BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN006K10

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1         182   5e-50   Nicotiana sylvestris
ref|XP_011094236.1|  PREDICTED: BEL1-like homeodomain protein 1         181   2e-49   
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1         180   4e-49   Nicotiana tomentosiformis
emb|CDP10596.1|  unnamed protein product                                178   2e-48   Coffea canephora [robusta coffee]
gb|ACD39466.1|  BEL29 protein                                           166   1e-44   Solanum palustre
ref|XP_004228612.1|  PREDICTED: BEL1-like homeodomain protein 1         164   2e-43   Solanum lycopersicum
ref|XP_006348466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    162   6e-43   Solanum tuberosum [potatoes]
gb|AAN03626.1|AF406702_1  BEL1-related homeotic protein 29              160   2e-42   Solanum tuberosum [potatoes]
gb|ACD39469.1|  BEL29 protein                                           159   5e-42   Solanum etuberosum
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1         159   8e-42   Prunus mume [ume]
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg             159   9e-42   
ref|XP_008367359.1|  PREDICTED: BEL1-like homeodomain protein 1         154   3e-41   
ref|XP_008391977.1|  PREDICTED: BEL1-like homeodomain protein 1         156   2e-40   
ref|XP_008360598.1|  PREDICTED: BEL1-like homeodomain protein 1         155   2e-40   
ref|XP_002524053.1|  bel1 homeotic protein, putative                    155   3e-40   Ricinus communis
ref|XP_009348973.1|  PREDICTED: BEL1-like homeodomain protein 1         154   9e-40   Pyrus x bretschneideri [bai li]
ref|XP_006430060.1|  hypothetical protein CICLE_v10011201mg             153   1e-39   
gb|KDO70617.1|  hypothetical protein CISIN_1g005514mg                   153   2e-39   Citrus sinensis [apfelsine]
ref|XP_006381943.1|  hypothetical protein POPTR_0006s21950g             152   3e-39   
ref|XP_006481599.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    151   9e-39   Citrus sinensis [apfelsine]
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1         150   1e-38   Eucalyptus grandis [rose gum]
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1         150   2e-38   
ref|XP_011046419.1|  PREDICTED: BEL1-like homeodomain protein 1         149   6e-38   Populus euphratica
gb|KJB16539.1|  hypothetical protein B456_002G234900                    148   7e-38   Gossypium raimondii
gb|EPS58511.1|  hypothetical protein M569_16303                         144   8e-38   Genlisea aurea
gb|KHG01894.1|  BEL1-like homeodomain protein 1                         147   9e-38   Gossypium arboreum [tree cotton]
emb|CAN63083.1|  hypothetical protein VITISV_015358                     148   1e-37   Vitis vinifera
gb|KDP36113.1|  hypothetical protein JCGZ_08757                         148   1e-37   Jatropha curcas
ref|XP_011042587.1|  PREDICTED: BEL1-like homeodomain protein 1         148   1e-37   Populus euphratica
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1         148   1e-37   Vitis vinifera
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1          146   4e-37   
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1         147   4e-37   
ref|XP_010107001.1|  BEL1-like homeodomain protein 1                    144   6e-37   
ref|XP_006373820.1|  hypothetical protein POPTR_0016s07040g             145   1e-36   
ref|XP_011467196.1|  PREDICTED: BEL1-like homeodomain protein 1         145   1e-36   Fragaria vesca subsp. vesca
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1         137   1e-33   Vitis vinifera
emb|CAN69527.1|  hypothetical protein VITISV_027380                     137   1e-33   Vitis vinifera
gb|KHG12855.1|  BEL1-like homeodomain protein 1                         136   1e-33   Gossypium arboreum [tree cotton]
gb|KHN10043.1|  BEL1-like homeodomain protein 1                         134   2e-33   Glycine soja [wild soybean]
ref|XP_002299773.2|  hypothetical protein POPTR_0001s22430g             136   2e-33   Populus trichocarpa [western balsam poplar]
gb|KHG12856.1|  BEL1-like homeodomain protein 1                         136   3e-33   Gossypium arboreum [tree cotton]
gb|KJB36260.1|  hypothetical protein B456_006G149100                    134   6e-33   Gossypium raimondii
gb|KHG11905.1|  BEL1-like homeodomain protein 1                         134   8e-33   Gossypium arboreum [tree cotton]
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    134   1e-32   Glycine max [soybeans]
gb|KHG11906.1|  BEL1-like homeodomain protein 1                         134   1e-32   Gossypium arboreum [tree cotton]
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1         132   6e-32   Nelumbo nucifera [Indian lotus]
ref|XP_011021429.1|  PREDICTED: BEL1-like homeodomain protein 1         132   1e-31   Populus euphratica
ref|XP_011003835.1|  PREDICTED: BEL1-like homeodomain protein 1         130   6e-31   Populus euphratica
gb|KJB62029.1|  hypothetical protein B456_009G396900                    128   1e-30   Gossypium raimondii
gb|KHN48417.1|  BEL1-like homeodomain protein 1                         127   1e-30   Glycine soja [wild soybean]
ref|XP_004494251.1|  PREDICTED: BEL1-like homeodomain protein 1-like    127   5e-30   Cicer arietinum [garbanzo]
gb|KHN33154.1|  BEL1-like homeodomain protein 1                         124   6e-30   Glycine soja [wild soybean]
gb|KEH24245.1|  BEL1-related homeotic protein                           126   7e-30   Medicago truncatula
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    126   9e-30   Glycine max [soybeans]
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g             125   1e-29   Phaseolus vulgaris [French bean]
gb|AFK35661.1|  unknown                                                 120   2e-29   Medicago truncatula
gb|KHN08605.1|  BEL1-like homeodomain protein 1                         124   3e-29   Glycine soja [wild soybean]
ref|XP_003554466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    124   3e-29   Glycine max [soybeans]
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    124   6e-29   Glycine max [soybeans]
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g             122   3e-28   Phaseolus vulgaris [French bean]
gb|EYU18114.1|  hypothetical protein MIMGU_mgv1a010011mg                119   3e-28   Erythranthe guttata [common monkey flower]
gb|KEH41936.1|  BEL1-related homeotic protein                           121   5e-28   Medicago truncatula
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor             120   8e-28   Trifolium pratense [peavine clover]
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1         120   2e-27   Cucumis melo [Oriental melon]
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like    117   2e-26   
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like    117   2e-26   
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                       117   2e-26   
ref|XP_010557975.1|  PREDICTED: BEL1-like homeodomain protein 1         114   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_007150022.1|  hypothetical protein PHAVU_005G119300g             109   6e-24   Phaseolus vulgaris [French bean]
ref|XP_007132496.1|  hypothetical protein PHAVU_011G099100g             108   1e-23   Phaseolus vulgaris [French bean]
ref|XP_010543867.1|  PREDICTED: BEL1-like homeodomain protein 1 i...    107   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010543869.1|  PREDICTED: BEL1-like homeodomain protein 1 i...    107   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_006854627.1|  hypothetical protein AMTR_s00030p00173920          106   9e-23   Amborella trichopoda
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1         105   1e-22   Phoenix dactylifera
ref|XP_004497655.1|  PREDICTED: BEL1-like homeodomain protein 1-like    100   1e-20   Cicer arietinum [garbanzo]
gb|KHN17979.1|  BEL1-like homeodomain protein 1                       99.8    1e-20   Glycine soja [wild soybean]
ref|XP_003539486.1|  PREDICTED: BEL1-like homeodomain protein 1-like  99.8    1e-20   Glycine max [soybeans]
ref|XP_010912386.1|  PREDICTED: BEL1-like homeodomain protein 1         100   1e-20   
gb|KJB35453.1|  hypothetical protein B456_006G115600                  97.8    9e-20   Gossypium raimondii
ref|XP_003543416.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  97.8    9e-20   Glycine max [soybeans]
gb|KEH29763.1|  BEL1-related homeotic protein                         96.7    2e-19   Medicago truncatula
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  93.6    2e-18   
emb|CBI24428.3|  unnamed protein product                              92.8    4e-18   Vitis vinifera
ref|XP_007150021.1|  hypothetical protein PHAVU_005G119300g           91.7    1e-17   Phaseolus vulgaris [French bean]
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1       87.4    3e-16   Phoenix dactylifera
ref|XP_010521016.1|  PREDICTED: BEL1-like homeodomain protein 1       87.4    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1       84.7    3e-15   Nicotiana tomentosiformis
ref|XP_010685441.1|  PREDICTED: BEL1-like homeodomain protein 1       83.6    6e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN21192.1|  BEL1-like homeodomain protein 1                       82.4    1e-14   Glycine soja [wild soybean]
ref|XP_003540818.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  82.0    2e-14   Glycine max [soybeans]
gb|ACC77468.1|  BEL1                                                  81.3    3e-14   Kalanchoe x houghtonii
ref|XP_007208166.1|  hypothetical protein PRUPE_ppa002583mg           80.9    4e-14   Prunus persica
ref|XP_008230296.1|  PREDICTED: BEL1-like homeodomain protein 1       79.7    9e-14   Prunus mume [ume]
gb|KJB55565.1|  hypothetical protein B456_009G082700                  79.7    1e-13   Gossypium raimondii
ref|XP_009778869.1|  PREDICTED: BEL1-like homeodomain protein 1       79.3    2e-13   Nicotiana sylvestris
gb|KHF99976.1|  BEL1-like homeodomain protein 1                       78.2    3e-13   Gossypium arboreum [tree cotton]
emb|CDX84171.1|  BnaC04g09330D                                        77.8    4e-13   
gb|KJB09137.1|  hypothetical protein B456_001G125400                  77.8    4e-13   Gossypium raimondii
emb|CDP15553.1|  unnamed protein product                              77.8    5e-13   Coffea canephora [robusta coffee]
emb|CDY40420.1|  BnaA04g20970D                                        77.0    7e-13   Brassica napus [oilseed rape]
ref|XP_009141535.1|  PREDICTED: BEL1-like homeodomain protein 1       77.0    8e-13   
gb|AFB32720.1|  hypothetical protein 0_17161_01                       72.4    1e-12   Larix decidua
emb|CDX75085.1|  BnaA05g08310D                                        75.9    2e-12   
ref|XP_006494895.1|  PREDICTED: BEL1-like homeodomain protein 1-like  74.7    5e-12   Citrus sinensis [apfelsine]
ref|XP_006424091.1|  hypothetical protein CICLE_v10027955mg           74.7    5e-12   Citrus clementina [clementine]
gb|KDO46590.1|  hypothetical protein CISIN_1g005901mg                 74.7    5e-12   Citrus sinensis [apfelsine]
ref|XP_006410764.1|  hypothetical protein EUTSA_v10016349mg           73.9    8e-12   
ref|XP_006293790.1|  hypothetical protein CARUB_v10022772mg           72.8    2e-11   
ref|XP_004506223.1|  PREDICTED: BEL1-like homeodomain protein 1-like  72.4    2e-11   Cicer arietinum [garbanzo]
emb|CDX79646.1|  BnaC03g19820D                                        72.4    3e-11   
ref|XP_010516801.1|  PREDICTED: BEL1-like homeodomain protein 1       70.1    3e-11   Camelina sativa [gold-of-pleasure]
gb|AEW08020.1|  hypothetical protein 0_17161_01                       68.2    3e-11   Pinus lambertiana
ref|XP_010507571.1|  PREDICTED: BEL1-like homeodomain protein 1       69.7    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009133059.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  72.0    3e-11   
emb|CDX84585.1|  BnaA03g16450D                                        72.0    4e-11   
gb|AEW08021.1|  hypothetical protein 0_17161_01                       67.0    6e-11   Pinus radiata
ref|XP_002881420.1|  hypothetical protein ARALYDRAFT_482564           71.2    7e-11   Arabidopsis lyrata subsp. lyrata
ref|NP_181138.1|  BEL1-like homeodomain 1                             70.9    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509532.1|  PREDICTED: BEL1-like homeodomain protein 1       70.5    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010505121.1|  PREDICTED: BEL1-like homeodomain protein 1       70.5    1e-10   Camelina sativa [gold-of-pleasure]
gb|AFB32721.1|  hypothetical protein 0_17161_01                       66.2    1e-10   Pinus mugo [mountain pine]
gb|AAK43836.1|AF353094_1  BEL1-like homeodomain 1                     70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32069.1|  BnaC04g44970D                                        69.7    2e-10   Brassica napus [oilseed rape]
ref|XP_010931060.1|  PREDICTED: BEL1-like homeodomain protein 1       69.7    2e-10   Elaeis guineensis
gb|AFB32724.1|  hypothetical protein 0_17161_01                       64.3    5e-10   Pinus mugo [mountain pine]
ref|XP_002313498.2|  hypothetical protein POPTR_0009s02250g           67.4    1e-09   
gb|AEW09250.1|  hypothetical protein UMN_1142_01                      59.3    2e-08   Pinus lambertiana
ref|XP_003539151.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  63.2    2e-08   Glycine max [soybeans]
gb|AEW09251.1|  hypothetical protein UMN_1142_01                      59.3    3e-08   Pinus radiata
ref|XP_009404911.1|  PREDICTED: BEL1-like homeodomain protein 1       62.4    5e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN19925.1|  BEL1-like homeodomain protein 1                       62.0    6e-08   Glycine soja [wild soybean]
ref|XP_010093716.1|  BEL1-like homeodomain protein 1                  61.6    6e-08   
ref|XP_010089795.1|  BEL1-like homeodomain protein 1                  60.8    1e-07   Morus notabilis
ref|XP_010676226.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  60.8    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676227.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  60.8    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010031566.1|  PREDICTED: BEL1-like homeodomain protein 1       55.8    7e-06   Eucalyptus grandis [rose gum]
ref|XP_008449596.1|  PREDICTED: BEL1-like homeodomain protein 1       55.5    8e-06   
ref|XP_010553582.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  55.5    9e-06   Tarenaya hassleriana [spider flower]
ref|XP_004140170.1|  PREDICTED: BEL1-like homeodomain protein 1-like  53.5    4e-05   
ref|NP_001234599.1|  bell-like homeodomain protein 2                  51.6    2e-04   Solanum lycopersicum
ref|NP_001274921.1|  BEL1-related homeotic protein 5                  50.8    3e-04   Solanum tuberosum [potatoes]
ref|XP_006361091.1|  PREDICTED: BEL1-related homeotic protein 5       50.4    5e-04   Solanum tuberosum [potatoes]
emb|CAC82983.1|  putative BEL1-like protein                           50.1    5e-04   Gnetum gnemon
gb|ACD39464.1|  BEL5 protein                                          49.7    8e-04   Solanum palustre



>ref|XP_009787672.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787673.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787674.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=707

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 128/184 (70%), Gaps = 31/184 (17%)
 Frame = +3

Query  6    FNLIGPS*MESIT--QGSPKKPRGG------SDMPA------------LMKFGNDRQNRE  125
            FNLIG   ++SI   QGSPKKPR        + +P+            L+KFG+DRQNR+
Sbjct  528  FNLIGSPEIKSINIGQGSPKKPRSNEILHSPNSVPSINMDVKPNEEQMLIKFGDDRQNRD  587

Query  126  GFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMSAT  302
            GF L+ G TNFM  FGSYP+ ++GRF+TEQF  PYST+  VSLTLGL HSENLS  MSAT
Sbjct  588  GFSLMGGPTNFMGGFGSYPIGEIGRFSTEQFSAPYSTSGTVSLTLGLPHSENLS--MSAT  645

Query  303  HHNFLP-----NQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
            HH+FLP      QMGRGV IG  EAN+F   + TPTSAH TSV++NFNIQNRKRF A LL
Sbjct  646  HHSFLPIPTQSIQMGRGVEIG--EANEF-GSLNTPTSAHSTSVYENFNIQNRKRFAAPLL  702

Query  468  PDFV  479
            PDFV
Sbjct  703  PDFV  706



>ref|XP_011094236.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=710

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 120/183 (66%), Gaps = 29/183 (16%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL---------------MKFGNDRQN  119
            GFNLIG + +ESITQGSPKK R        S +P++               MKFGN+RQ 
Sbjct  532  GFNLIGSTEIESITQGSPKKLRNADILHSPSSIPSMNMESKPTDPHNENMSMKFGNERQG  591

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R+GF L+   TNF+  FGSYP+ ++GRF TEQF  PYS N VSLTLGL H ENLS  MS 
Sbjct  592  RDGFTLMGAPTNFIGGFGSYPIGELGRFGTEQFQAPYSGNGVSLTLGLPHCENLS--MSG  649

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
             H  FLP+   Q+GRGV IG  E NDF  GM T T+ H T+V+DN NIQNRKRF AQLLP
Sbjct  650  AHQTFLPSQSIQLGRGVEIG--ETNDF-GGMNTQTNTHSTNVYDNINIQNRKRFAAQLLP  706

Query  471  DFV  479
            DFV
Sbjct  707  DFV  709



>ref|XP_009628712.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628714.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628715.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=700

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 128/186 (69%), Gaps = 32/186 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESI--TQGSPKKPRGG------SDMPAL------------MKFGNDRQNR  122
            GFNLIG    ESI   QGS KKPR        + +P++            +KFG+DRQNR
Sbjct  519  GFNLIGSPEKESINVAQGSQKKPRSNEMLHSPNSVPSINMDVKPNEEQMSIKFGDDRQNR  578

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMSA  299
            +GF L+ G TNFM  FGSYP+ ++GRF+TEQF  PYST+  VSLTLGL HSENLS  MSA
Sbjct  579  DGFSLMGGPTNFMGGFGSYPIGEIGRFSTEQFSAPYSTSGTVSLTLGLPHSENLS--MSA  636

Query  300  THHNFLP-----NQMGRGVV-IGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQ  461
            THH+FLP      QMGRGVV IG  EAN+F   + TPTSAH TSV++NFNIQNRKRF A 
Sbjct  637  THHSFLPIPTQSIQMGRGVVEIG--EANEF-GSLNTPTSAHSTSVYENFNIQNRKRFAAP  693

Query  462  LLPDFV  479
            LLPDFV
Sbjct  694  LLPDFV  699



>emb|CDP10596.1| unnamed protein product [Coffea canephora]
Length=680

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 117/176 (66%), Gaps = 31/176 (18%)
 Frame = +3

Query  30   MESITQGSPKKPRGGSDM----------------------PALMKFGNDRQNREGFPLVE  143
            M+SITQGSPKK R  +DM                         MKF N+RQNREGF L+ 
Sbjct  511  MDSITQGSPKKLRS-ADMLHSPSSVPSVSIDAKPNESNNEQLSMKFVNERQNREGFSLLG  569

