIIEQVKKEKA  103

Query  356  EREALGA  376
            E+E   A
Sbjct  104  EQEEWDA  110



>gb|KFW81092.1| Cytochrome b-c1 complex subunit 7, partial [Manacus vitellinus]
Length=105

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  38   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDNHYLEPYLKEVIRERR  97

Query  356  EREAL  370
            E+EA 
Sbjct  98   EKEAW  102



>ref|XP_008922299.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Manacus vitellinus]
Length=111

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  44   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDNHYLEPYLKEVIRERR  103

Query  356  EREAL  370
            E+EA 
Sbjct  104  EKEAW  108



>ref|XP_004940015.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X4 
[Gallus gallus]
Length=98

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  31   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  90

Query  356  EREALG  373
            EREA  
Sbjct  91   EREAWN  96



>pdb|3H1H|F Chain F, Cytochrome Bc1 Complex From Chicken
 pdb|3H1H|S Chain S, Cytochrome Bc1 Complex From Chicken
 pdb|3H1I|F Chain F, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex 
From Chicken
 pdb|3H1I|S Chain S, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex 
From Chicken
 pdb|3H1J|F Chain F, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
 pdb|3H1J|S Chain S, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
 pdb|3H1K|F Chain F, Chicken Cytochrome Bc1 Complex With Zn++ And An Iodinated 
Derivative Of Kresoxim-Methyl Bound
 pdb|3H1K|S Chain S, Chicken Cytochrome Bc1 Complex With Zn++ And An Iodinated 
Derivative Of Kresoxim-Methyl Bound
 pdb|3L70|F Chain F, Cytochrome Bc1 Complex From Chicken With Trifloxystrobin 
Bound
 pdb|3L70|S Chain S, Cytochrome Bc1 Complex From Chicken With Trifloxystrobin 
Bound
 pdb|3L71|F Chain F, Cytochrome Bc1 Complex From Chicken With Azoxystrobin 
Bound
 pdb|3L71|S Chain S, Cytochrome Bc1 Complex From Chicken With Azoxystrobin 
Bound
 pdb|3L72|F Chain F, Chicken Cytochrome Bc1 Complex With Kresoxym-i-dimethyl 
Bound
 pdb|3L72|S Chain S, Chicken Cytochrome Bc1 Complex With Kresoxym-i-dimethyl 
Bound
 pdb|3L73|F Chain F, Cytochrome Bc1 Complex From Chicken With Triazolone 
Inhibitor
 pdb|3L73|S Chain S, Cytochrome Bc1 Complex From Chicken With Triazolone 
Inhibitor
 pdb|3L74|F Chain F, Cytochrome Bc1 Complex From Chicken With Famoxadone 
Bound
 pdb|3L74|S Chain S, Cytochrome Bc1 Complex From Chicken With Famoxadone 
Bound
 pdb|3L75|F Chain F, Cytochrome Bc1 Complex From Chicken With Fenamidone 
Bound
 pdb|3L75|S Chain S, Cytochrome Bc1 Complex From Chicken With Fenamidone 
Bound
 pdb|3TGU|F Chain F, Cytochrome Bc1 Complex From Chicken With Pfvs-Designed 
Moa Inhibitor Bound
 pdb|3TGU|S Chain S, Cytochrome Bc1 Complex From Chicken With Pfvs-Designed 
Moa Inhibitor Bound
Length=110

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  43   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  102

Query  356  EREAL  370
            EREA 
Sbjct  103  EREAW  107



>ref|XP_010707455.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Meleagris gallopavo]
Length=111

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  103

Query  356  EREAL  370
            EREA 
Sbjct  104  EREAW  108



>ref|XP_004940014.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X3 
[Gallus gallus]
Length=107

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  40   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  99

Query  356  EREAL  370
            EREA 
Sbjct  100  EREAW  104



>ref|XP_009674294.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Struthio camelus 
australis]
Length=79

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  12   VKEALKRLPEPLYNERIFRMKRALDLSLKHQILPKEQWVKYEEDKRYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>ref|XP_007547796.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Poecilia formosa]
Length=110

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA DLSMK   LP+D         NYL   L  V +ER 
Sbjct  43   VKEALRRLPENVYNDRTFRMKRAFDLSMKQQILPKDQWTKYEEDVNYLTPYLEEVIRERK  102