Query  144  GSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN  323
              TNF+  FGSYP+ ++GRF++EQFP PYS N VSLTLGL H ENLS  +S  H NFLPN
Sbjct  570  APTNFIGGFGSYPIAEIGRFSSEQFPGPYSGNGVSLTLGLPHCENLS--ISGPHQNFLPN  627

Query  324  ---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
               Q+GRGV IG  EAND+  G+ TPTS+H TSV++N NIQNRKRF AQLLPDFV 
Sbjct  628  QNIQLGRGVEIG--EANDY-GGLGTPTSSHSTSVYENINIQNRKRFAAQLLPDFVA  680



>gb|ACD39466.1| BEL29 protein [Solanum palustre]
Length=516

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 123/187 (66%), Gaps = 32/187 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESI--TQGSPKKPRGG------SDMPAL------------MKFGNDRQNR  122
            GFNLIG   +ESI  TQGSPKKPR        + +P++            MKFG+DRQ+R
Sbjct  333  GFNLIGSPEIESINITQGSPKKPRSNEMLHSPNSIPSINMDVKPNEEQMSMKFGDDRQDR  392

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMSA  299
            +GF L+ G  NFM  FG+YP+ ++ RF+TEQF  PYST   VSLTLGL H+ENLS  MSA
Sbjct  393  DGFSLMGGPMNFMGGFGAYPIGEIARFSTEQFSAPYSTGGTVSLTLGLPHNENLS--MSA  450

Query  300  THHNFLP-----NQMGR-GVVIGEAEANDFVAGMTTPTSAHPT-SVFDNFNIQNRKRFPA  458
            THH+FLP      Q+GR G  IG  E N     + TPTSAH T SV++NFNIQNRKRF A
Sbjct  451  THHSFLPIPTQNIQIGRGGAEIG--EPNHEFGSLNTPTSAHSTSSVYENFNIQNRKRFAA  508

Query  459  QLLPDFV  479
             LLPDFV
Sbjct  509  PLLPDFV  515



>ref|XP_004228612.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=700

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 122/183 (67%), Gaps = 28/183 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESI--TQGSPKKPRGG-------SDMPAL------------MKFGNDRQN  119
            GFNLIG   +ESI  TQGSPKKPR         + +P++            MKFG+DRQ+
Sbjct  523  GFNLIGSPDIESINVTQGSPKKPRSNEMLQHSPNSIPSINMDVKPNEEQMSMKFGDDRQD  582

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMS  296
            R+GF L+ G  NFM  FG+YP+ ++ RF+TEQF  PYST+  VSLTLGL H+ENLS  MS
Sbjct  583  RDGFSLMGGPMNFMGGFGAYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLS--MS  640

Query  297  ATHHNFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPTS-VFDNFNIQNRKRFPAQLLPD  473
            ATHH+FLP    + V IG  E N     + TPTSAH TS V++NFNIQNRKRF A LLPD
Sbjct  641  ATHHSFLPIPT-QNVQIG--EPNHEFGSLNTPTSAHSTSNVYENFNIQNRKRFAAPLLPD  697

Query  474  FVT  482
            FVT
Sbjct  698  FVT  700



>ref|XP_006348466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348467.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Solanum 
tuberosum]
Length=704

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 122/181 (67%), Gaps = 26/181 (14%)
 Frame = +3

Query  3    GFNLIGPS*MESI--TQGSPKKPRGG------SDMPAL------------MKFGNDRQNR  122
            GFNLIG   +ESI  TQGSPKKPR        + +P++            MKFG+DRQ+R
Sbjct  527  GFNLIGSPEIESINITQGSPKKPRNNEMLHSPNSIPSINIDVKPNEQQMSMKFGDDRQDR  586

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMSA  299
            +GF L+ G  NFM  FG+YP+ ++ RF+TEQF  PYST+  VSLTLGL H+ENLS  MSA
Sbjct  587  DGFSLMGGPMNFMGGFGAYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLS--MSA  644

Query  300  THHNFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPT-SVFDNFNIQNRKRFPAQLLPDF  476
            THH+FLP    + + IG +E N     + TPTSAH T SV++NFNIQNRKRF A LLPDF
Sbjct  645  THHSFLPIPT-QNIQIG-SEPNHEFGSLNTPTSAHSTSSVYENFNIQNRKRFAAPLLPDF  702

Query  477  V  479
            V
Sbjct  703  V  703



>gb|AAN03626.1|AF406702_1 BEL1-related homeotic protein 29, partial [Solanum tuberosum]
Length=567

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 121/181 (67%), Gaps = 26/181 (14%)
 Frame = +3

Query  3    GFNLIGPS*MESI--TQGSPKKPRGG------SDMPAL------------MKFGNDRQNR  122
            GFNLIG   +ESI  TQGSPKKPR        + +P++            MKFG+DRQ+R
Sbjct  390  GFNLIGSPEIESINITQGSPKKPRNNEMLHSPNSIPSINMDVKPNEEQMSMKFGDDRQDR  449

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMSA  299
            +GF L+ G  NFM  FG+YP+ ++ RF+TEQF  PYST+  VSLTLGL H+ENLS  MSA
Sbjct  450  DGFSLMGGPMNFMGGFGAYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLS--MSA  507

Query  300  THHNFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPT-SVFDNFNIQNRKRFPAQLLPDF  476
            THH+FLP    + + IG +E N     + TPTSAH T SV++ FNIQNRKRF A LLPDF
Sbjct  508  THHSFLPIPT-QNIQIG-SEPNHEFGSLNTPTSAHSTSSVYETFNIQNRKRFAAPLLPDF  565

Query  477  V  479
            V
Sbjct  566  V  566



>gb|ACD39469.1| BEL29 protein [Solanum etuberosum]
Length=516

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 120/185 (65%), Gaps = 28/185 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESI--TQGSPKKPRGG------SDMPAL------------MKFGNDRQNR  122
            GFNLIG   +ESI  TQGSPKKPR        + +P++            MKFG+DRQ+R
Sbjct  333  GFNLIGSPEIESINITQGSPKKPRSNEMLHSPNSIPSINMDVKPNEEQMSMKFGDDRQDR  392

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMSA  299
            +GF L+ G  NFM  FG+YP+ ++ RF+TEQF  PYST+  VSLTLGL H+ENLS  MSA
Sbjct  393  DGFSLMGGPMNFMGGFGAYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLS--MSA  450

Query  300  THHNFLP----NQMGRGVVIGEAEANDFVAGMTTPTSAHPT-SVFDNFNIQNRKRFPAQL  464
            THH+FLP    N    G  +   E N     + TPTSAH T SV++NFNIQNRKRF A L
Sbjct  451  THHSFLPIPTQNIQIGGGGVEIGEPNHEFGSLNTPTSAHSTSSVYENFNIQNRKRFAAPL  510

Query  465  LPDFV  479
            LPDFV
Sbjct  511  LPDFV  515



>ref|XP_008241058.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241059.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241060.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241062.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=710

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 116/184 (63%), Gaps = 28/184 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-------GSDMPAL---------------MKFGNDRQ  116
            GF+LIG S ++ ITQGSPKKPR         S +P +               MKFG++RQ
Sbjct  529  GFSLIGSSELDGITQGSPKKPRSTEFMQSPNSSVPCMNMDHKAQEVNNEQVSMKFGDERQ  588

Query  117  NREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMS  296
             R+G+  + G TNF+ +FG YP+ ++GRF  +QF P +S N VSLTLGL H ENLS + +
Sbjct  589  GRDGYSFMGGQTNFIGSFGQYPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGA  648

Query  297  ATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
              H NFLPN   Q+GR V IG  EAND    + T ++ H ++ F+N +IQNRKRF AQLL
Sbjct  649  HHHQNFLPNQNIQLGRRVDIG--EANDQFGTINT-SAPHSSAAFENIDIQNRKRFVAQLL  705

Query  468  PDFV  479
            PDFV
Sbjct  706  PDFV  709



>ref|XP_007204250.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 ref|XP_007204251.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05449.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05450.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
Length=707

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 116/184 (63%), Gaps = 28/184 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-------GSDMPAL---------------MKFGNDRQ  116
            GF+LIG S ++ ITQGSPKKPR         S +P +               MKFG++RQ
Sbjct  526  GFSLIGSSELDGITQGSPKKPRSTEFMQSPNSSVPCMNMDHKAQEVNNEQLSMKFGDERQ  585

Query  117  NREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMS  296
             R+G+  + G TNF+ +FG YP+ ++GRF  +QF P +S N VSLTLGL H ENLS + +
Sbjct  586  GRDGYSFMGGQTNFIGSFGQYPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGA  645

Query  297  ATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
              H NFLPN   Q+GR V IG  EAND    + T ++ H ++ F+N +IQNRKRF AQLL
Sbjct  646  HHHQNFLPNQNIQLGRRVDIG--EANDQFGTINT-SAPHSSAAFENIDIQNRKRFVAQLL  702

Query  468  PDFV  479
            PDFV
Sbjct  703  PDFV  706



>ref|XP_008367359.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=349

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 108/182 (59%), Gaps = 25/182 (14%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPRG-------GSDMPAL-------------MKFGNDRQNRE  125
            F+LIG S ++ ITQGSPKKPR         S +P +             MKFGN+RQ R+
Sbjct  170  FSLIGSSELDGITQGSPKKPRSTEIMHSSNSGVPCMNMESQEVSNEQVSMKFGNERQGRD  229

Query  126  GFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATH  305
            G+  + G TNF+  FG YP+ ++GRF  +QF P +S N VSLTLGL H ENLS + +  H
Sbjct  230  GYSFMGGQTNFIGNFGQYPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHHH  289

Query  306  HNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDF  476
              FLPN   Q+GR V IG  E ND    + T       + F+N +IQNRKRF AQLLPDF
Sbjct  290  QTFLPNQNIQLGRRVDIG--ETNDQFGAINTSAPHSSAAAFENIDIQNRKRFVAQLLPDF  347

Query  477  VT  482
            V 
Sbjct  348  VA  349



>ref|XP_008391977.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008391978.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=708

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 108/182 (59%), Gaps = 25/182 (14%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-------GSDMPAL-------------MKFGNDRQNR  122
            GF LIG S ++ ITQGSPKKPR         S +P +             MKFGN+RQ R
Sbjct  528  GFTLIGSSELDGITQGSPKKPRSTEIMHSSNSGVPCMNMESQEVSNEQVSMKFGNERQGR  587

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+  + G TNF+  FG YP+ ++GRF  +QF P +S N VSLTLGL H ENLS + +  
Sbjct  588  DGYSFMGGQTNFIGNFGQYPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHH  647

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
            H  FLPN   Q+GR V IG  E ND    + T       + F+N +IQNRKRF AQLLPD
Sbjct  648  HQTFLPNQNIQLGRRVDIG--ETNDQFGAINTSAPHSSAAAFENIDIQNRKRFVAQLLPD  705

Query  474  FV  479
            FV
Sbjct  706  FV  707



>ref|XP_008360598.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008360599.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=710

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 108/182 (59%), Gaps = 25/182 (14%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-------GSDMPAL-------------MKFGNDRQNR  122
            GF LIG S ++ ITQGSPKKPR         S +P +             MKFGN+RQ R
Sbjct  530  GFTLIGSSELDGITQGSPKKPRSTEIMHSSNSGVPCMNMESQEVSNEQVSMKFGNERQGR  589

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+  + G TNF+  FG YP+ ++GRF  +QF P +S N VSLTLGL H ENLS + +  
Sbjct  590  DGYSFMGGQTNFIGNFGQYPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHH  649

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
            H  FLPN   Q+GR V IG  E ND    + T       + F+N +IQNRKRF AQLLPD
Sbjct  650  HQTFLPNQNIQLGRRVDIG--ETNDQFGAINTSAPHSSAAAFENIDIQNRKRFVAQLLPD  707

Query  474  FV  479
            FV
Sbjct  708  FV  709



>ref|XP_002524053.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF38263.1| bel1 homeotic protein, putative [Ricinus communis]
Length=679

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 117/184 (64%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL---------------MKFGNDRQN  119
            GF+LIG S +E ITQGSPK+ R        + +P++               MKFG++RQN
Sbjct  502  GFSLIGSSELEGITQGSPKRHRSTEMIQSPTSVPSINMDIKPGEMNNDQISMKFGSERQN  561

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R+G+  + G TNF+  FG YP+  +GRF TEQF P +S N VSLTLGL H ENLS  MS 
Sbjct  562  RDGYSFIGGQTNFIGGFGQYPIGDLGRFDTEQFTPRFSGNGVSLTLGLPHCENLS--MSG  619

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH +FLP+   Q+GR V I  +E N+F  G+ T T  H ++ +++ NIQNRKRF AQLLP
Sbjct  620  THESFLPSQNIQLGRRVEI--SEPNEF-GGINTST-PHSSTAYESINIQNRKRFAAQLLP  675

Query  471  DFVT  482
            DFV 
Sbjct  676  DFVA  679



>ref|XP_009348973.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348980.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348985.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
Length=710

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 108/182 (59%), Gaps = 25/182 (14%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-------GSDMPAL-------------MKFGNDRQNR  122
            GF LIG S ++ ITQGSPKKPR         S +P +             MKFG++RQ R
Sbjct  530  GFTLIGSSELDGITQGSPKKPRSTEIMHSSNSTVPCMNMESQEVSNEQVSMKFGDERQGR  589

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+  + G TNF+  FG YP+ ++GRF  +QF P +S N VSLTLGL H ENLS + +  
Sbjct  590  DGYSFMGGQTNFIGNFGQYPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHH  649

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
            H  FLPN   Q+GR V IG  E ND    + T       + F+N +IQNRKRF AQLLPD
Sbjct  650  HQTFLPNQNIQLGRRVDIG--ETNDQFGAINTSAPHSSAAAFENIDIQNRKRFVAQLLPD  707

Query  474  FV  479
            FV
Sbjct  708  FV  709



>ref|XP_006430060.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 ref|XP_006430061.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43300.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43301.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
Length=693

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 115/188 (61%), Gaps = 35/188 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG--------SDMPAL-----------------MKFGN  107
            GF+LIG S +E +TQGSPKKPR          S++P++                 MKF +
Sbjct  511  GFSLIGSSELEGLTQGSPKKPRNSDMNMMLSPSNVPSISIDVKPGGNEATNDLMPMKFDD  570

Query  108  D-RQNREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLS  284
            D RQ+R+G+  +    NF+  FG YP+ ++GRF  EQF P +S N VSLTLGL H ENLS
Sbjct  571  DDRQSRDGYSFIGNQMNFIQGFGQYPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS  630

Query  285  AAMSATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFP  455
              +SATH NFLP+   Q+GR V IG  E N+F  G     S H ++ ++N NIQNRKRF 
Sbjct  631  --LSATHQNFLPSQNIQLGRRVEIG--EPNEF--GTINTQSPHASAAYENMNIQNRKRFA  684

Query  456  AQLLPDFV  479
            AQLLPDFV
Sbjct  685  AQLLPDFV  692



>gb|KDO70617.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70618.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70619.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70620.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
Length=693

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 115/188 (61%), Gaps = 35/188 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG--------SDMPAL-----------------MKFGN  107
            GF+LIG S +E +TQGSPKKPR          S++P++                 MKF +
Sbjct  511  GFSLIGSSELEGLTQGSPKKPRNSDMNMMLSPSNVPSISIDVKPGGNEATNDLMPMKFDD  570

Query  108  D-RQNREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLS  284
            D RQ+R+G+  +    NF+  FG YP+ ++GRF  EQF P +S N VSLTLGL H ENLS
Sbjct  571  DDRQSRDGYSFIGNQMNFIQGFGQYPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS  630

Query  285  AAMSATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFP  455
              +SATH NFLP+   Q+GR V IG  E N+F  G     S H ++ ++N NIQNRKRF 
Sbjct  631  --LSATHQNFLPSQNIQLGRRVEIG--EPNEF--GTINTQSPHASAAYENMNIQNRKRFA  684

Query  456  AQLLPDFV  479
            AQLLPDFV
Sbjct  685  AQLLPDFV  692



>ref|XP_006381943.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381944.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381945.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_002308323.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381946.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381947.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381948.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59740.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59741.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59742.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|EEE91846.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59743.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59744.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59745.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
Length=678

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 115/183 (63%), Gaps = 30/183 (16%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL---------------MKFGNDRQN  119
            GF+ +G S ++ ITQGSPKKPR        + +P++               MKFG++RQ+
Sbjct  501  GFSFMGSSELDGITQGSPKKPRSHDLIQSPTSVPSINMDIKPGEANNEQVSMKFGDERQS  560

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R+G+  + G TNF+  FG YPM ++GRF  EQF P +S N VSLTLGL H ENLS  +S 
Sbjct  561  RDGYSFIGGQTNFIGGFGQYPMGEIGRFDGEQFTPRFSGNGVSLTLGLPHCENLS--LSG  618

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR V IG  E N++  G    ++ H ++ +++ +IQNRKRF AQLLP
Sbjct  619  THQTFLPNQNIQLGRRVEIG--EPNEY--GALNTSTPHSSTAYESIDIQNRKRFIAQLLP  674

Query  471  DFV  479
            DFV
Sbjct  675  DFV  677



>ref|XP_006481599.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481600.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Citrus 
sinensis]
Length=693

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 115/189 (61%), Gaps = 35/189 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG--------SDMPAL-----------------MKFGN  107
            GF+LIG S +E +TQGSPKKPR          S++P++                 MKF +
Sbjct  511  GFSLIGSSELEGLTQGSPKKPRNSDMNMMLSPSNVPSISIDVKPGGNEATNDLMPMKFDD  570

Query  108  D-RQNREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLS  284
            D RQ+R+G+  +    NF+  FG YP+ ++GRF  EQF P +S N VSLTLGL H ENLS
Sbjct  571  DDRQSRDGYSFIGNQMNFIQGFGQYPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS  630

Query  285  AAMSATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFP  455
              +SATH +FLP+   Q+GR V IG  E N+F  G     S H ++ ++N NIQNRKRF 
Sbjct  631  --LSATHQSFLPSQNIQLGRRVEIG--EPNEF--GTINTQSPHASAAYENMNIQNRKRFA  684

Query  456  AQLLPDFVT  482
            AQLLPDFV 
Sbjct  685  AQLLPDFVA  693



>ref|XP_010059079.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW90459.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
 gb|KCW90460.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
Length=703

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 35/190 (18%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL-----------MKFGNDRQNREGF  131
            GF L+GPS +E +TQGSPKKPR        S++ +L           MKF ++ Q R+G+
Sbjct  519  GFTLVGPSELEGLTQGSPKKPRSAELLQNLSNVSSLNVNPKLGEAISMKFIDEGQGRDGY  578

Query  132  PLVEGS-TNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVS---------LTLGLQHSENL  281
            P++ G   NF+  FG YPM ++GRF  +QF P +S N VS         LTLGL HSENL
Sbjct  579  PIIGGGPANFIGGFGQYPMGEIGRFGADQFAPSFSGNGVSPTFSGNGVSLTLGLPHSENL  638

Query  282  SAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRF  452
            S  +S  H +FLP+Q   +GR V IGEA  N+F A M TPT  H +S ++  NIQNRKRF
Sbjct  639  S--LSGAHQSFLPSQNIQLGRRVDIGEA--NEFGA-MNTPTIPHSSSAYETMNIQNRKRF  693

Query  453  PAQLLPDFVT  482
            P QLL DFV 
Sbjct  694  PVQLLQDFVA  703



>ref|XP_008387112.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387113.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387114.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=703

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 106/182 (58%), Gaps = 25/182 (14%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDMPAL--------------------MKFGNDRQNR  122
            GF LIG S ++ ITQGSPKKPR    M +                     MKFG++RQ R
Sbjct  523  GFTLIGSSELDGITQGSPKKPRSTEIMHSSNGSVPRMNIEAQEVNNEQVSMKFGDERQGR  582

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+  + G TNF+  FG YP+ ++GRF  +QF P +S N VSLTLGL H ENLS + +  
Sbjct  583  DGYSFMGGQTNFIGNFGQYPIGEIGRFDADQFAPRFSGNGVSLTLGLPHCENLSMSGAHR  642

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
            H  FLPN   Q+GR V  G  E ND    + T  S    + F+N +IQNRKRF AQLLPD
Sbjct  643  HQTFLPNQNIQLGRRVDTG--ETNDQFGAINTSASHSSAAAFENIDIQNRKRFVAQLLPD  700

Query  474  FV  479
            FV
Sbjct  701  FV  702



>ref|XP_011046419.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046420.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046421.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046422.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046423.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 115/184 (63%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL---------------MKFGNDRQN  119
            GF+ +G S ++ ITQGSPKKPR        + +P++               MKFG++RQ+
Sbjct  502  GFSFMGSSELDGITQGSPKKPRSHDLIQSPTSVPSINMDIKPGEANNEQVSMKFGDERQS  561

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R+G+  + G TNF+  FG YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  +S 
Sbjct  562  RDGYSFMGGQTNFIGGFGQYPIGEIGRFDGEQFTPRFSGNGVSLTLGLPHCENLS--LSG  619

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR V IG  E N++  G    ++ H ++ +++ +IQNRKR+ AQLLP
Sbjct  620  THQTFLPNQNIQLGRRVEIG--EPNEY--GALNTSTPHSSTAYESIDIQNRKRYIAQLLP  675

Query  471  DFVT  482
            DFV 
Sbjct  676  DFVA  679



>gb|KJB16539.1| hypothetical protein B456_002G234900 [Gossypium raimondii]
 gb|KJB16540.1| hypothetical protein B456_002G234900 [Gossypium raimondii]
Length=634

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 110/165 (67%), Gaps = 19/165 (12%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDMPALMKFGNDRQNREGFPLVEGSTN--FMAAFGS  176
            GF+ IG S +E ITQGSPKKPR  +++   MKF     +++G+  + G+TN  FM  FG 
Sbjct  482  GFSFIGSSELEGITQGSPKKPRTNNEV--TMKF-----DKDGYTFMGGTTNNDFMGGFGQ  534

Query  177  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT-HHNFLPN---QMGRGVV  344
            YP+ ++ RF TEQF P +S N VSLTLGL H ENLS  +S T H  FLPN   QMGR V 
Sbjct  535  YPIGEITRFDTEQFTPRFSGNGVSLTLGLPHCENLS--LSGTPHQTFLPNQAMQMGRRVD  592

Query  345  IGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            IG  E N+F  G   P++ H ++ +DN NIQNRKRF AQLLPDFV
Sbjct  593  IG--EPNEF--GSINPSTPHSSAAYDNINIQNRKRFAAQLLPDFV  633



>gb|EPS58511.1| hypothetical protein M569_16303, partial [Genlisea aurea]
Length=298

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 114/190 (60%), Gaps = 34/190 (18%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPRG-GSDM---PA---------------LMKFGNDRQNRE-  125
            FNLI PS ++ I Q SPKK R    D+   PA                +KF  DRQNRE 
Sbjct  112  FNLIRPSEIDHIAQVSPKKMRNVARDVLHSPASITAMSMESKPGDEETLKFHADRQNREA  171

Query  126  ---GFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHS--ENLSAA  290
               GF L+   TNF++ FGSYPM ++GR+T EQFP  YS N VSLTLGL HS  ENL   
Sbjct  172  GGGGFTLLGAPTNFISGFGSYPMAELGRYTAEQFPAAYSGNGVSLTLGLPHSHCENLQIQ  231

Query  291  MSATHH---NFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRF  452
             S  HH   NFLPN   Q+GRGV I  ++  D+ AG+  P  A P ++++N NIQ+RKRF
Sbjct  232  GSHRHHHHQNFLPNQSIQLGRGVEI--SDPGDY-AGLNPPAGAAPGNIYENINIQSRKRF  288

Query  453  PAQLLPDFVT  482
             +QLLPDFV 
Sbjct  289  ASQLLPDFVA  298



>gb|KHG01894.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=634

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 110/165 (67%), Gaps = 19/165 (12%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDMPALMKFGNDRQNREGFPLVEGSTN--FMAAFGS  176
            GF+ IG S +E ITQGSPKKPR  +++   MKF     +++G+  + G+TN  FM  FG 
Sbjct  482  GFSFIGSSELEGITQGSPKKPRTNNEV--TMKF-----DKDGYTFMGGTTNNDFMGGFGQ  534

Query  177  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT-HHNFLPN---QMGRGVV  344
            YP+ ++ RF TEQF P +S N VSLTLGL H ENLS  +S T H  FLPN   QMGR V 
Sbjct  535  YPIGEITRFDTEQFTPRFSGNGVSLTLGLPHCENLS--LSGTPHQTFLPNQAMQMGRRVD  592

Query  345  IGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            IG  E N+F  G   P++ H ++ +DN NIQNRKRF AQLLPDFV
Sbjct  593  IG--EPNEF--GSINPSTPHSSAAYDNINIQNRKRFAAQLLPDFV  633



>emb|CAN63083.1| hypothetical protein VITISV_015358 [Vitis vinifera]
Length=709

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 110/180 (61%), Gaps = 30/180 (17%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPRGG------SDMPAL---------------MKFGNDRQNR  122
            F L+GPS ME + QGSPKKPR        S +P++               MKF N+RQ R
Sbjct  531  FTLMGPSEMEGMAQGSPKKPRSTDVLHSPSSVPSMDMDVKPGEANHHHISMKFSNERQGR  590

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+PL+ G TNF+  F SY + ++GRF  EQF P +S N VSLTLGL H ENLS  +S T
Sbjct  591  DGYPLMAGPTNFIGGFESYSLGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSGT  648

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
            H  FLPN   Q+GR V +G  E N++  G    T+ H T+ ++N N+QN KRF AQLLPD
Sbjct  649  HQTFLPNQNIQLGRRVDMG--EPNEY--GTINTTTPHSTAAYENINMQNGKRFAAQLLPD  704



>gb|KDP36113.1| hypothetical protein JCGZ_08757 [Jatropha curcas]
Length=676

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 117/185 (63%), Gaps = 32/185 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL---------------MKFGNDRQN  119
            GF+LIG S +E +TQ SPK+ R        + +P++               MKFG++RQ+
Sbjct  497  GFSLIGSSELEGLTQASPKRHRSTELIQSPNSVPSINMDVKPGETNNEQISMKFGSERQS  556

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQ--FPPPYSTNAVSLTLGLQHSENLSAAM  293
            R+G+  +   TNF+  FG YP+ ++GRF TEQ   PP +S NAVSLTLGL H ENLS  +
Sbjct  557  RDGYSFIGAQTNFIGGFGQYPIGELGRFDTEQQFTPPRFSGNAVSLTLGLPHCENLS--L  614

Query  294  SATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQL  464
            SATH  FLPN   Q+GR V +G  E N+F  G+ T T  H ++ +D+ +IQNRKRF AQL
Sbjct  615  SATHQTFLPNQNIQLGRRVEMG--EPNEF-GGINTST-PHSSTAYDSIDIQNRKRFAAQL  670

Query  465  LPDFV  479
            LPDFV
Sbjct  671  LPDFV  675



>ref|XP_011042587.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042589.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042590.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042591.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042592.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042593.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 114/184 (62%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG------GSDMPAL---------------MKFGNDRQN  119
            GF+ IG S +E ITQ SPKK R        + +P++               +KFG++RQ+
Sbjct  502  GFSFIGSSELEGITQRSPKKRRSNDLIQSSTSVPSINMDIKPGEANNEQVSVKFGSERQS  561

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R+G+  + G TNF+  FG YP+ ++GRF  EQF P +S N VSL+LGL H ENLS  +S 
Sbjct  562  RDGYSFMGGQTNFIGGFGQYPIGEIGRFDGEQFTPRFSGNGVSLSLGLPHCENLS--LSG  619

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR V IG  EAN+F  G    ++ H ++ +D+ ++QNRKRF AQLLP
Sbjct  620  THQTFLPNQNIQLGRRVEIG--EANEF--GAINTSTPHSSTAYDSIDMQNRKRFIAQLLP  675

Query  471  DFVT  482
            DFV 
Sbjct  676  DFVA  679



>ref|XP_002266838.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653287.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653288.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653289.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653290.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653292.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=696

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 110/180 (61%), Gaps = 30/180 (17%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPRGG------SDMPAL---------------MKFGNDRQNR  122
            F L+GPS ME + QGSPKKPR        S +P++               MKF N+RQ R
Sbjct  518  FTLMGPSEMEGMAQGSPKKPRSTDVLHSPSSVPSMDMDVKPGEANHHHISMKFSNERQGR  577

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+PL+ G TNF+  F SY + ++GRF  EQF P +S N VSLTLGL H ENLS  +S T
Sbjct  578  DGYPLMAGPTNFIGGFESYSLGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSGT  635

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
            H  FLPN   Q+GR V +G  E N++  G    T+ H T+ ++N N+QN KRF AQLLPD
Sbjct  636  HQTFLPNQNIQLGRRVDMG--EPNEY--GTINTTTPHSTAAYENINMQNGKRFAAQLLPD  691



>ref|XP_007027982.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027983.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027984.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08484.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08485.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08486.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
Length=668

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 34/183 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL--------------MKFGNDRQNR  122
            GF+LIG S +E ITQGSPKKPR        S +P++              MKFG     +
Sbjct  497  GFSLIGSSELEGITQGSPKKPRSTELLQSPSSVPSINIDIKQSEANNEVSMKFG-----K  551

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            EG+  +  +TNFM  FG YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  +S T
Sbjct  552  EGYSFMGTNTNFMGGFGQYPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSGT  609

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
            H   LPN   QMGR + IG  E N+F      P++ H ++ ++N +IQNRKRF AQLLPD
Sbjct  610  HQTLLPNPNLQMGRRLDIG--EPNEFAT--INPSAPHSSAAYENISIQNRKRFAAQLLPD  665

Query  474  FVT  482
            FV 
Sbjct  666  FVA  668



>ref|XP_010247184.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247191.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247201.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247208.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247219.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247226.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247233.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=729

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 110/182 (60%), Gaps = 27/182 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPR--------------------GGSDMPALMKFGNDRQNR  122
            GF+LIG S M+ + QGSPKKP                     G S+     KF N RQ+R
Sbjct  551  GFSLIGSSDMDGLIQGSPKKPCSTEMQNSPSSISVMDMDVKPGDSNRDLFAKFQNGRQSR  610

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+ L+ G+TN   AF +Y + ++GRF  EQF P +S N VSLTLGL H ENLS  +S T
Sbjct  611  DGYSLITGTTNNGEAFDTYSIGELGRFDPEQFTPRFSGNGVSLTLGLPHCENLS--LSGT  668

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
               FL N   Q+GR + +G  E NDF  G++TP S H ++ ++N NIQNRKRF AQLLPD
Sbjct  669  QQTFLSNQNIQLGRRLEMGGGEPNDFC-GLSTP-SPHSSAAYENINIQNRKRFAAQLLPD  726

Query  474  FV  479
            +V
Sbjct  727  YV  728



>ref|XP_010107001.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC12999.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=441

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 110/184 (60%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG---------------------GSDMPALMKFGNDRQN  119
            GF+LIG S ++ ITQGSPKKPR                      G+D  + MKFG++RQ+
Sbjct  264  GFSLIGSSELDGITQGSPKKPRNDMMQSPNSIPSITMDVKPGKMGNDHISSMKFGDERQS  323

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R+G+  + G TNF++ FG YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  +S 
Sbjct  324  RDGYSFMGGQTNFISGFGQYPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSG  381

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
             H +F+ N   Q+GR +     E N++ A  T+   +   + F+  NIQN KRF AQLLP
Sbjct  382  AHQSFVSNQSIQLGRNI----GEPNEYSAINTSAPHSSAAAAFETINIQNPKRFAAQLLP  437

Query  471  DFVT  482
            D+V 
Sbjct  438  DYVA  441



>ref|XP_006373820.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_002323384.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_006373821.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 ref|XP_006373822.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51617.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|EEF05145.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51618.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 gb|ERP51619.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
Length=679

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 110/183 (60%), Gaps = 30/183 (16%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG---------------------GSDMPALMKFGNDRQN  119
            GF+ IG S +E ITQ SPKK R                       +D    +KFG++RQ+
Sbjct  502  GFSFIGSSELEGITQRSPKKRRSNDFIQSSTSVPSINMDIKPGEANDEQVSVKFGSERQS  561

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R+G+  + G TNF+  FG YP+ ++GRF  EQF P +S N VSL+LGL H ENLS  +S 
Sbjct  562  RDGYSFMGGQTNFIGGFGQYPIGEIGRFDGEQFTPRFSGNGVSLSLGLPHCENLS--LSG  619

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR V IG  E N+F  G    ++ H ++ +++ +IQNRKRF AQLLP
Sbjct  620  THQTFLPNQNIQLGRRVEIG--EPNEF--GAINTSTPHSSTAYESIDIQNRKRFLAQLLP  675

Query  471  DFV  479
            DFV
Sbjct  676  DFV  678



>ref|XP_011467196.1| PREDICTED: BEL1-like homeodomain protein 1 [Fragaria vesca subsp. 
vesca]
Length=704

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 114/183 (62%), Gaps = 28/183 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG--------------------SDMPALMKFGNDRQNR  122
            GF+LIG S ++ ITQGSPKKPR                      S+    MKFG++RQ+R
Sbjct  525  GFSLIGSSELDGITQGSPKKPRSTEIMHSPNSMMNHMDVKPQEVSNEQVSMKFGDERQSR  584

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+  + G TNF+  FG YP+ ++GRF T+QF P +S N+VSL+LGL H ENLS +  A 
Sbjct  585  DGYSFMGGQTNFIGNFGQYPIGEIGRFDTDQFTPRFSGNSVSLSLGLPHCENLSLS-GAH  643

Query  303  HHNFLPN---QMGRGVV-IGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            H  FLPN   Q+GR V  IG  E ND    M T ++ H ++ F++ +IQNRKRF AQLLP
Sbjct  644  HQTFLPNQNIQLGRRVDHIG--EPNDQFGTMNT-SAPHSSAGFESIDIQNRKRFVAQLLP  700

Query  471  DFV  479
            DFV
Sbjct  701  DFV  703



>ref|XP_002275098.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=728

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 106/184 (58%), Gaps = 28/184 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPR--------------------GGSDMPALMKFGNDRQNR  122
            GFNLIG S +E + Q SPKKPR                    GG+     MKFG++RQ +
Sbjct  549  GFNLIGSSEIEGMVQRSPKKPRSYDIQSSPSSILSMDMEMKPGGTSREISMKFGSERQAK  608

Query  123  EGFPLVEGSTNFMAAFGSY-PMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            +G+PL+ G+ N    FG+Y P+  +GRF  EQ  P +  N+VSLTLGL H ENLS  +S 
Sbjct  609  DGYPLITGAINNGGGFGAYSPIGDIGRFNPEQLAPRFHGNSVSLTLGLPHCENLS--LSG  666

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            +  ++L N   Q+GR + +G  E +    G+     +H  + +D+ NIQNRKRF AQLLP
Sbjct  667  SQQSYLSNPNVQLGRRLEMGNGEPD--YCGINAAQPSHSNAAYDSINIQNRKRFAAQLLP  724

Query  471  DFVT  482
            DFV 
Sbjct  725  DFVA  728



>emb|CAN69527.1| hypothetical protein VITISV_027380 [Vitis vinifera]
Length=728

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 106/184 (58%), Gaps = 28/184 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPR--------------------GGSDMPALMKFGNDRQNR  122
            GFNLIG S +E + Q SPKKPR                    GG+     MKFG++RQ +
Sbjct  549  GFNLIGSSEIEGMVQRSPKKPRSYDIQSSPSSILSMDMEMKPGGTSREISMKFGSERQAK  608

Query  123  EGFPLVEGSTNFMAAFGSY-PMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            +G+PL+ G+ N    FG+Y P+  +GRF  EQ  P +  N+VSLTLGL H ENLS  +S 
Sbjct  609  DGYPLITGAINNGGGFGAYXPIGDIGRFNPEQLAPRFHGNSVSLTLGLPHCENLS--LSG  666

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            +  ++L N   Q+GR + +G  E +    G+     +H  + +D+ NIQNRKRF AQLLP
Sbjct  667  SQQSYLSNPNVQLGRRLEMGNGEPD--YCGINAAQPSHSNAAYDSINIQNRKRFAAQLLP  724