Query  356  ERE  364
            ERE
Sbjct  103  ERE  105



>ref|XP_005760154.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Emiliania 
huxleyi CCMP1516]
 ref|XP_005764180.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Emiliania 
huxleyi CCMP1516]
 gb|EOD07725.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Emiliania 
huxleyi CCMP1516]
 gb|EOD11751.1| ubiquinol-cytochrome C reductase complex 14kD subunit [Emiliania 
huxleyi CCMP1516]
Length=123

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +K AL RLP ++++AR QRLKRAM LS +   LP ++     PF +YL   L  VKKE+ 
Sbjct  58   VKLALKRLPPDVLNAREQRLKRAMVLSSQIKTLPPEVAEKLDPFESYLGPYLEQVKKEKE  117

Query  356  E  358
            E
Sbjct  118  E  118



>gb|EHB12641.1| Cytochrome b-c1 complex subunit 7 [Heterocephalus glaber]
Length=111

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSLKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  EREALG  373
            ERE  G
Sbjct  104  EREEWG  109



>ref|XP_009816014.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Gavia stellata]
Length=79

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+K   LP+D        ++YL+  L  V +ER 
Sbjct  12   VKEALKRLPEHLYNERIFRIKRALDLSLKRQILPKDQWVKYEEDKHYLEPYLKEVIRERL  71

Query  356  EREALG  373
            EREA  
Sbjct  72   EREAWN  77



>gb|EDM07587.1| rCG63535 [Rattus norvegicus]
Length=79

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLSM+H  LP+D        + YL+  L  V +ER 
Sbjct  12   VKEAIRRLPENLYNDRMFRIKRALDLSMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  71

Query  356  EREALG  373
            ERE   
Sbjct  72   EREEWA  77



>gb|KFV81894.1| Cytochrome b-c1 complex subunit 7, partial [Struthio camelus 
australis]
Length=108

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  41   VKEALKRLPEPLYNERIFRMKRALDLSLKHQILPKEQWVKYEEDKRYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_004645372.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++  A     + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWAKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_003386823.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Amphimedon 
queenslandica]
Length=115

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP ++++ R  R+KRA+DLSMKH  LP D          YL  ++  V KE  
Sbjct  48   VKEAVRRLPEDVMNLRQFRIKRALDLSMKHSILPRDQWTKPEEDVQYLTPLIEQVTKEFL  107

Query  356  EREAL  370
            ER+A 
Sbjct  108  ERKAW  112



>gb|KFP84293.1| Cytochrome b-c1 complex subunit 7, partial [Acanthisitta chloris]
Length=108

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERL  100

Query  356  ERE  364
            ERE
Sbjct  101  ERE  103



>ref|XP_010009436.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Nestor notabilis]
Length=98

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  31   VKEAVRRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  90

Query  356  EREALG  373
            ERE   
Sbjct  91   EREEWN  96



>gb|KFQ41982.1| Cytochrome b-c1 complex subunit 7, partial [Nestor notabilis]
Length=108

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEAVRRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDQHYLEPYLKEVIRERL  100

Query  356  ERE  364
            ERE
Sbjct  101  ERE  103



>ref|XP_418347.4| PREDICTED: cytochrome b-c1 complex subunit 7-like isoformX2 [Gallus 
gallus]
Length=146

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP ++ + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  79   VKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERL  138

Query  356  EREAL  370
            EREA 
Sbjct  139  EREAW  143



>ref|XP_004631617.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++   +    + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRVFRIKRALDLSMKHQILPKEQWTIYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_009076930.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Acanthisitta 
chloris]
Length=104

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP+D          YL+  L  V +ER 
Sbjct  37   VKEALKRLPEHLYNERIFRIKRALDLSLKHQILPKDQWVKYEEDHRYLEPYLKEVIRERL  96

Query  356  ERE  364
            ERE
Sbjct  97   ERE  99



>gb|KFV45193.1| Cytochrome b-c1 complex subunit 7, partial [Gavia stellata]
Length=108

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+K   LP+D        ++YL+  L  V +ER 
Sbjct  41   VKEALKRLPEHLYNERIFRIKRALDLSLKRQILPKDQWVKYEEDKHYLEPYLKEVIRERL  100