Query  471  DFVT  482
            DFV 
Sbjct  725  DFVA  728



>gb|KHG12855.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=644

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 104/175 (59%), Gaps = 22/175 (13%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGS-------DMPALMKFGND----RQNREGFPLVEGS  149
            G++ IG S +E ITQGSPKKPR          DM    +   D    +  +EG+  +   
Sbjct  475  GYSFIGSSELEGITQGSPKKPRSTEVLLQSPIDMDTKQREAADDVSIKFGKEGYSFMGTD  534

Query  150  TNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN--  323
            TNF+  FG YP+ +M RF  E F P +  N VSLTLGL H ENLS  +SATH  FLPN  
Sbjct  535  TNFIGGFGQYPIAEMARFDAEHFAPRFPGNGVSLTLGLPHCENLS--LSATHQTFLPNQT  592

Query  324  -QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVF--DNFNIQNRKRFPAQLLPDFV  479
             QMGR + IG  E N++  G   P++ H ++ +  +N ++QNRKRF AQLLPDFV
Sbjct  593  LQMGRRLDIG--EPNEY--GAINPSTPHSSAAYEIENIDVQNRKRFAAQLLPDFV  643



>gb|KHN10043.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=431

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 110/183 (60%), Gaps = 32/183 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL--------------MKFGNDRQNR  122
            GF+ +G S ++ ITQGSPKKPR        + +P++              +    +RQNR
Sbjct  256  GFSFMGSSELDGITQGSPKKPRNHEILRSPNRVPSINMDVKANEANNEQQLSMDLERQNR  315

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMSA  299
            +G+  +   TNF++ FG YPME++GRF  EQF P +S  N VSLTLGL H + L    S 
Sbjct  316  DGYTFMGNQTNFISGFGQYPMEEIGRFDAEQFTPRFSGNNGVSLTLGLPHCDTL----SG  371

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH +FLPN   Q+GRG+ IG  E N F  G    +++H ++ F++ N+QN KRF AQLLP
Sbjct  372  THQSFLPNQNIQLGRGLDIG--EPNQF--GALNNSTSHSSAAFESINMQNPKRFAAQLLP  427

Query  471  DFV  479
            DFV
Sbjct  428  DFV  430



>ref|XP_002299773.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
 gb|EEE84578.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
Length=732

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 109/183 (60%), Gaps = 32/183 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGS-----------DMPAL---------MKFGNDRQNR  122
            GF LIGP+ ME I Q S KKPR G            DM            + FG DR  +
Sbjct  557  GFTLIGPAEMEGIAQSS-KKPRSGDMQNSPSSILSMDMDVKHGETSREIGVNFGGDRLTK  615

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+PL+ GS     +FG+YPM  +GRF  EQ  P +S N+VSLTLGL H ENLS  +S T
Sbjct  616  DGYPLITGSN---GSFGAYPMGDLGRFNIEQLTPRFSGNSVSLTLGLPHCENLS--LSGT  670

Query  303  HHNFLPNQM----GRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
              N+L +Q     GR + IG +E  DF +G+ T  ++H +S F++ +IQNRKRFPAQLLP
Sbjct  671  QQNYLSSQNIQLGGRRIEIGTSEP-DF-SGINTSQNSHSSSGFESVDIQNRKRFPAQLLP  728

Query  471  DFV  479
            DFV
Sbjct  729  DFV  731



>gb|KHG12856.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=763

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 104/175 (59%), Gaps = 22/175 (13%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGS-------DMPALMKFGND----RQNREGFPLVEGS  149
            G++ IG S +E ITQGSPKKPR          DM    +   D    +  +EG+  +   
Sbjct  594  GYSFIGSSELEGITQGSPKKPRSTEVLLQSPIDMDTKQREAADDVSIKFGKEGYSFMGTD  653

Query  150  TNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN--  323
            TNF+  FG YP+ +M RF  E F P +  N VSLTLGL H ENLS  +SATH  FLPN  
Sbjct  654  TNFIGGFGQYPIAEMARFDAEHFAPRFPGNGVSLTLGLPHCENLS--LSATHQTFLPNQT  711

Query  324  -QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVF--DNFNIQNRKRFPAQLLPDFV  479
             QMGR + IG  E N++  G   P++ H ++ +  +N ++QNRKRF AQLLPDFV
Sbjct  712  LQMGRRLDIG--EPNEY--GAINPSTPHSSAAYEIENIDVQNRKRFAAQLLPDFV  762



>gb|KJB36260.1| hypothetical protein B456_006G149100 [Gossypium raimondii]
Length=644

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 102/175 (58%), Gaps = 22/175 (13%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGS-------DMPALMKFGND----RQNREGFPLVEGS  149
            GF+ IG S +E ITQGSPKKPR          DM    +   D    +  +EG+  +   
Sbjct  475  GFSFIGSSELEGITQGSPKKPRSTEVLLQSPIDMDIKQREAADDVSIKFGKEGYSFMGTD  534

Query  150  TNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN--  323
            TNFM  FG YP+ +M RF  E F P +  N VSLTLGL H ENLS  + ATH  FLPN  
Sbjct  535  TNFMGGFGQYPIAEMARFDAEHFAPRFPGNGVSLTLGLPHCENLS--LPATHQTFLPNQT  592

Query  324  -QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVF--DNFNIQNRKRFPAQLLPDFV  479
             QMGR + IG  E N++  G   P++ H +  +  +N ++QNRKRF AQLLPDFV
Sbjct  593  LQMGRRLDIG--EPNEY--GAINPSTPHSSVAYEIENIDVQNRKRFAAQLLPDFV  643



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 105/181 (58%), Gaps = 34/181 (19%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPRGG------SDMPAL--------------MKFGNDRQNRE  125
            F+LIG S +E I QGSPKKPR        S +P++              MKF  D     
Sbjct  483  FSLIGSSELEGINQGSPKKPRSNELLQSPSSVPSMNMDMNQSEASNEVSMKFSKD-----  537

Query  126  GFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATH  305
            G+  +  +T+FM   G YP+ ++GRF  EQF P +  N VSLTLGL H ENLS  +S TH
Sbjct  538  GYSFMGTNTDFMGGLGQYPIGEIGRFDAEQFAPRFPGNGVSLTLGLPHCENLS--LSGTH  595

Query  306  HNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDF  476
             NFLPN   QMGR + I   E N+F  G   P + H ++ +++ N+QNRKRF AQLLPDF
Sbjct  596  QNFLPNQTMQMGRRLDID--EPNEF--GAINPPTPHSSAAYESINLQNRKRFVAQLLPDF  651

Query  477  V  479
            V
Sbjct  652  V  652



>ref|XP_003519115.1| PREDICTED: BEL1-like homeodomain protein 1-like isoformX1 [Glycine 
max]
 ref|XP_006575286.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006575287.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=664

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 110/183 (60%), Gaps = 32/183 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL--------------MKFGNDRQNR  122
            GF+ +G S ++ ITQGSPKKPR        + +P++              +    +RQNR
Sbjct  489  GFSFMGSSELDGITQGSPKKPRNHEILRSPNRVPSINMDVKANEANNEQQLSMDLERQNR  548

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMSA  299
            +G+  +   TNF++ FG YPME++GRF  EQF P +S  N VSLTLGL H + L    S 
Sbjct  549  DGYTFMGNQTNFISGFGQYPMEEIGRFDAEQFTPRFSGNNGVSLTLGLPHCDTL----SG  604

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH +FLPN   Q+GRG+ IG  E N F  G    +++H ++ F++ N+QN KRF AQLLP
Sbjct  605  THQSFLPNQNIQLGRGLDIG--EPNQF--GALNNSTSHSSAAFESINMQNPKRFAAQLLP  660

Query  471  DFV  479
            DFV
Sbjct  661  DFV  663



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 105/181 (58%), Gaps = 34/181 (19%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPRGG------SDMPAL--------------MKFGNDRQNRE  125
            F+LIG S +E I QGSPKKPR        S +P++              MKF  D     
Sbjct  510  FSLIGSSELEGINQGSPKKPRSNELLQSPSSVPSMNMDMNQSEASNEVSMKFSKD-----  564

Query  126  GFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATH  305
            G+  +  +T+FM   G YP+ ++GRF  EQF P +  N VSLTLGL H ENLS  +S TH
Sbjct  565  GYSFMGTNTDFMGGLGQYPIGEIGRFDAEQFAPRFPGNGVSLTLGLPHCENLS--LSGTH  622

Query  306  HNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDF  476
             NFLPN   QMGR + I   E N+F  G   P + H ++ +++ N+QNRKRF AQLLPDF
Sbjct  623  QNFLPNQTMQMGRRLDID--EPNEF--GAINPPTPHSSAAYESINLQNRKRFVAQLLPDF  678

Query  477  V  479
            V
Sbjct  679  V  679



>ref|XP_010263012.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010263013.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=739

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 107/184 (58%), Gaps = 29/184 (16%)
 Frame = +3

Query  3    GFNLIGPS*MESITQG-SPKKPRGG-------SDMPAL--------------MKFGNDRQ  116
            GF+LIG S +E   QG SPKK R         S +P++               KF   RQ
Sbjct  559  GFSLIGSSDVEGFMQGTSPKKLRSTELQQNSPSSIPSMDTDVKPADTNRDLFTKFDTGRQ  618

Query  117  NREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMS  296
            +R G+PL+  +TN   AF +Y + ++GRF  EQF P +S N VSLTLGL H ENLS  +S
Sbjct  619  SRGGYPLITNTTNHGGAFSAYSLGELGRFDPEQFAPRFSGNGVSLTLGLPHCENLS--LS  676

Query  297  ATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
             T   +L N   Q+GR + IG  E NDF  GM++P   H ++ ++N NIQN KRF AQLL
Sbjct  677  GTQQTYLSNQNIQLGRRLEIGGGEPNDFC-GMSSPP-PHSSAAYENMNIQNGKRFAAQLL  734

Query  468  PDFV  479
            PDFV
Sbjct  735  PDFV  738



>ref|XP_011021429.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021430.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021431.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=732

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 108/183 (59%), Gaps = 32/183 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGS-----------DMPAL---------MKFGNDRQNR  122
            GF LIG + ME I Q S KKPR G            DM            + FG +R  +
Sbjct  557  GFTLIGQAEMEGIAQSS-KKPRSGDMQNSPSSILSMDMDVKHGETSREIGVNFGGERLTK  615

Query  123  EGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSAT  302
            +G+PL+ GS     +FG+YPM  +GRF  EQ  P +S N+VSLTLGL H ENLS  +S T
Sbjct  616  DGYPLITGSN---GSFGAYPMGDLGRFNIEQLTPRFSGNSVSLTLGLPHCENLS--LSGT  670

Query  303  HHNFLPNQM----GRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
              N+L +Q     GR + IG +E  DF +G+ T  ++H +S F++ +IQNRKRFPAQLLP
Sbjct  671  QQNYLSSQNIQLGGRRIEIGTSEP-DF-SGINTSQNSHSSSGFESVDIQNRKRFPAQLLP  728

Query  471  DFV  479
            DFV
Sbjct  729  DFV  731



>ref|XP_011003835.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003836.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003838.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003839.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003840.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003841.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=734

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 103/183 (56%), Gaps = 31/183 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKP-------------------RGGSDMPALMKFGNDRQNRE  125
            GF LIGP+ ME I+  S KKP                   +G +       FG +R  ++
Sbjct  558  GFTLIGPAEMEGISHRSSKKPSSDMQNSPSSILSMDMDVKQGETSREISANFGGERLIKD  617

Query  126  GFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATH  305
            G+PL+  S      FG+YPM  +GRF  EQ  P +S N+VSLTLGL H ENLS  +S T 
Sbjct  618  GYPLITSS----GGFGAYPMGDLGRFNLEQMTPRFSGNSVSLTLGLPHCENLS--LSGTQ  671

Query  306  HNFLPNQ-----MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
             N+L NQ      GR + IG     DF +G+ T  ++H ++ F++ +IQNRKRFPAQLLP
Sbjct  672  QNYLSNQNINQLAGRRLEIGSGTEPDF-SGINTSQNSHSSTGFESIDIQNRKRFPAQLLP  730

Query  471  DFV  479
            DFV
Sbjct  731  DFV  733



>gb|KJB62029.1| hypothetical protein B456_009G396900 [Gossypium raimondii]
Length=653

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 101/181 (56%), Gaps = 34/181 (19%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPRGGS-------------DM-------PALMKFGNDRQNRE  125
            F+LIG S +E ITQGSPKKPR                DM          MKF  D     
Sbjct  483  FSLIGSSELEGITQGSPKKPRSNELLQSPTSVQSMNMDMNQSEASNEVSMKFRKD-----  537

Query  126  GFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATH  305
            G+  +  +T+FM  FG YP+ ++GRF  EQF P +  N VSLTLGL H ENLS  +S  H
Sbjct  538  GYSFMGTNTDFMGGFGQYPIGEIGRFDAEQFAPRFPGNGVSLTLGLPHCENLS--LSGAH  595

Query  306  HNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDF  476
             N +PN   QMGR + I   E N+F  G   P + H ++ +++ N+ NRKRF AQLLPDF
Sbjct  596  QNLIPNQTMQMGRRLDID--EPNEF--GAINPPTPHSSAAYESINLHNRKRFVAQLLPDF  651

Query  477  V  479
            V
Sbjct  652  V  652



>gb|KHN48417.1| BEL1-like homeodomain protein 1, partial [Glycine soja]
Length=471

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 110/184 (60%), Gaps = 33/184 (18%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL--------------MKFGNDRQN-  119
            GF+ +G S ++ ITQGSPKKPR        + +P++              +   ++RQN 
Sbjct  295  GFSFMGSSELDGITQGSPKKPRNHEILHSPNRVPSINMDVKANEANNEQQLSMDHERQNN  354

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMS  296
            R+ +  +   TNF++ FG YP+E++GRF  EQF P +S  N VSLTLGL H + L    S
Sbjct  355  RDSYSFMGNQTNFISGFGQYPIEEIGRFDAEQFTPRFSGKNGVSLTLGLPHCDTL----S  410

Query  297  ATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
             TH +FLPN   Q+GRG+ IG  E N F  G    +++H ++ F++ N+QN KRF AQLL
Sbjct  411  GTHQSFLPNQNIQLGRGLDIG--EPNQF--GALNNSNSHNSAAFESINMQNPKRFAAQLL  466

Query  468  PDFV  479
            PDFV
Sbjct  467  PDFV  470



>ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=686

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 104/185 (56%), Gaps = 36/185 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG---------------------GSDMPALMKFGNDRQN  119
            GF+ IG S +E I QGSPKK R                      G++    MKFG++R +
Sbjct  513  GFSFIGSSELEGIAQGSPKKSRNHELMHSSNSFPLVNMDVKHNEGNNEEISMKFGDERHS  572

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPP-YSTNAVSLTLGLQHSENLSAAMS  296
            R+G+  +   TNF+  FG YP+  +GRF +EQF  P +S+N VSLTLGL        ++ 
Sbjct  573  RDGYSFMGNQTNFIGGFGQYPIGDIGRFDSEQFTTPRFSSNGVSLTLGLD-------SIQ  625

Query  297  ATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
             TH  FLPN   Q+GR + I  +E N+F  G    +S H T  F++ N+QN KRF AQLL
Sbjct  626  GTHQTFLPNQNIQLGRSLDI--SEQNEF--GSINTSSPHSTGPFESINMQNPKRFAAQLL  681

Query  468  PDFVT  482
            PDFV+
Sbjct  682  PDFVS  686



>gb|KHN33154.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=428

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 102/184 (55%), Gaps = 35/184 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDM------PAL---------------MKFGNDRQN  119
            GF+ +G S ++ ITQGSPKKPR    M      P++               MKFG +RQ 
Sbjct  256  GFSFMGSSELDGITQGSPKKPRNHEMMHSPNSVPSMSMDVKPNDENNEQLSMKFGVERQG  315

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R     +   TNF   FG YP+  +GRF TEQF P  S N VSLTLGL        ++  
Sbjct  316  RNESSFMGNQTNFNGGFGQYPIGDIGRFDTEQFTPRLSGNGVSLTLGLD-------SLPG  368

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR + IG  E N+F  G  + +S H T+ +++ ++QN KRF AQLLP
Sbjct  369  THQTFLPNQNIQLGRSLDIG--EPNEF--GAISTSSPHSTAAYESISMQNPKRFAAQLLP  424

Query  471  DFVT  482
            DFVT
Sbjct  425  DFVT  428



>gb|KEH24245.1| BEL1-related homeotic protein [Medicago truncatula]
Length=660

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 103/180 (57%), Gaps = 35/180 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-----------------GSDMPALMKFGNDRQNREGF  131
            GF+ IG S +E I QGSPKKPR                   ++    MKFG+DRQNR+G+
Sbjct  496  GFSFIGSSELEGIPQGSPKKPRNHELMHNPNSFIDVKHNEANNEELSMKFGDDRQNRDGY  555

Query  132  PLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHN  311
              +   TNF+  FG YP+  +GRF +EQF P +S+N VSLTLGL        ++   H  
Sbjct  556  SFMGNQTNFIGGFGQYPIGDIGRFDSEQFAPRFSSNNVSLTLGLD-------SIQGNHQT  608

Query  312  FLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
            FLPN   Q+GR + I  +E N+F +  T+      +  +++ N+QN KRF AQLLPDFV+
Sbjct  609  FLPNQNIQLGRSIDI--SEPNEFGSINTS------SPQYESINMQNPKRFAAQLLPDFVS  660



>ref|XP_003535815.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006588872.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=661

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 110/185 (59%), Gaps = 33/185 (18%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGG------SDMPAL--------------MKFGNDRQN-  119
            GF+ +G S ++ ITQGSPKKPR        + +P++              +   ++RQN 
Sbjct  485  GFSFMGSSELDGITQGSPKKPRNHEILHSPNRVPSINMDVKANEANNEQQLSMDHERQNN  544

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMS  296
            R+ +  +   TNF++ FG YP+E++GRF  EQF P +S  N VSLTLGL H + L    S
Sbjct  545  RDSYSFMGNQTNFISGFGQYPIEEIGRFDAEQFTPRFSGKNGVSLTLGLPHCDTL----S  600

Query  297  ATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
             TH +FLPN   Q+GRG+ IG  E N F  G    +++H ++ F++ N+QN KRF AQLL
Sbjct  601  GTHQSFLPNQNIQLGRGLDIG--EPNQF--GALNNSNSHNSAAFESINMQNPKRFAAQLL  656

Query  468  PDFVT  482
            PDFV 
Sbjct  657  PDFVA  661



>ref|XP_007162972.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
 gb|ESW34966.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
Length=679

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 102/184 (55%), Gaps = 35/184 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDM------PAL---------------MKFGNDRQN  119
            GF+ +G S +E ITQGSPKK R    M      P++               MKFG+DRQ 
Sbjct  507  GFSFMGSSELEGITQGSPKKARNHEMMHSPNSVPSMNIDVKPNEANNEQLSMKFGDDRQG  566

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R     +   TNF+  FG YP+  +GRF  EQF P +S N VSLTLGL        ++  
Sbjct  567  RNESSFMVNQTNFIGGFGQYPIGDIGRFDAEQFAPRFSGNGVSLTLGLD-------SLPG  619

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR + IG  E N+F  G    +S H ++ +++ ++QN KRF AQLLP
Sbjct  620  THQTFLPNQNIQLGRSLDIG--EPNEF--GSINTSSPHSSAAYESISMQNPKRFAAQLLP  675

Query  471  DFVT  482
            DFVT
Sbjct  676  DFVT  679



>gb|AFK35661.1| unknown [Medicago truncatula]
Length=242

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 98/171 (57%), Gaps = 36/171 (21%)
 Frame = +3

Query  30   MESITQGSPKKPRG----------------GSDMPALMKFGNDRQNREGFPLVEGSTNFM  161
            ++ ITQ SPK+ R                  ++    MKFG+DRQ+R+G+  +   TNF+
Sbjct  86   LDGITQASPKRTRNHEILQSPNHVKSNETTANNEQISMKFGDDRQSRDGYCFMGNQTNFI  145

Query  162  AAFGSYPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPN---Q  326
            A FG YPME++GRF  EQF P +S   N VSLTLGL H + L    S TH +F+PN   Q
Sbjct  146  AGFGQYPMEEIGRFDAEQFAPRFSGNNNGVSLTLGLPHCDTL----SGTHQSFMPNQNIQ  201

Query  327  MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            +GR + I  +E N+F            ++ F++ N+QN KRF AQLLPDFV
Sbjct  202  LGRRLDI--SETNEF---------GDSSAAFESINMQNPKRFAAQLLPDFV  241



>gb|KHN08605.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=679

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 103/184 (56%), Gaps = 35/184 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDM------PAL---------------MKFGNDRQN  119
            GF+ +G S ++ ITQGSPKKPR    M      P+L               M+FG +RQ 
Sbjct  507  GFSFMGSSELDGITQGSPKKPRNHEMMHSPNSVPSLNMDVKPNDENSEQLSMRFGVERQG  566

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R     +   TNF+  FG YP+  +GRF  EQF P +S N VSLTLGL        ++  
Sbjct  567  RNESSFMGNQTNFIGGFGQYPIGDIGRFDAEQFTPRFSGNGVSLTLGLD-------SLPG  619

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR + IG  E N+F  G  + +S H T+ +++ ++QN KRF AQLLP
Sbjct  620  THQTFLPNQNIQLGRSLDIG--EPNEF--GAISTSSPHSTAAYESISMQNPKRFAAQLLP  675

Query  471  DFVT  482
            DFVT
Sbjct  676  DFVT  679



>ref|XP_003554466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006604654.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=680

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 103/184 (56%), Gaps = 35/184 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDM------PAL---------------MKFGNDRQN  119
            GF+ +G S ++ ITQGSPKKPR    M      P+L               M+FG +RQ 
Sbjct  508  GFSFMGSSELDGITQGSPKKPRNHEMMHSPNSVPSLNMDVKPNDENSEQLSMRFGVERQG  567

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R     +   TNF+  FG YP+  +GRF  EQF P +S N VSLTLGL        ++  
Sbjct  568  RNESSFMGNQTNFIGGFGQYPIGDIGRFDAEQFTPRFSGNGVSLTLGLD-------SLPG  620

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR + IG  E N+F  G  + +S H T+ +++ ++QN KRF AQLLP
Sbjct  621  THQTFLPNQNIQLGRSLDIG--EPNEF--GAISTSSPHSTAAYESISMQNPKRFAAQLLP  676

Query  471  DFVT  482
            DFVT
Sbjct  677  DFVT  680



>ref|XP_003521496.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006577097.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006577098.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006577099.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=679

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 102/184 (55%), Gaps = 35/184 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDM------PAL---------------MKFGNDRQN  119
            GF+ +G S ++ ITQGSPKKPR    M      P++               MKFG +RQ 
Sbjct  507  GFSFMGSSELDGITQGSPKKPRNHEMMHSPNSVPSMSMDVKPNDENNEQLSMKFGVERQG  566

Query  120  REGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            R     +   TNF   FG YP+  +GRF TEQF P  S N VSLTLGL        ++  
Sbjct  567  RNESSFMGNQTNFNGGFGQYPIGDIGRFDTEQFTPRLSGNGVSLTLGLD-------SLPG  619

Query  300  THHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
            TH  FLPN   Q+GR + IG  E N+F  G  + +S H T+ +++ ++QN KRF AQLLP
Sbjct  620  THQTFLPNQNIQLGRSLDIG--EPNEF--GAISTSSPHSTAAYESISMQNPKRFAAQLLP  675

Query  471  DFVT  482
            DFVT
Sbjct  676  DFVT  679



>ref|XP_007145789.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
 gb|ESW17783.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
Length=649

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 103/180 (57%), Gaps = 35/180 (19%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPRGGSDMPA-----------LMKFGN--------DRQNREG  128
            F+ IG S     TQGSPKK R    +P+            M  GN        +RQ+R+G
Sbjct  482  FSFIGSS-----TQGSPKKARNHEILPSPNRASSMNMDVKMNEGNNEQQVSMDERQSRDG  536

Query  129  FPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHH  308
            +  +   TNF + FG YPME++GRF  EQF P +S N VSLTLGL H + L    S TH 
Sbjct  537  YSFMGSQTNFTSGFGQYPMEEIGRFDAEQFTPRFSGNGVSLTLGLPHCDTL----SGTHQ  592

Query  309  NFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
             FLPN   Q+GRG+ IG  + N F  G+   +++H ++ +++ N+QN KRF AQL+ DFV
Sbjct  593  TFLPNQNIQLGRGLDIG--QPNQF--GVLNNSTSHSSAAYESMNMQNPKRFAAQLVLDFV  648



>gb|EYU18114.1| hypothetical protein MIMGU_mgv1a010011mg [Erythranthe guttata]
Length=324

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 101/177 (57%), Gaps = 22/177 (12%)
 Frame = +3

Query  3    GFNLIGPS*---MESITQGSPKKPRGGSDMPALMKFGNDRQNRE-----GFPLVEGSTNF  158
            GFNLIG S      +I + SPKK R  SDM  + K  +D +N       GF L+ G TNF
Sbjct  151  GFNLIGSSSEIETATIARESPKKLRI-SDM-LMSKSSDDAENESMSRDGGFTLMGGPTNF  208

Query  159  MAAFGSYPMEQMGRFTTEQFPP-PYSTNAVSLTLGLQHSENLSAAMSA-----THHNFLP  320
            +  FGSY + ++GRF  + F   PY  N VSLTLGL H +N     S       H  F+P
Sbjct  209  IGGFGSYAINELGRFEPDHFQQHPYLGNGVSLTLGLPHCDNQLTMSSVPHHHHHHQAFMP  268

Query  321  N----QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
                 Q+GRGV IGE   ND+V       + HPT+V++N NIQNRKRF AQLLPDFV
Sbjct  269  TNQGMQLGRGVEIGET--NDYVGMNAQQPNTHPTNVYENINIQNRKRFAAQLLPDFV  323



>gb|KEH41936.1| BEL1-related homeotic protein [Medicago truncatula]
Length=649

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 98/171 (57%), Gaps = 36/171 (21%)
 Frame = +3

Query  30   MESITQGSPKKPRG----------------GSDMPALMKFGNDRQNREGFPLVEGSTNFM  161
            ++ ITQ SPK+ R                  ++    MKFG+DRQ+R+G+  +   TNF+
Sbjct  493  LDGITQASPKRTRNHEILQSPNHVKSNETTANNEQISMKFGDDRQSRDGYCFMGNQTNFI  552

Query  162  AAFGSYPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPN---Q  326
            A FG YPME++GRF  EQF P +S   N VSLTLGL H + L    S TH +F+PN   Q
Sbjct  553  AGFGQYPMEEIGRFDAEQFAPRFSGNNNGVSLTLGLPHCDTL----SGTHQSFMPNQNIQ  608

Query  327  MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            +GR + I  +E N+F            ++ F++ N+QN KRF AQLLPDFV
Sbjct  609  LGRRLDI--SETNEF---------GDSSAAFESINMQNPKRFAAQLLPDFV  648



>dbj|BAE71188.1| BEL1-like homeodomain transcription factor [Trifolium pratense]
Length=651

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 98/172 (57%), Gaps = 37/172 (22%)
 Frame = +3

Query  30   MESITQGSPKKPRGGSDMPA-----------------LMKFGNDRQNREGFPLVEGSTNF  158
            ++ ITQ SPK+ R    + +                  MKFG+DRQ+R+G+  +   TNF
Sbjct  494  LDGITQASPKRTRNHEILQSPNHVKSNETNNNNNEQISMKFGDDRQSRDGYCFMGNQTNF  553

Query  159  MAAFGSYPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPN---  323
            +A FG YPME++GRF  EQF P +S   N VSLTLGL H + L    S TH +F+PN   
Sbjct  554  IAGFGQYPMEEIGRFDAEQFTPRFSGNNNGVSLTLGLPHCDTL----SGTHQSFMPNQNI  609

Query  324  QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            Q+GR + I  +E N+F            ++ F++ N+QN KRF AQLLPDFV
Sbjct  610  QLGRRLDI--SEQNEF---------GDSSAAFESMNMQNPKRFAAQLLPDFV  650



>ref|XP_008442920.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=713

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 108/201 (54%), Gaps = 48/201 (24%)
 Frame = +3

Query  3    GFNLIG-PS*MESITQGSPKKPRG-------GSDMPAL----------------------  92
            GF LIG  S ++ ITQGSPKK RG        +++P +                      
Sbjct  518  GFTLIGTSSELDGITQGSPKKQRGPDILHSSNNNVPFINMDIKPREEEEHQNQTHNPHHN  577

Query  93   -------MKFGNDRQNREGFPLVEGSTNF-MAAFGSYPMEQMGRFTTEQFPPPYS-TNAV  245
                   MKF  DRQNR+G+  + G  +F +  FG YP+ ++ RF  +QF P +S  N V
Sbjct  578  NHHHHLPMKFDEDRQNRDGYSFL-GQPHFNIGGFGQYPIGEIARFDADQFTPRFSGNNGV  636

Query  246  SLTLGLQHSENLSAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSAHPTSV  416
            SLTLGL H ENLS    ATH +FLPNQ   +GR   IG  +  DF A     ++AH ++ 
Sbjct  637  SLTLGLPHCENLSLN-PATHQSFLPNQSIHLGRRTEIG--KPTDFSA--INASTAHSSTA  691

Query  417  FDNFNIQNRKRFPAQLLPDFV  479
            FD  NIQN KRF AQLLPDFV
Sbjct  692  FDTINIQNGKRFAAQLLPDFV  712



>ref|XP_004171976.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN59214.1| hypothetical protein Csa_3G782620 [Cucumis sativus]
Length=716

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 108/204 (53%), Gaps = 51/204 (25%)
 Frame = +3

Query  3    GFNLIG-PS*MESITQGSPKKPRG-------GSDMPAL----------------------  92
            GF LIG  S ++ ITQGSPKK RG        +++P +                      
Sbjct  518  GFTLIGTSSELDGITQGSPKKQRGPDILHSSNNNVPFINMDIKPREEEEHQNQNHNPHQN  577

Query  93   ----------MKFGNDRQNREGFPLVEGSTNF-MAAFGSYPMEQMGRFTTEQFPPPYS-T  236
                      MKF  DRQNR+G+  + G  +F +  FG YP+ ++ RF  +QF P +S  
Sbjct  578  NHHHHHHLLPMKFDEDRQNRDGYSFL-GQPHFNIGGFGQYPIGEIARFDADQFTPRFSGN  636

Query  237  NAVSLTLGLQHSENLSAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSAHP  407
            N VSLTLGL H ENLS    ATH +FLPNQ   +GR   IG  +  DF A     ++AH 
Sbjct  637  NGVSLTLGLPHCENLSLN-PATHQSFLPNQSIHLGRRTEIG--KPTDFSA--INASTAHS  691

Query  408  TSVFDNFNIQNRKRFPAQLLPDFV  479
            ++ F+  NIQN KRF AQLLPDFV
Sbjct  692  STAFETINIQNGKRFAAQLLPDFV  715



>ref|XP_004136516.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
Length=716

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 108/204 (53%), Gaps = 51/204 (25%)
 Frame = +3

Query  3    GFNLIG-PS*MESITQGSPKKPRG-------GSDMPAL----------------------  92
            GF LIG  S ++ ITQGSPKK RG        +++P +                      
Sbjct  518  GFTLIGTSSELDGITQGSPKKQRGPDILHSSNNNVPFINMDIKPREEEEHQNQNHNPHQN  577

Query  93   ----------MKFGNDRQNREGFPLVEGSTNF-MAAFGSYPMEQMGRFTTEQFPPPYS-T  236
                      MKF  DRQNR+G+  + G  +F +  FG YP+ ++ RF  +QF P +S  
Sbjct  578  NHHHHHHLLSMKFDEDRQNRDGYSFL-GQPHFNIGGFGQYPIGEIARFDADQFTPRFSGN  636

Query  237  NAVSLTLGLQHSENLSAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSAHP  407
            N VSLTLGL H ENLS    ATH +FLPNQ   +GR   IG  +  DF A     ++AH 
Sbjct  637  NGVSLTLGLPHCENLSLN-PATHQSFLPNQSIHLGRRTEIG--KPTDFSA--INASTAHS  691

Query  408  TSVFDNFNIQNRKRFPAQLLPDFV  479
            ++ F+  NIQN KRF AQLLPDFV
Sbjct  692  STAFETINIQNGKRFAAQLLPDFV  715



>ref|XP_007015671.1| BEL1 homeodomain 1, putative [Theobroma cacao]
 gb|EOY33290.1| BEL1 homeodomain 1, putative [Theobroma cacao]
Length=732

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 108/183 (59%), Gaps = 29/183 (16%)
 Frame = +3

Query  6    FNLIGPS*ME-SITQGSPKKPRGGSDM---PALM-----------------KFGNDRQNR  122
            FNLIG S ++ +  + SPKKPRG +DM   P+ +                 KFG +R ++
Sbjct  553  FNLIGSSDLDGTAARRSPKKPRGINDMHNSPSSILSMDMDMKQGETREINIKFGEERLSK  612

Query  123  EGFPLVEGSTNFMAAFGSYP-MEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSA  299
            + + L+ G+ N    FG+Y  M ++GRF  EQ  P +  N+VSLTLGL H +NLS  +S 
Sbjct  613  DSYSLLTGTANHGGGFGTYSTMGEIGRFDPEQLTPRFPGNSVSLTLGLPHCDNLS--LSG  670

Query  300  THHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLP  470
               NFL NQ   +GR + +G +E+ DF  G+    ++H ++ ++N  +QNRKRF AQLLP
Sbjct  671  NQQNFLSNQNIQLGRRLELGPSES-DFC-GINNQQASHSSTGYENIEMQNRKRFAAQLLP  728

Query  471  DFV  479
            DFV
Sbjct  729  DFV  731



>ref|XP_010557975.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=675

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 104/175 (59%), Gaps = 19/175 (11%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDM-------PALMKFGNDRQNREG--FPLVEGSTN  155
            GF++ G S +E ITQGSPK+ R    +        A M F    + R+   F  +  +TN
Sbjct  505  GFSISGASELEGITQGSPKRVRINEILHSPASVPSAKMDFNIPERFRDEKEFSFLASNTN  564

Query  156  FMAA-FGSYPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPN-  323
            FM   FG+YP+E+ GRF  E+F P YS   N VSLTLGL H E+ S + + TH NF PN 
Sbjct  565  FMGGNFGAYPIEEAGRFEAEEFTPSYSGNNNGVSLTLGLPHCESFSVS-APTHQNFFPNQ  623

Query  324  --QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
              Q+GR V +  +E N+F A ++T  S    + ++  ++QN++RF AQLLPDFVT
Sbjct  624  NIQIGRDVEM--SEPNEFGA-ISTSESHSSAAAYNTISLQNQRRFSAQLLPDFVT  675



>ref|XP_007150022.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
 gb|ESW22016.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
Length=702

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 102/187 (55%), Gaps = 36/187 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-----------GSDMP------------ALMKFGNDR  113
            GF+L G     S  Q SP KPR              DM             A  KF  +R
Sbjct  523  GFHLAG----SSDVQRSPNKPRSLEMQNSPSSILSVDMEMKHNGEHANTREANTKFSIER  578

Query  114  QNREGFPLVEGSTNFMAAFGSYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHSENLS  284
             +++G+PL+ G+TN    FG++ ME +G RF  TTEQ    +  N VSLTLGL H+ENLS
Sbjct  579  HHKDGYPLMSGNTNQGGGFGAFAMEDIGNRFNVTTEQLASRFHGNGVSLTLGLPHNENLS  638

Query  285  AAMSATHHNFLPN--QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPA  458
              +S T H FL     +GR + +G    N+F A + TP S+H  + +++ +IQNRKRF A
Sbjct  639  --ISGTQHGFLSQNIHLGRRLEMGTT-GNEFCA-INTPPSSHSGTTYESIDIQNRKRFVA  694

Query  459  QLLPDFV  479
            QLLPDFV
Sbjct  695  QLLPDFV  701



>ref|XP_007132496.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 ref|XP_007132497.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04490.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04491.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
Length=733

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 84/155 (54%), Gaps = 16/155 (10%)
 Frame = +3

Query  51   SPKKPRGGSDM----------PALMKFGNDRQNREGFPLVEGSTNFMAAFGSYPMEQMGR  200
            SPK+PR  S+M             MK   +   REG     G  N    FG++PME +GR
Sbjct  582  SPKRPRSTSEMQNSPGSILSVDMEMKPHGETNTREGTNTKFGIENHSGGFGAFPMEDIGR  641