Query  356  EREAL  370
            EREA 
Sbjct  101  EREAW  105



>ref|XP_009821544.1| hypothetical protein H257_00515 [Aphanomyces astaci]
 gb|ETV89144.1| hypothetical protein H257_00515 [Aphanomyces astaci]
Length=102

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLA  334
            ++ A++ L R+   AR +RL RA DLS K  YLPE++Q +Q P+  YL D +A
Sbjct  35   VQRAVHWLDRDQSLARTRRLSRAADLSFKRTYLPEEIQKIQEPYNFYLHDKVA  87



>gb|AAB30496.1| cytochrome-c reductase 14 kda subunit {P1 peptide} {EC 1.10.2.2.} 
[Solanum tuberosum=potatoes, cv. Hansa, Peptide Mitochondrial 
Partial, 26 aa]
Length=26

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  179  KEALNRLPREIVDARNQRLKRAMDLS  256
            KEALNRLPREIVDARNQRL RA+DLS
Sbjct  1    KEALNRLPREIVDARNQRLLRAVDLS  26



>ref|XP_005150932.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Melopsittacus 
undulatus]
Length=111

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP+D         +YL+  L  V +ER 
Sbjct  44   VKEAVRRLPEHLYNERMFRIKRALDLSLKHQILPKDQWVKYEEDHHYLEPYLKEVIRERL  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|NP_001019613.1| cytochrome b-c1 complex subunit 7 [Danio rerio]
 ref|XP_009292718.1| PREDICTED: cytochrome b-c1 complex subunit 7 isoform X1 [Danio 
rerio]
 gb|AAH95035.1| Ubiquinol-cytochrome c reductase binding protein [Danio rerio]
 gb|AAI65897.1| Ubiquinol-cytochrome c reductase binding protein [Danio rerio]
Length=111

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  RLKRAMDLSMKH  LP+D          YL+  L  V +ER 
Sbjct  44   VKEAVRRLPEPLYNERVFRLKRAMDLSMKHQILPKDQWTKFEQDVKYLEPYLQEVIRERK  103

Query  356  ERE  364
            E+E
Sbjct  104  EKE  106



>ref|NP_001121025.1| cytochrome b-c1 complex subunit 7 [Rattus norvegicus]
 gb|EDM16443.1| rCG60159 [Rattus norvegicus]
 gb|AAI66882.1| Uqcrb protein [Rattus norvegicus]
Length=111

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLSM+H  LP+D        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_005797417.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Xiphophorus 
maculatus]
Length=110

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLSMK   LP+D         NYL   L  V +ER 
Sbjct  43   VKEALRRLPENVGNDRVFRIKRALDLSMKQQILPKDQWTKYEEDVNYLTPYLEEVIRERK  102

Query  356  ERE  364
            ERE
Sbjct  103  ERE  105



>ref|XP_004638531.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWTKHEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|NP_080495.1| cytochrome b-c1 complex subunit 7 [Mus musculus]
 dbj|BAB25983.1| unnamed protein product [Mus musculus]
 dbj|BAB31397.1| unnamed protein product [Mus musculus]
 gb|AAH86921.1| Ubiquinol-cytochrome c reductase binding protein [Mus musculus]
 gb|AAI00602.1| Ubiquinol-cytochrome c reductase binding protein [Mus musculus]
 dbj|BAE40296.1| unnamed protein product [Mus musculus]
 dbj|BAE40676.1| unnamed protein product [Mus musculus]
 gb|EDL10333.1| mCG67985 [Mus musculus]
Length=111

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP ++ + R  R+KRA+DL+M+H  LP+D        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_009037032.1| hypothetical protein AURANDRAFT_26379, partial [Aureococcus anophagefferens]
 gb|EGB08306.1| hypothetical protein AURANDRAFT_26379, partial [Aureococcus anophagefferens]
Length=89

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  185  ALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERAERE  364
            AL R+  E V AR +R+KRA D+S K   LP DLQ +Q P   Y   ++   K  R ERE
Sbjct  25   ALGRISDEEVQARARRMKRAFDISFKKKSLPADLQRLQAPLAPYATPLIDEAKARRVERE  84