Query  201  F--TTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPNQMGRGVVIGEAEANDFV  374
            F   +EQ  P +  N VSLTLGL HSENL+  +S T H FL   M  G+       N+F 
Sbjct  642  FHHVSEQLAPRFHGNGVSLTLGLPHSENLT--LSGTQHGFLSPNMHLGMRT--TNENEFC  697

Query  375  AGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
              + TP S+H  + +DN +IQNRKRF AQLL DFV
Sbjct  698  GAINTPPSSHSATSYDNIDIQNRKRFAAQLLRDFV  732



>ref|XP_010543867.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543868.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=594

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 35/185 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDM--PALM--------KFGNDR--------QNREG  128
            GF+++G S  E   QG+PKK R    +  P L+        K G  R        ++ + 
Sbjct  420  GFSILGVSEFEGNMQGNPKKLRTDELLHSPELVPSMEMDADKVGEVRNDNISPRFRDEKE  479

Query  129  FPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMSAT  302
            FP    +TNF+  FG YP+ + GRF  E+F P YS   N VSLTLGL H E+ S  +SAT
Sbjct  480  FPFFANNTNFIGGFGPYPICETGRFEAEEFTPSYSGNINGVSLTLGLPHCESFS--VSAT  537

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAG--MTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
            H NF PN   Q+GR V +  +E N+F A    T+P + +P       N+QN++RF +QLL
Sbjct  538  HQNFFPNQNIQIGRNVEM--SEPNEFGASEPRTSPAAYNP------INLQNQRRFLSQLL  589

Query  468  PDFVT  482
            PDFVT
Sbjct  590  PDFVT  594



>ref|XP_010543869.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=573

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 35/185 (19%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDM--PALM--------KFGNDR--------QNREG  128
            GF+++G S  E   QG+PKK R    +  P L+        K G  R        ++ + 
Sbjct  399  GFSILGVSEFEGNMQGNPKKLRTDELLHSPELVPSMEMDADKVGEVRNDNISPRFRDEKE  458

Query  129  FPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMSAT  302
            FP    +TNF+  FG YP+ + GRF  E+F P YS   N VSLTLGL H E+ S  +SAT
Sbjct  459  FPFFANNTNFIGGFGPYPICETGRFEAEEFTPSYSGNINGVSLTLGLPHCESFS--VSAT  516

Query  303  HHNFLPN---QMGRGVVIGEAEANDFVAG--MTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
            H NF PN   Q+GR V +  +E N+F A    T+P + +P       N+QN++RF +QLL
Sbjct  517  HQNFFPNQNIQIGRNVEM--SEPNEFGASEPRTSPAAYNP------INLQNQRRFLSQLL  568

Query  468  PDFVT  482
            PDFVT
Sbjct  569  PDFVT  573



>ref|XP_006854627.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda]
 gb|ERN16094.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda]
Length=709

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 82/133 (62%), Gaps = 9/133 (7%)
 Frame = +3

Query  93   MKFGNDRQNREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHS  272
            +KFG+ RQ+RE F L +    F +A   Y +  +GRF  EQF P +S N VSLTLGL H 
Sbjct  583  IKFGDGRQSREDFGLDDHGGGFGSA---YHIGDLGRFGHEQFAPRFSGNGVSLTLGLPHC  639

Query  273  ENLSAAMSATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNR  443
            ++LS  ++ T   +L N   QMGR   +G  E NDF +  T   +AH  + ++N +IQNR
Sbjct  640  DSLS--LAGTQQAYLSNPNLQMGRRHELG-GEPNDFCSMNTASATAHSANPYENLSIQNR  696

Query  444  KRFPAQLLPDFVT  482
            KRF AQLLPDFV 
Sbjct  697  KRFAAQLLPDFVA  709



>ref|XP_008784116.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784117.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784118.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=660

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 81/137 (59%), Gaps = 17/137 (12%)
 Frame = +3

Query  75   SDMPALMKF--GNDRQNREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVS  248
            S+   LMKF  G  R   +GF L+ G+TN   +FG+YP+  +GRF +EQF P +S N VS
Sbjct  538  SNRELLMKFMDGQQRAGDQGFSLIGGTTNHGGSFGAYPIADLGRFDSEQFTPRFSGNGVS  597

Query  249  LTLGLQHSENLSAAMSATHHNFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNF  428
            LTLGL H ENLS  +S    +FL N+                +    P+ AHP++ +++ 
Sbjct  598  LTLGLPHCENLS--LSGAQPSFLSNE-------------SMPSFNNNPSVAHPSNAYESI  642

Query  429  NIQNRKRFPAQLLPDFV  479
            +I NRKR+ AQLLPDFV
Sbjct  643  DIPNRKRYAAQLLPDFV  659



>ref|XP_004497655.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=667

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 96/178 (54%), Gaps = 46/178 (26%)
 Frame = +3

Query  36   SITQGSPKKPRGGSDMPA--------------------LMKF---GNDRQNREGFPLVEG  146
            + TQGSPK+ R    + +                     MKF   G++R++R+G+  +  
Sbjct  505  TTTQGSPKRTRNHEILQSHHNNVLKSSNETTNNGQQIVSMKFVGGGDERESRDGYCFMGN  564

Query  147  STNFMAAFGSYPMEQMGRFTTEQFPPPYS----TNAVSLTLGLQHSENLSAAMSATHHNF  314
             TNF+A FG YPME++GRF  E F P +S     N VSLTLGL             H +F
Sbjct  565  QTNFIAGFGQYPMEEIGRFDEENFTPRFSGNNNNNGVSLTLGL------------PHQSF  612

Query  315  LPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            +PN   Q+GR + I  +E N+F  G    +++H ++ F++ N+QN KRF AQLLPDFV
Sbjct  613  MPNENIQLGRRLEI--SENNEF--GALNNSNSHSSAAFESINMQNPKRFAAQLLPDFV  666



>gb|KHN17979.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=517

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 104/194 (54%), Gaps = 41/194 (21%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGS--DMPALM------------------------KFG  104
            GF+L G S M+     SPKKPR     + P+ +                        KFG
Sbjct  331  GFHLAGSSDMQIR---SPKKPRSSEIQNSPSSILSVGMEMKHNNNGDHANNREANNTKFG  387

Query  105  NDRQN-REGFPLVEGSTNFMAAFGSYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHS  272
            N+R + ++G+PL+  + N    FG++ ME MG RF  TTEQ    +  N VSLTLGL H+
Sbjct  388  NERHHQKDGYPLMTSNANHGGGFGAFTMEDMGSRFNVTTEQLASRFHGNGVSLTLGLPHN  447

Query  273  ENLSAAMSAT-HHNFLPN--QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNR  443
            ENLS  M  T  H FL     +GR + +G    N+F A + TP S+H  + +++ +IQNR
Sbjct  448  ENLS--MPGTQQHGFLSQNIHLGRRLEMG-TNGNEFCA-INTPPSSHSGTTYESIDIQNR  503

Query  444  KRFPA-QLLPDFVT  482
            KRF A QLLPDFV 
Sbjct  504  KRFVAHQLLPDFVA  517



>ref|XP_003539486.1| PREDICTED: BEL1-like homeodomain protein 1-like, partial [Glycine 
max]
Length=526

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 104/194 (54%), Gaps = 41/194 (21%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGS--DMPALM------------------------KFG  104
            GF+L G S M+     SPKKPR     + P+ +                        KFG
Sbjct  340  GFHLAGSSDMQIR---SPKKPRSSEIQNSPSSILSVGMEMKHNNNGDHANNREANNTKFG  396

Query  105  NDRQN-REGFPLVEGSTNFMAAFGSYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHS  272
            N+R + ++G+PL+  + N    FG++ ME MG RF  TTEQ    +  N VSLTLGL H+
Sbjct  397  NERHHQKDGYPLMTSNANHGGGFGAFTMEDMGSRFNVTTEQLASRFHGNGVSLTLGLPHN  456

Query  273  ENLSAAMSAT-HHNFLPN--QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNR  443
            ENLS  M  T  H FL     +GR + +G    N+F A + TP S+H  + +++ +IQNR
Sbjct  457  ENLS--MPGTQQHGFLSQNIHLGRRLEMG-TNGNEFCA-INTPPSSHSGTTYESIDIQNR  512

Query  444  KRFPA-QLLPDFVT  482
            KRF A QLLPDFV 
Sbjct  513  KRFVAHQLLPDFVA  526



>ref|XP_010912386.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=663

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 80/137 (58%), Gaps = 17/137 (12%)
 Frame = +3

Query  75   SDMPALMKF--GNDRQNREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVS  248
            S+   LMKF  G  R   +GF L+ G+ +   +FG+YP+  +GRF +EQF P +S N VS
Sbjct  541  SNRELLMKFMDGQQRAGDQGFSLIAGTASNGGSFGAYPIPDLGRFDSEQFTPRFSGNGVS  600

Query  249  LTLGLQHSENLSAAMSATHHNFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNF  428
            LTLGL + ENLS  +S    +FL N+                +    P+ AHP++ +++ 
Sbjct  601  LTLGLPYCENLS--LSGAQPSFLSNE-------------SMPSFNNNPSVAHPSNAYESI  645

Query  429  NIQNRKRFPAQLLPDFV  479
            +IQNRKRF AQ LPDFV
Sbjct  646  DIQNRKRFAAQPLPDFV  662



>gb|KJB35453.1| hypothetical protein B456_006G115600 [Gossypium raimondii]
Length=717

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 92/185 (50%), Gaps = 32/185 (17%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG---------------------GSDMPALMKFGNDRQN  119
             FNLIG   ++   Q SPKKPR                      G      M FG++R  
Sbjct  540  AFNLIGSCDLDGAAQRSPKKPRSSVNELQNSPSSILSMDMEMKQGETREINMNFGDERLP  599

Query  120  REGFPLVEGSTNFMAAFGSY-PMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMS  296
            ++ +    G+ N  + F +Y  M  +GRF   Q    +  N+VSLTLGL H ENLS  +S
Sbjct  600  KDSYSFFTGTDNTGSGFPTYSAMGDIGRFDPNQLTQRFHGNSVSLTLGLPHCENLS--LS  657

Query  297  ATHHNFLPN---QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
              H + L N   Q+GR + +G++E  DF     T  ++H ++    F +QNRKRF AQLL
Sbjct  658  GNHQSLLSNQNIQLGRRLELGQSEV-DFCGINNTQQASHSST----FEMQNRKRFAAQLL  712

Query  468  PDFVT  482
            PDFV 
Sbjct  713  PDFVA  717



>ref|XP_003543416.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006594920.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006594921.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006594922.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=702

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 101/191 (53%), Gaps = 38/191 (20%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-----------------------GSDMPALMKFGNDR  113
            GF+L G S M+     SP KPR                        G++  A  KFG +R
Sbjct  517  GFHLAGSSDMQIR---SPNKPRSSEMQNSPSSILSVDMEMKHSGDHGNNRDANTKFGIER  573

Query  114  --QNREGFPLVEGSTNFMAAFGSYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHSEN  278
              Q ++G+PL+  + N    FG++ ME +G RF  TTEQ    +  N VSLTLGL H+EN
Sbjct  574  HHQQKDGYPLMTSNPNHGGGFGAFTMEDIGSRFNVTTEQLASRFHGNGVSLTLGLPHNEN  633

Query  279  LSAAMSAT-HHNFLPN--QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKR  449
            LS  MS T  H FL     +GR + +G    N+F    T P S+H  + +++ +IQNRKR
Sbjct  634  LS--MSGTQQHGFLSQNIHLGRRLEMG-TNGNEFCTINTAPPSSHSGTTYESIDIQNRKR  690

Query  450  FPA-QLLPDFV  479
            F A QLLPDFV
Sbjct  691  FVAHQLLPDFV  701



>gb|KEH29763.1| BEL1-related homeotic protein [Medicago truncatula]
Length=711

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 96/176 (55%), Gaps = 24/176 (14%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDMPALMKFGNDR------------QNREGFPLVEG  146
            GF+L G S      Q SPK    GS +   M+  ++R            Q++ G+PL+ G
Sbjct  544  GFHLAGSS----DVQRSPKNSHQGSFLSMDMEMKSNRESNIEVEVERHNQDKNGYPLMSG  599

Query  147  STNFM-AAFGSYPMEQMGRF-TTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLP  320
            + N     +GS+ ME + RF  +EQ  P +  N VSLTLGL H+EN+   +S+T H FL 
Sbjct  600  NENHHDGGYGSFSMEDIRRFNVSEQLAPRFHGNGVSLTLGLPHNENI--PLSSTQHGFLS  657

Query  321  NQMGRGVVIGE--AEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
              +  G  I E  +  N+F    TTP  +H  + +++ +I+NRKRF AQLL +FVT
Sbjct  658  QNLHLGGTIDEMGSNENEFCTINTTP--SHSETNYESIDIENRKRFAAQLLRNFVT  711



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 12/150 (8%)
 Frame = +3

Query  48   GSPKKPRGGSDMPALMKF--GNDRQNREGFPLVEGSTNFMAAFGSYPME-QMGRFTTEQF  218
            G   KP   ++   LMK   G  R   +G+PL+ G+T+   ++G+YP+  ++GRF  EQF
Sbjct  525  GIEVKPDETNNQDILMKLIDGRHRGGEQGYPLIPGNTSHGGSYGAYPIGGELGRFDAEQF  584

Query  219  PPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN---QMGRGVVIGEAEANDFVAGMTT  389
             P +S N VSLTLGLQHSE+L   +S    +FL +   QMGR V +   EA D+ +    
Sbjct  585  APRFSGNGVSLTLGLQHSESL--PLSGAQPSFLSSESMQMGRRVEM-NTEAGDYCSLNNN  641

Query  390  PTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
               AH ++     ++Q R+RF AQLLP+ +
Sbjct  642  AAVAHSSNA---XSVQGRERFSAQLLPELI  668



>emb|CBI24428.3| unnamed protein product [Vitis vinifera]
Length=573

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 84/164 (51%), Gaps = 32/164 (20%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG---GSDMPALMKFGNDRQNREGFPLVEGSTNFMAAFG  173
            GFNLIG S +E + Q SPKKPR     S   +++       + E  P +    N    FG
Sbjct  438  GFNLIGSSEIEGMVQRSPKKPRSYDIQSSPSSILSM-----DMEMKPAI----NNGGGFG  488

Query  174  SY-PMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPNQMGRGVVIG  350
            +Y P+  +GRF  EQ  P +  N+VSLTLGL H ENLS             +MG G    
Sbjct  489  AYSPIGDIGRFNPEQLAPRFHGNSVSLTLGLPHCENLSLL-----------EMGNG----  533

Query  351  EAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
                 D+  G+     +H  + +D+ NIQNRKRF AQLLPDFV 
Sbjct  534  ---EPDYC-GINAAQPSHSNAAYDSINIQNRKRFAAQLLPDFVA  573



>ref|XP_007150021.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
 gb|ESW22015.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
Length=708

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 93/177 (53%), Gaps = 36/177 (20%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG-----------GSDMP------------ALMKFGNDR  113
            GF+L G S      Q SP KPR              DM             A  KF  +R
Sbjct  523  GFHLAGSS----DVQRSPNKPRSLEMQNSPSSILSVDMEMKHNGEHANTREANTKFSIER  578

Query  114  QNREGFPLVEGSTNFMAAFGSYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHSENLS  284
             +++G+PL+ G+TN    FG++ ME +G RF  TTEQ    +  N VSLTLGL H+ENLS
Sbjct  579  HHKDGYPLMSGNTNQGGGFGAFAMEDIGNRFNVTTEQLASRFHGNGVSLTLGLPHNENLS  638

Query  285  AAMSATHHNFLPN--QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKR  449
              +S T H FL     +GR + +G    N+F A + TP S+H  + +++ +IQNRKR
Sbjct  639  --ISGTQHGFLSQNIHLGRRLEMG-TTGNEFCA-INTPPSSHSGTTYESIDIQNRKR  691



>ref|XP_008799712.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008799713.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=673

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 77/136 (57%), Gaps = 20/136 (15%)
 Frame = +3

Query  90   LMKF--GNDRQNREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNA-VSLTLG  260
            LMKF  G  R   +GF L+ G+ +     G+YP+  +GRF +EQF P +  N  VSLTLG
Sbjct  553  LMKFMDGRQRAGDQGFSLIAGNADHGGNLGAYPIAGIGRFDSEQFAPRFPGNGGVSLTLG  612

Query  261  LQHSENLSAAMSATHHNFLPNQMGRGVVIGEAEANDFVAGMTTPTSA--HPTSVFDNFNI  434
            L   EN S  +S     FL N+       G A  N      + P++A  HP+S +++ +I
Sbjct  613  LPQCENFS--LSGAQPPFLSNE-------GMASFN------SNPSAAPAHPSSAYESIDI  657

Query  435  QNRKRFPAQLLPDFVT  482
            Q+RKRF A+LLPDFV 
Sbjct  658  QSRKRFAARLLPDFVA  673



>ref|XP_010521016.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=662

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 91/173 (53%), Gaps = 38/173 (22%)
 Frame = +3

Query  42   TQGSPKKPRGGSDM-------------PALMKFGNDRQN-REGFPLVEGSTNFMAAFGSY  179
             QGSPK+ R   +M                MK   +RQ  R+G+       +F+  FG Y
Sbjct  502  AQGSPKRLRTSDEMLMQPMNTGFNPNEKLTMKILEERQGLRDGY-------SFVGNFGQY  554

Query  180  PMEQMGRFTTEQ----FPPPYS---TNAVSLTLGLQHSENLSAAMSATHH-NFLPN---Q  326
             M++M RF          PP +    N VSLTLGL H E+LSA    THH NF+PN   Q
Sbjct  555  QMDEMPRFDVSDHQHLIVPPRTFSGNNGVSLTLGLPHCESLSA----THHQNFMPNHNIQ  610

Query  327  MGRGVVIGEAEANDFVAGMTTPTSAHPTSV-FDNFNIQNRKRFPAQLLPDFVT  482
            +GR V I   E +DF A   + ++ H +SV ++  N++N+KRF AQLLPD V+
Sbjct  611  LGRRVKIN-GETDDFGAMNASASTPHSSSVAYNGINMENQKRFVAQLLPDLVS  662



>ref|XP_009629592.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009629593.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=730

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 90/174 (52%), Gaps = 21/174 (12%)
 Frame = +3

Query  3    GFNLIGPS*ME-SITQGSPKKPRGGSD--------MPALMKFGNDRQ----NREGFPLVE  143
            GF+ IG   ME S ++ + KKPR            M   MK GN R+    N +     +
Sbjct  564  GFSFIGSLNMENSTSERNNKKPRNDMQNSSSSILSMETEMKAGNTRKGEKFNGDNRQARD  623

Query  144  GSTNFMAAFGSYPMEQMGRFTTEQ-FPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLP  320
             S   M A+ +  M + GRF  EQ     +  N VSLTLGL  SENL   +S   HNFLP
Sbjct  624  QSYPLMTAYST--MGEFGRFNPEQQMATRFQGNGVSLTLGLPPSENL--VLSGNQHNFLP  679

Query  321  NQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
            NQ   G+ +G  E +     MT P  +HP+  ++N + Q+ KR+ AQLLPDFV+
Sbjct  680  NQ-NIGIEMGRIETH--YNRMTNPQPSHPSITYENIDFQSGKRYAAQLLPDFVS  730



>ref|XP_010685441.1| PREDICTED: BEL1-like homeodomain protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=747

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 91/182 (50%), Gaps = 27/182 (15%)
 Frame = +3

Query  3    GFNLIG-PS*MESITQGSPKKPRGGSDM----PALMKFGNDRQ----------NREGFPL  137
            GF LIG  S MES+   SPKK R  SDM     +++    + +           R  F L
Sbjct  570  GFTLIGTSSDMESLMARSPKKQRSNSDMQNSPSSILSMDMEMKPVDHHQQHQHQRHSF-L  628

Query  138  VEGSTNFMAAFGSYPM---EQMGRFTTEQFPP-PYSTNAVSLTLGLQHSENLSAAMSATH  305
            +    +    F  Y +   +  GRF  +Q    PY  NAVSLTLGL H ENLS  +    
Sbjct  629  MTNHGDADTGFNPYIVNNHDLAGRFNPDQMTAHPYHGNAVSLTLGLPHCENLS--LGNHQ  686

Query  306  HNFLPNQ----MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
             NFL NQ    +GR + +G  +  DF  G++    +HP + F+  +IQNRKRF AQL+ D
Sbjct  687  QNFLQNQPNIQLGRRLELGPGDQPDFC-GISMAQPSHPNNGFETIDIQNRKRFAAQLVHD  745

Query  474  FV  479
            F 
Sbjct  746  FA  747



>gb|KHN21192.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=584

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 8/112 (7%)
 Frame = +3

Query  162  AAFGSYP-MEQMGRF---TTEQFPPPYSTNAVSLTLGLQHS-ENLSAAMSATHHNFLPNQ  326
              FG++P ME +GRF    TEQ  P +  N VSLTLGL HS EN  +    T H FL   
Sbjct  474  GGFGAFPNMEDIGRFHHHVTEQLAPRFHGNGVSLTLGLPHSTENNLSLSGTTQHGFLSQN  533

Query  327  MGRGVVIGEAEANDFVAGM-TTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            M  G+    +E ++F   + TTP S+H    +++ +IQNRKRF AQLL DFV
Sbjct  534  MHLGMR--NSENDEFCGAINTTPPSSHSGISYESIDIQNRKRFAAQLLRDFV  583



>ref|XP_003540818.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006592357.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=741

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 8/112 (7%)
 Frame = +3

Query  162  AAFGSYP-MEQMGRF---TTEQFPPPYSTNAVSLTLGLQHS-ENLSAAMSATHHNFLPNQ  326
              FG++P ME +GRF    TEQ  P +  N VSLTLGL HS EN  +    T H FL   
Sbjct  631  GGFGAFPNMEDIGRFHHHVTEQLAPRFHGNGVSLTLGLPHSTENNLSLSGTTQHGFLSQN  690

Query  327  MGRGVVIGEAEANDFVAGM-TTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            M  G+    +E ++F   + TTP S+H    +++ +IQNRKRF AQLL DFV
Sbjct  691  MHLGMR--NSENDEFCGAINTTPPSSHSGISYESIDIQNRKRFAAQLLRDFV  740



>gb|ACC77468.1| BEL1 [Kalanchoe x houghtonii]
Length=641

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 92/185 (50%), Gaps = 48/185 (26%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG---------------------GSDMPALMKFGNDRQN  119
            GF+L+G S +E I++ SPK+ R                       S+   LM+FG +RQ 
Sbjct  478  GFSLVGSSELEGISEMSPKRQRTNHLMINPTDSFQSNMEMKSIHASNEHVLMQFGIERQT  537

Query  120  REGFPLVEGSTNFMAA--FGSYPMEQMGRF-TTEQFPPPYS-TNAVSLTLGLQHSENLSA  287
            R+ + L       MAA  FGS P+E++ +F ++ Q+ P +S    VSLTLGL  +     
Sbjct  538  RDDYSL-------MAAGPFGSCPLEEINQFDSSHQYQPRFSGKGGVSLTLGLTDT-----  585

Query  288  AMSATHHNFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPTS-VFDNFNIQNRKRFPAQL  464
                      PNQ  R +  GEA  ++F      P  A  TS  +++ NIQN KRFP QL
Sbjct  586  --------LFPNQNMRRMDTGEA--SEFGTINNNPNPARTTSTAYESINIQNPKRFPVQL  635

Query  465  LPDFV  479
            LPDFV
Sbjct  636  LPDFV  640



>ref|XP_007208166.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
 gb|EMJ09365.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
Length=655

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 93/173 (54%), Gaps = 26/173 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDMP----ALMKFGNDRQNREGFPLVEGSTNFMAAF  170
            GFNL+G S M    QGSPKK R  S++     +++    D +  E     E +T+    F
Sbjct  494  GFNLVGMSNM----QGSPKK-RKSSEIENSPSSILSMDTDMKANETN--REITTDHANGF  546

Query  171  GSYPMEQMGRFTT--EQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN-------  323
            G+YP+ ++ RF    E     +  N VSLTLGL H EN+S  +S T  +FL N       
Sbjct  547  GTYPIPEIERFDMNPEHLAQRFHGNGVSLTLGLPHRENIS--LSGTQQSFLSNHGQINIH  604

Query  324  -QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
             Q+GR    G  EA DF A +  P  +H    +++ ++++RKRF AQLLPDFV
Sbjct  605  DQLGRRFNTG-GEA-DFCA-INHPQPSHSGIDYEDMDMRSRKRFAAQLLPDFV  654



>ref|XP_008230296.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008230304.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=655

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 93/173 (54%), Gaps = 26/173 (15%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDMP----ALMKFGNDRQNREGFPLVEGSTNFMAAF  170
            GFNL+G S M    QGSPKK R  S++     +++    D +  E     E + +    F
Sbjct  494  GFNLVGMSNM----QGSPKK-RKSSEIENSPSSILSVDADMKANETN--REITADHANGF  546

Query  171  GSYPMEQMGRFTT--EQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN-------  323
            G+YP+ ++GRF    E     +  N VSLTLGL H EN  +++S T  +FL N       
Sbjct  547  GTYPIPEIGRFDMNPEHLAQRFHGNGVSLTLGLPHREN--SSLSGTQQSFLSNHGQINIH  604

Query  324  -QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
             Q+GR    G  EA DF A +  P  +H    +++ ++++RKRF AQLLPDFV
Sbjct  605  DQLGRRFNTG-GEA-DFCA-INHPQPSHSGIDYEDMDMRSRKRFAAQLLPDFV  654



>gb|KJB55565.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
 gb|KJB55566.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
Length=721

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 88/172 (51%), Gaps = 23/172 (13%)
 Frame = +3

Query  6    FNLIGPS*MESITQGSPKKPR--------GGSDMPALMKFGNDRQNREGFP----LVEGS  149
            FNLIG S ++      PKKPR        G   M   MK G  R+    F       + S
Sbjct  558  FNLIGSSDLDR----GPKKPRNELQNSAFGILPMEMEMKQGETREINMRFGDERLFKDHS  613

Query  150  TNFMAAFGSYPMEQMGRFT-TEQFPPPYSTNA-VSLTLGLQHSENLSAAMSATHHNFLPN  323
             ++++      M ++GRF   +Q PP +  N+ VSLTLGL   ENLS  +S  H NF+PN
Sbjct  614  YSYLSGTVYSSMREVGRFNHGQQLPPGFHGNSGVSLTLGLPDCENLS--LSGNHQNFVPN  671

Query  324  QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            Q    V    A  +DF A  T P  +H T+ +D   +Q+RKRF A LLPDFV
Sbjct  672  QTINDVE--GATQSDFCAINTQPQPSHSTT-YDTMEMQSRKRFAAPLLPDFV  720



>ref|XP_009778869.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009778870.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009778871.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=732

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 89/174 (51%), Gaps = 21/174 (12%)
 Frame = +3

Query  3    GFNLIGPS*ME-SITQGSPKKPRGGSD--------MPALMKFGNDRQ----NREGFPLVE  143
            GF+ IG   ME S ++ + KK R            M   MK G+ R+    N +     +
Sbjct  566  GFSFIGSLNMENSTSERNNKKARNDMQNSSSSILSMETEMKAGDTRKGEKFNGDNRQARD  625

Query  144  GSTNFMAAFGSYPMEQMGRFTTEQ-FPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLP  320
             S   M A+ +  M + GRF  EQ     +  N VSLTLGL  SENL   +S + HNFLP
Sbjct  626  QSYPLMTAYST--MGEFGRFNPEQQMATSFQGNGVSLTLGLPPSENL--VLSGSQHNFLP  681

Query  321  NQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
            NQ   G+ +G  E +     M+ P  +HP   ++N + Q+ KR+ AQLLPDFV+
Sbjct  682  NQ-NIGIEMGRIETH--YNRMSNPQPSHPNITYENIDFQSGKRYAAQLLPDFVS  732



>gb|KHF99976.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=693

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 90/175 (51%), Gaps = 32/175 (18%)
 Frame = +3

Query  6    FNLIGPS*MES---ITQGSPKKPRGGSD----MPALMKFGNDRQNR-------EGFPLVE  143
            FNLIG S  ++   + Q + KK R  +D     P  MK G   +         +   L++
Sbjct  533  FNLIGSSEFDNGVGLAQRASKKSRNANDELQNSPMEMKPGETWETNINMIKLGDEERLLK  592

Query  144  GSTNFMAAFGSYPMEQMGRFTTEQ-FPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLP  320
             S ++++      M ++GRF  EQ  PP +  N+VSLTLGL H ENLS  +S    NFL 
Sbjct  593  HSFSYLSGTAYSSMGEIGRFNEEQQLPPKFHGNSVSLTLGLPHCENLS--LSGNPQNFLS  650

Query  321  NQMGRGVVIGEAEANDFVAGMTTPTSAHPTSV-FDNFN-IQNRKRFPAQLLPDFV  479
            N             ++   G+ TP ++H  +  FDN + +QNR+RF AQLLPDFV
Sbjct  651  N-------------HNIQLGINTPHASHSNAAGFDNIHEMQNRQRFAAQLLPDFV  692



>emb|CDX84171.1| BnaC04g09330D [Brassica napus]
Length=588

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 84/176 (48%), Gaps = 35/176 (20%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGG------------SDMPALMKFGNDRQNREGFPLVEGSTNFMAA  167
            +E +T  QGSPK+ R              S+    MK   +RQ        +G   FM  
Sbjct  421  LEGVTGMQGSPKRLRTNEETMMQPNVDFTSNEKLTMKILEERQEIRS----DGGYPFMGN  476

Query  168  FGSYPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ  326
            FG Y M++M RF       E     YS   N VSLTLGL H ++LS   S  H  F+   
Sbjct  477  FGQYQMDEMSRFDVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLS---STRHQGFMQTH  533

Query  327  ----MGRGVVIGEAEANDFVAGMTTPTSAHPTSV-FDNFNIQNRKRFPAQLLPDFV  479
                +GR V IGE E  ++ A   +  + H ++  +   NIQN+KR+ AQLLPDFV
Sbjct  534  HGIPIGRRVKIGETE--EYGAANISAATVHSSAAAYSAMNIQNQKRYVAQLLPDFV  587



>gb|KJB09137.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09138.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09139.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
Length=693

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 91/175 (52%), Gaps = 32/175 (18%)
 Frame = +3

Query  6    FNLIGPS*MES---ITQGSPKKPRGGSD----MPALMKFGNDRQNR-------EGFPLVE  143
            FNLIG S +++   + Q + KK R  +D     P  MK G   +         +   L++
Sbjct  533  FNLIGSSELDNGVGVAQRASKKSRNVNDELQNSPVEMKPGETWETNINMIKLGDEERLLK  592

Query  144  GSTNFMAAFGSYPMEQMGRFTTEQ-FPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLP  320
             S ++++      M ++GRF  EQ  PP +  N+VSLTLGL H ENLS  +S    NFL 
Sbjct  593  HSFSYLSGTTYTSMGEIGRFNEEQQLPPKFHGNSVSLTLGLPHCENLS--LSRNPQNFLS  650

Query  321  NQMGRGVVIGEAEANDFVAGMTTPTSAHPTSV-FDNFN-IQNRKRFPAQLLPDFV  479
            N             ++   G+ TP ++H  +  FDN + +QNR+RF AQLLPDFV
Sbjct  651  N-------------HNIQLGINTPHASHSNAAGFDNIHEMQNRQRFAAQLLPDFV  692



>emb|CDP15553.1| unnamed protein product [Coffea canephora]
Length=725

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 92/187 (49%), Gaps = 33/187 (18%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRG----------GSDMPALMKFGNDRQ------------  116
            GF LIG   ME+  + + KK R             DM   MKFG  R+            
Sbjct  545  GFGLIGALNMEANVEKNSKKMRTEMQNSPSSILSVDME--MKFGEPRKGFDNKFSTSQRE  602

Query  117  -NREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAM  293
             N++GF L+  +      FG++ + ++G+F  EQ    +  N+VSLTLGL  SENL A  
Sbjct  603  TNKDGFSLMVNNAGHGNGFGAFNLGELGQFNPEQLTTGFHGNSVSLTLGLPPSENL-ALS  661

Query  294  SATHHNFLPNQ---MGRGVVIGEAEAN-DFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQ  461
            + T  N+L +Q   +   + +G  + + D V    T   +H +  ++  N  NRKRF AQ
Sbjct  662  AGTQQNYLSDQNMELEDRLEMGTMDGHYDRVNKTQT---SHSSLGYETINFDNRKRFAAQ  718

Query  462  LLPDFVT  482
            LLPDFVT
Sbjct  719  LLPDFVT  725



>emb|CDY40420.1| BnaA04g20970D [Brassica napus]
Length=632

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 86/180 (48%), Gaps = 34/180 (19%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  456  LEGVTGMQGSPKRLRTSEETMMQPINADFSSNEKLTMKILEERQGLR-SDGGYPFMGNFG  514

Query  174  SYPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ--  326
             Y M++M RF       E     YS   N VSLTLGL H ++LS   S  H  F+     
Sbjct  515  QYQMDEMSRFEVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLS---STHHQGFMQTHHG  571

Query  327  --MGRGVVIGEAE-------ANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
              +GR V IGEA+            +  T  +SA   + ++  NIQN+KR+ AQLLPDFV
Sbjct  572  IPIGRRVKIGEADDYGAAALNGGGGSAATVHSSATAAAAYNGMNIQNQKRYVAQLLPDFV  631



>ref|XP_009141535.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141536.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141537.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
Length=675

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 86/181 (48%), Gaps = 34/181 (19%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  499  LEGVTGMQGSPKRLRTSEETMMQPINADFSSNEKLTMKILEERQGL-RSDGGYPFMGNFG  557

Query  174  SYPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ--  326
             Y M++M RF       E     YS   N VSLTLGL H ++LS   S  H  F+     
Sbjct  558  QYQMDEMSRFEVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLS---STHHQGFMQTHHG  614

Query  327  --MGRGVVIGEAE-------ANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
              +GR V IGEA+            +  T  +SA   + ++  NIQN+KR+ AQLLPDFV
Sbjct  615  IPIGRRVKIGEADDYGAAALNGGGGSAATVHSSATAAAAYNGMNIQNQKRYVAQLLPDFV  674

Query  480  T  482
             
Sbjct  675  A  675



>gb|AFB32720.1| hypothetical protein 0_17161_01, partial [Larix decidua]
Length=129

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 12/131 (9%)
 Frame = +3

Query  96   KFGNDRQNREGFPLVEGST---NFMAAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLTLGL  263
            KF ++RQN E +  V  +    +   +FGSY +  + R+  E F P +S +  VSLTLGL
Sbjct  3    KFSDERQNTEDYSFVHNAMVHPDNSGSFGSYQIGDLSRYGHESFTPRFSGSGGVSLTLGL  62

Query  264  QHSENLSAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNI  434
            Q ++ LS  +  T  N++  Q   +GR   +G   ++D+    T+  +AHP ++++N NI
Sbjct  63   QRTDGLS--LQGTQQNYMSTQSLALGRRHDLG-GNSSDYCNIETS--TAHPANIYENLNI  117

Query  435  QNRKRFPAQLL  467
            Q RK F  QL+
Sbjct  118  QPRKCFATQLM  128



>emb|CDX75085.1| BnaA05g08310D [Brassica napus]
Length=628

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 84/173 (49%), Gaps = 28/173 (16%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKF-GNDR------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F  ND+      + R+G    +G   FM  FG
Sbjct  460  LEVVTGMQGSPKRLRTNEETMMQPINADFNSNDKLTMKILEERQGIR-SDGGYPFMGNFG  518

Query  174  SYPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ--  326
             Y M++M RF       E     YS   N VSLTLGL H ++LS   S  H  F+     
Sbjct  519  QYQMDEMSRFDVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLS---STRHQGFMQTHHG  575

Query  327  --MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
              +GR V IG+ E     A ++  T     + +   NIQN+KR+ AQLLPDFV
Sbjct  576  IPIGRRVKIGDTEEYG-SANISAATVHSSAAAYSAMNIQNQKRYVAQLLPDFV  627



>ref|XP_006494895.1| PREDICTED: BEL1-like homeodomain protein 1-like [Citrus sinensis]
Length=672

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 83/171 (49%), Gaps = 36/171 (21%)
 Frame = +3

Query  3    GFNLIGPS*--MESITQGSPKKPRGGSDMPALMKFGNDRQNREGFPLVEGSTNFMAAFGS  176
            GFNLIGPS   +E   Q S KKPR         +  N R +      +         F  
Sbjct  527  GFNLIGPSDHHLEGFVQRSQKKPRNA-------EMQNSRSS------INDPGGGFGMFSM  573