Query  365  AL  370
             L
Sbjct  85   LL  86



>ref|XP_004995655.1| ubiquinol-cytochrome C reductase [Salpingoeca rosetta]
 gb|EGD82419.1| ubiquinol-cytochrome C reductase [Salpingoeca rosetta]
Length=117

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            ++EA++RLPRE  D R  RLKRA+ LS++H YLP++        R YL  ++  V++E  
Sbjct  49   VREAISRLPREEQDLRYFRLKRALQLSVQHKYLPKEEWTTDETERYYLTPIIKQVEQELK  108

Query  356  EREAL  370
            E+E  
Sbjct  109  EKEEF  113



>gb|AAH31607.1| Ubiquinol-cytochrome c reductase binding protein [Mus musculus]
Length=111

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP ++ + R  R+KRA+DL+M+H  LP+D        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>sp|Q9D855.3|QCR7_MOUSE RecName: Full=Cytochrome b-c1 complex subunit 7; AltName: Full=Complex 
III subunit 7; AltName: Full=Complex III subunit VII; 
AltName: Full=Ubiquinol-cytochrome c reductase complex 14 
kDa protein [Mus musculus]
 dbj|BAB25678.1| unnamed protein product [Mus musculus]
Length=111

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP ++ + R  R+KRA+DL+M+H  LP+D        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPEDLYNDRMLRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_005181276.1| PREDICTED: cytochrome b-c1 complex subunit 7 [Musca domestica]
Length=111

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLPR++ D RN R+ RA+ LSM    LP+D          YL+  L  V KER 
Sbjct  43   VKEAIRRLPRKLYDERNYRIMRALHLSMTKTILPKDQWTKYEDDVKYLEPYLNEVIKERE  102

Query  356  ERE  364
            ERE
Sbjct  103  ERE  105



>gb|KHN32490.1| Cytochrome b-c1 complex subunit 7 [Glycine soja]
Length=63

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  38   MSSFSRWLVDPKRNPLAAIHKKTLDSRLRKyglryddlydpyydldIKEALNRLP  202
            M+SF +W +DPK+N  AA H K+L  RLRKYGLRYDDLYDPYYDLD+KEALNRLP
Sbjct  1    MASFLQWFLDPKKNWFAAQHMKSLSRRLRKYGLRYDDLYDPYYDLDVKEALNRLP  55



>ref|XP_004635428.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KR +DLSMKH  LP++  A     + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMLRIKRTLDLSMKHQILPKEQWAKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_004474746.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Dasypus novemcinctus]
Length=111

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DL+MKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIKRLPENVYNDRMFRIKRALDLTMKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_003479958.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Cavia porcellus]
Length=111

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_004627307.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_002112931.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV25041.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=120

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            I EAL RLP +   AR  R+KRA+D S+K+ YLP +        + YL+  L +V+KE+ 
Sbjct  53   IAEALRRLPEDEYMARQWRIKRALDCSLKNTYLPREEWTKVEDDKFYLKPYLDLVEKEKT  112

Query  356  EREAL  370
            ER++ 
Sbjct  113  ERKSF  117



>gb|KFP07518.1| Cytochrome b-c1 complex subunit 7, partial [Calypte anna]
Length=81

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  14   VKEALKRLPEHLYNERIFRIKRALDLSLKHRILPKEEWVKYEEDKPYLEPYLKEVIRERL  73

Query  356  EREALG  373
            ERE   
Sbjct  74   EREEWN  79



>ref|XP_006273293.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Alligator 
mississippiensis]
Length=79

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +K A+ RLP E+   R  R+KRA+DLSMKH  LP +        + YLQ  L  V +ER 
Sbjct  12   VKLAVKRLPPELYHERMFRIKRALDLSMKHRILPPEQWTKYEEDQRYLQPYLKEVIRERL  71

Query  356  EREAL  370
            EREA 
Sbjct  72   EREAW  76



>emb|CDW54961.1| cytochrome b c1 complex subunit 7 [Trichuris trichiura]
Length=95

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            ++EA+ RLP E  D R  RL RA  LS+KH YLP+           YLQ  L+ ++KE A
Sbjct  13   VEEAVRRLPAEEYDKRAFRLMRAAQLSLKHEYLPKSQWTKWEDETWYLQPQLSAIRKEYA  72

Query  356  EREALGALPLYQRT  397
            +   L  +  Y  T
Sbjct  73   DYRKLTGMKPYWAT  86



>ref|XP_004639579.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Octodon degus]
Length=111

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLSMKH  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLSMKHQILPKEQWTKYEEDKFYLEPYLKEVIQERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>gb|EHH64317.1| Ubiquinol-cytochrome c reductase complex 14 kDa protein [Macaca 
fascicularis]
Length=111

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DL+MKH  LP++          YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNGRVFRIKRALDLTMKHQILPKEQWTKYEEENFYLEPYLKEVIRERK  103

Query  356  ERE  364
            ERE
Sbjct  104  ERE  106



>ref|XP_004580673.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Ochotona princeps]
Length=111

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DL+++H  LP++        + YL+  L  V +ER 
Sbjct  44   VKEAIRRLPENLYNDRMFRIKRALDLTLRHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  103

Query  356  EREALG  373
            ERE  G
Sbjct  104  EREEWG  109



>ref|XP_008500690.1| PREDICTED: cytochrome b-c1 complex subunit 7, partial [Calypte 
anna]
Length=109

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEAL RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  42   VKEALKRLPEHLYNERIFRIKRALDLSLKHRILPKEEWVKYEEDKPYLEPYLKEVIRERL  101

Query  356  ERE  364
            ERE
Sbjct  102  ERE  104



>ref|XP_006130634.1| PREDICTED: cytochrome b-c1 complex subunit 7-like isoform X2 
[Pelodiscus sinensis]
Length=79

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +K AL RLP ++ + R  R+KRA+DLSMKH  LP+D          YL+  L  V +ER 
Sbjct  12   VKAALKRLPEKMYNERLFRIKRALDLSMKHQILPKDQWMKYEEDHKYLEPYLKEVIRERL  71

Query  356  EREALG  373
            ERE   
Sbjct  72   EREEWD  77



>pdb|1QCR|F Chain F, Crystal Structure Of Bovine Mitochondrial Cytochrome 
Bc1 Complex, Alpha Carbon Atoms Only
Length=103

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + D R  R+KRA+DLSM+   LP++        ++YL+  L  V +ER 
Sbjct  36   VKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERK  95

Query  356  EREALG  373
            ERE   
Sbjct  96   EREEWA  101



>ref|XP_002160238.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Hydra vulgaris]
Length=114

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +K A+ RL  E  + R  R+KRAMDLS+KH  LP+D          YL  ++  V KER 
Sbjct  47   VKNAVQRLSEEEYNLRAFRIKRAMDLSLKHQILPKDQWTKPEEDVFYLTPLVEAVTKERK  106

Query  356  EREAL  370
            ERE+L
Sbjct  107  ERESL  111



>pdb|1SQP|F Chain F, Crystal Structure Analysis Of Bovine Bc1 With Myxothiazol
Length=110

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + D R  R+KRA+DLSM+   LP++        ++YL+  L  V +ER 
Sbjct  43   VKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERK  102

Query  356  EREALG  373
            ERE   
Sbjct  103  EREEWA  108



>ref|XP_001505521.2| PREDICTED: cytochrome b-c1 complex subunit 7 [Ornithorhynchus 
anatinus]
Length=79

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DLS+KH  LP++        + YL+  L  V +ER 
Sbjct  12   VKEAIRRLPENLYNDRIFRIKRALDLSLKHQILPKEQWTKYEEDKFYLEPYLKEVIRERK  71

Query  356  EREALG  373
            ERE   
Sbjct  72   EREEWN  77



>ref|XP_006727830.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Leptonychotes 
weddellii]
Length=79

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  176  IKEALNRLPREIVDARNQRLKRAMDLSMKHLYLPEDLQAMQTPFRNYLQDMLAIVKKERA  355
            +KEA+ RLP  + + R  R+KRA+DL+M+H  LP++        + YL+  L  V +ER 
Sbjct  12   VKEAIRRLPENLYNDRMFRIKRALDLTMRHQILPKEQWTKYEEDKFYLETYLKEVIRERK  71

Query  356  EREALG  373
            ERE   
Sbjct  72   EREEWA  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750