Query  177  YPMEQMGRFTTE------QFPPP--YSTNAVSLTLGLQHSENLSAAMSATHHNFLPNQMG  332
             P  ++GRF  +      Q   P  +  N VSLTLGL H ENLS  +S + HN L +   
Sbjct  574  GP--EIGRFNPDNHHHHHQLAAPTFHGNNGVSLTLGLPHCENLS--LSGSQHNLLSS---  626

Query  333  RGVVIGEAEANDFVAGMTTPT-SAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
                 G+    D   G+ TP  ++H  + +++ +IQ+RKRF AQLLPDFVT
Sbjct  627  -----GQNIEPDHFCGIETPQHNSHSGTAYESIDIQSRKRFAAQLLPDFVT  672



>ref|XP_006424091.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
 gb|ESR37331.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
Length=671

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 83/171 (49%), Gaps = 36/171 (21%)
 Frame = +3

Query  3    GFNLIGPS*--MESITQGSPKKPRGGSDMPALMKFGNDRQNREGFPLVEGSTNFMAAFGS  176
            GFNLIGPS   +E   Q S KKPR         +  N R +      +         F  
Sbjct  526  GFNLIGPSDHHLEGFVQRSQKKPRNA-------EMQNSRSS------INDPGGGFGMFSM  572

Query  177  YPMEQMGRFTTE------QFPPP--YSTNAVSLTLGLQHSENLSAAMSATHHNFLPNQMG  332
             P  ++GRF  +      Q   P  +  N VSLTLGL H ENLS  +S + HN L +   
Sbjct  573  GP--EIGRFNPDNHHHHHQLAAPTFHGNNGVSLTLGLPHCENLS--LSGSQHNLLSS---  625

Query  333  RGVVIGEAEANDFVAGMTTPT-SAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
                 G+    D   G+ TP  ++H  + +++ +IQ+RKRF AQLLPDFVT
Sbjct  626  -----GQNIEPDHFCGIETPQHNSHSGTAYESIDIQSRKRFAAQLLPDFVT  671



>gb|KDO46590.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46591.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46592.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
Length=671

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 83/171 (49%), Gaps = 36/171 (21%)
 Frame = +3

Query  3    GFNLIGPS*--MESITQGSPKKPRGGSDMPALMKFGNDRQNREGFPLVEGSTNFMAAFGS  176
            GFNLIGPS   +E   Q S KKPR         +  N R +      +         F  
Sbjct  526  GFNLIGPSDHHLEGFVQRSQKKPRNA-------EMQNSRSS------INDPGGGFGMFSM  572

Query  177  YPMEQMGRFTTE------QFPPP--YSTNAVSLTLGLQHSENLSAAMSATHHNFLPNQMG  332
             P  ++GRF  +      Q   P  +  N VSLTLGL H ENLS  +S + HN L +   
Sbjct  573  GP--EIGRFNPDNHHHHHQLAAPTFHGNNGVSLTLGLPHCENLS--LSGSQHNLLSS---  625

Query  333  RGVVIGEAEANDFVAGMTTPT-SAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
                 G+    D   G+ TP  ++H  + +++ +IQ+RKRF AQLLPDFVT
Sbjct  626  -----GQNIEPDHFCGIETPQHNSHSGTAYESIDIQSRKRFAAQLLPDFVT  671



>ref|XP_006410764.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410765.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410766.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52217.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52218.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52219.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
Length=677

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 88/178 (49%), Gaps = 31/178 (17%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   D    P    F ++        + R+G    +G   FM  FG
Sbjct  504  LEGVTGMQGSPKRLRTSEDTMMQPINADFSSNEKLTMKILEERQGIR-SDGGYPFMGNFG  562

Query  174  SYPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMSATHHNFLP  320
             Y M++M RF       E     YS   N VSLTLGL H ++LS+        THH  +P
Sbjct  563  QYQMDEMSRFDVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP  621

Query  321  NQMGRGVVIGEAE----ANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
              +GR V IGE E    A     G +  T+    +V++  NIQN+KR+ AQLLPDFV 
Sbjct  622  --IGRRVKIGETEEYGAAALNGGGGSAATAHSSAAVYNGMNIQNQKRYVAQLLPDFVA  677



>ref|XP_006293790.1| hypothetical protein CARUB_v10022772mg [Capsella rubella]
 gb|EOA26688.1| hypothetical protein CARUB_v10022772mg [Capsella rubella]
Length=679

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 85/179 (47%), Gaps = 32/179 (18%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  505  LEGVTGIQGSPKRLRTSEETMMQPINADFSSNEKLTMKILEERQGI-RSDGGYPFMGNFG  563

Query  174  SYPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ---  326
             Y M++M RF      E     YS   N VSLTLGL H +NLS   S  H  F+      
Sbjct  564  QYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDNLS---STHHQGFMQTHHGI  620

Query  327  -MGRGVVIGEAEANDFVA------GMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
             +GR V IGE E     A        T  +SA   + ++  NIQN+KR+ AQLLPDFV 
Sbjct  621  PIGRRVKIGETEEYGAAAINGGGSAATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  679



>ref|XP_004506223.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=636

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 68/127 (54%), Gaps = 17/127 (13%)
 Frame = +3

Query  120  REGFPLVEGSTNFM--AAFGSYPMEQMGRF--TTEQFPPPYSTNAVSLTLGLQHSENLSA  287
            ++G+ L+  + N +    FGS+ M+ +GRF  + +Q  P    N VSLTLGL H+EN+S 
Sbjct  521  KDGYSLMTENENHINGGDFGSFSMDNIGRFNVSDQQLAPKCHGNGVSLTLGLPHNENVS-  579

Query  288  AMSATHHNFLPNQMGRGVVIGE--AEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQ  461
             +S+T H FL   +  G  I E     N+F A      S          +IQNRKRF AQ
Sbjct  580  -LSSTQHGFLSQNIHLGGRINEMGGNENEFCAINNNNESV---------DIQNRKRFAAQ  629

Query  462  LLPDFVT  482
            LL +FV 
Sbjct  630  LLRNFVV  636



>emb|CDX79646.1| BnaC03g19820D [Brassica napus]
Length=691

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 90/182 (49%), Gaps = 38/182 (21%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   D    P    F ++        + R+G    +G   FM +F 
Sbjct  515  LEGVTGMQGSPKRLRTSDDTMMQPINEGFSSNEKITMKILEERQGIR-SDGGYPFMGSFV  573

Query  174  SYPMEQMGRFT---------TEQFPPPYSTNAVSLTLGLQHSENLSA----AMSATHHNF  314
             Y M++M RF          T++F    + N VSLTLGL H ++LS+        THH  
Sbjct  574  QYQMDEMSRFNVAVSDQELLTQRFSG--NINGVSLTLGLPHCDSLSSTHHQGFMQTHHGI  631

Query  315  LPNQMGRGVVIGEAE--ANDFVAG-----MTTPTSAHPTSVFDNFNIQNRKRFPAQLLPD  473
               Q+GR V IGE E   N  + G      T  +SA   + ++  NIQN+KR+ AQLLPD
Sbjct  632  ---QIGRSVKIGETEEYGNSAINGGSGSAATAHSSAAAAAAYNGMNIQNQKRYVAQLLPD  688

Query  474  FV  479
            FV
Sbjct  689  FV  690



>ref|XP_010516801.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=260

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 87/178 (49%), Gaps = 32/178 (18%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  86   LEGVTGMQGSPKRLRTSEETMMQPINADFSSNEKLTMKILEERQGIR-SDGGYPFMGNFG  144

Query  174  SYPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMSATHHNFLPN  323
             Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH    N
Sbjct  145  QYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG---N  201

Query  324  QMGRGVVIGEAEA------NDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
             +GR V IGE E       N   +  T  +SA   + ++  NIQN+KR+ AQLLPDFV
Sbjct  202  PIGRRVKIGETEEYGAAAXNGGGSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  259



>gb|AEW08020.1| hypothetical protein 0_17161_01, partial [Pinus lambertiana]
Length=129

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 72/132 (55%), Gaps = 14/132 (11%)
 Frame = +3

Query  96   KFGNDRQNREGFPLVEGST---NFMAAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLTLGL  263
            KF ++RQN E +  V  +    +   +FGSY +  + R+  E F P +S +  VSLTLGL
Sbjct  3    KFSDERQNTEDYSFVHNAMVHPDNSGSFGSYQIGDLSRYGHESFTPRFSGSGGVSLTLGL  62

Query  264  QHSENLSAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSA-HPTSVFDNFN  431
            Q ++ LS  +     N++  Q   +GR   +G   ++D+       TSA HP ++++N N
Sbjct  63   QRTDGLS--LQGAQQNYMSTQSLALGRRHDLG-GNSSDYC---NIETSAPHPANIYENIN  116

Query  432  IQNRKRFPAQLL  467
            IQ RK F  QL+
Sbjct  117  IQPRKCFATQLM  128



>ref|XP_010507571.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=233

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 88/178 (49%), Gaps = 32/178 (18%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  59   LEGVTGMQGSPKRLRTSEETMMQPINADFSSNEKLTMKILEERQGI-RSDGGYPFMGNFG  117

Query  174  SYPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMSATHHNFLPN  323
             Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH  +P 
Sbjct  118  QYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP-  175

Query  324  QMGRGVVIGEAEA------NDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
             +GR V IGE E       N   +  T  +SA   + ++  NIQN+KR+ AQLLPDFV
Sbjct  176  -IGRRVKIGETEEYGTASINGGGSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  232



>ref|XP_009133059.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Brassica rapa]
Length=658

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 75/143 (52%), Gaps = 26/143 (18%)
 Frame = +3

Query  114  QNREGFPLVEGSTNFMAAFGSYPMEQMGRFT---------TEQFPPPYSTNAVSLTLGLQ  266
            + R+G    +G   FM +FG Y M++M RF          T++F    + N VSLTLGL 
Sbjct  522  EERQGIR-SDGGYPFMGSFGQYQMDEMSRFNVAVSDQELLTQRFSG--NNNGVSLTLGLP  578

Query  267  HSENLSA----AMSATHHNFLPNQMGRGVVIGEAE--ANDFVAG-----MTTPTSAHPTS  413
            H ++LS+        THH     Q+GR V IGE E   N  + G      T  +SA   +
Sbjct  579  HCDSLSSTHHQGFMQTHHGI---QIGRSVKIGETEEYGNSAINGGSGSAATAHSSAAAAA  635

Query  414  VFDNFNIQNRKRFPAQLLPDFVT  482
             ++  NIQN+KR+ AQLLPDFV 
Sbjct  636  AYNGMNIQNQKRYVAQLLPDFVA  658



>emb|CDX84585.1| BnaA03g16450D [Brassica napus]
Length=671

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 75/142 (53%), Gaps = 26/142 (18%)
 Frame = +3

Query  114  QNREGFPLVEGSTNFMAAFGSYPMEQMGRFT---------TEQFPPPYSTNAVSLTLGLQ  266
            + R+G    +G   FM +FG Y M++M RF          T++F    + N VSLTLGL 
Sbjct  535  EERQGI-RSDGGYPFMVSFGQYQMDEMSRFNVAVSDQELLTQRFSG--NNNGVSLTLGLP  591

Query  267  HSENLSA----AMSATHHNFLPNQMGRGVVIGEAE--ANDFVAGMT-----TPTSAHPTS  413
            H ++LS+        THH     Q+GR V IGE E   N  + G +       +SA   +
Sbjct  592  HCDSLSSTHHQGFMQTHHGI---QIGRSVKIGETEEYGNSAINGGSGSTATAHSSAAAAA  648

Query  414  VFDNFNIQNRKRFPAQLLPDFV  479
             ++  NIQN+KR+ AQLLPDFV
Sbjct  649  AYNGMNIQNQKRYVAQLLPDFV  670



>gb|AEW08021.1| hypothetical protein 0_17161_01, partial [Pinus radiata]
 gb|AFG47671.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47672.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47673.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47674.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47675.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47676.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47677.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47678.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47679.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47680.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47681.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47682.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47683.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47684.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
Length=129

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 72/132 (55%), Gaps = 14/132 (11%)
 Frame = +3

Query  96   KFGNDRQNREGFPLVEGST---NFMAAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLTLGL  263
            KF ++RQN E +  V  +    +   +FGSY +  + R+  E F P +S +  VSLTLGL
Sbjct  3    KFSDERQNTEDYSFVHNAMVHPDNSGSFGSYQIGDLSRYGHESFTPRFSGSGGVSLTLGL  62

Query  264  QHSENLSAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSA-HPTSVFDNFN  431
            Q ++ LS  +     N++  Q   +GR   +G   ++D+       TSA HP ++++N N
Sbjct  63   QRTDGLS--LQGAQQNYMSTQSLALGRRHDLG-GNSSDYC---NIETSAPHPANLYENIN  116

Query  432  IQNRKRFPAQLL  467
            IQ RK F  QL+
Sbjct  117  IQPRKCFATQLM  128



>ref|XP_002881420.1| hypothetical protein ARALYDRAFT_482564 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57679.1| hypothetical protein ARALYDRAFT_482564 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 86/179 (48%), Gaps = 32/179 (18%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  497  LEGVTGMQGSPKRLRTSDETMMQPINADFSSNEKLTMKILEERQGIR-SDGGYPFMGNFG  555

Query  174  SYPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ---  326
             Y M++M RF      E     YS   N VSLTLGL H ++LS   S  H  F+      
Sbjct  556  QYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLS---STHHQGFMQTHHGI  612

Query  327  -MGRGVVIGEAEA------NDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
             +GR V IGE E       N   +  T  +SA   + ++  NIQN+KR+ AQLLPDFV 
Sbjct  613  PIGRRVKIGETEEYGAATINGGSSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  671



>ref|NP_181138.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 ref|NP_850256.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 ref|NP_001031490.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 sp|Q9SJ56.1|BLH1_ARATH RecName: Full=BEL1-like homeodomain protein 1; Short=BEL1-like 
protein 1; AltName: Full=Protein EMBRYO SAC DEVELOPMENT ARREST 
29 [Arabidopsis thaliana]
 gb|AAD21463.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAL59997.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAM20198.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAM20705.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAP37781.1| At2g35940 [Arabidopsis thaliana]
 dbj|BAE99297.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AEC09179.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 gb|AEC09180.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 gb|AEC09181.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
Length=680

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 86/179 (48%), Gaps = 32/179 (18%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  506  LEGVTGMQGSPKRLRTSDETMMQPINADFSSNEKLTMKILEERQGI-RSDGGYPFMGNFG  564

Query  174  SYPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ---  326
             Y M++M RF      E     YS   N VSLTLGL H ++LS   S  H  F+      
Sbjct  565  QYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLS---STHHQGFMQTHHGI  621

Query  327  -MGRGVVIGEAEA------NDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
             +GR V IGE E       N   +  T  +SA   + ++  NIQN+KR+ AQLLPDFV 
Sbjct  622  PIGRRVKIGETEEYGPATINGGSSTTTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  680



>ref|XP_010509532.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=678

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 85/179 (47%), Gaps = 32/179 (18%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  504  LEGVTGMQGSPKRLRTSEETMMQPINADFSSNEKLTMKILEERQGI-RSDGGYPFMGNFG  562

Query  174  SYPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ---  326
             Y M++M RF      E     YS   N VSLTLGL H ++LS   S  H  F+      
Sbjct  563  QYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLS---STHHQGFMQTHHGI  619

Query  327  -MGRGVVIGEAEANDFVA------GMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
             +GR V IGE E     A        T  +SA   + ++  NIQN+KR+ AQLLPDFV 
Sbjct  620  PIGRRVKIGETEEYGAAAINGGGSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  678



>ref|XP_010505121.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=675

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 86/179 (48%), Gaps = 32/179 (18%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  501  LEGVTGMQGSPKRLRTSEETMMQPINADFSSNEKLTMKILEERQGIR-SDGGYPFMGNFG  559

Query  174  SYPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ---  326
             Y M++M RF      E     YS   N VSLTLGL H ++LS   S  H  F+      
Sbjct  560  QYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLS---STHHQGFMQTHHGI  616

Query  327  -MGRGVVIGEAEA------NDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
             +GR V IGE E       N   +  T  +SA   + ++  NIQN+KR+ AQLLPDFV 
Sbjct  617  PIGRRVKIGETEEYGTASINGGGSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  675



>gb|AFB32721.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
 gb|AFB32722.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
 gb|AFB32723.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
Length=129

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 70/131 (53%), Gaps = 12/131 (9%)
 Frame = +3

Query  96   KFGNDRQNREGFPLVEGST---NFMAAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLTLGL  263
            KF ++RQN E +  V  +    +   +FGSY +  + R+  E F P +S +  VSLTLGL
Sbjct  3    KFSDERQNTEDYSFVHNAMVHPDNSGSFGSYQIGDLSRYGHESFTPRFSGSGGVSLTLGL  62

Query  264  QHSENLSAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNI  434
            Q ++ LS  +     N++  Q   +GR   +G   ++     ++ P   HP ++++N NI
Sbjct  63   QRTDGLS--LQGAQQNYMSTQSLALGRRHDLGGNSSDYCNIEISAP---HPANLYENINI  117

Query  435  QNRKRFPAQLL  467
            Q RK F  QL+
Sbjct  118  QPRKCFATQLM  128



>gb|AAK43836.1|AF353094_1 BEL1-like homeodomain 1 [Arabidopsis thaliana]
Length=680

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 85/179 (47%), Gaps = 32/179 (18%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QG PK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  506  LEGVTGMQGCPKRLRTSDETMMQPINADFSSNEKLTMKILEERQGI-RSDGGYPFMGNFG  564

Query  174  SYPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ---  326
             Y M++M RF      E     YS   N VSLTLGL H ++LS   S  H  F+      
Sbjct  565  QYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLS---STDHQGFMQTHHGI  621

Query  327  -MGRGVVIGEAEA------NDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFVT  482
             +GR V IGE E       N   +  T  +SA   + ++  NIQN+KR+ AQLLPDFV 
Sbjct  622  PIGRRVKIGETEEYGPATINGGSSTTTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  680



>emb|CDY32069.1| BnaC04g44970D [Brassica napus]
Length=636

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 86/181 (48%), Gaps = 34/181 (19%)
 Frame = +3

Query  30   MESIT--QGSPKKPRGGSD---MPALMKFGNDR-------QNREGFPLVEGSTNFMAAFG  173
            +E +T  QGSPK+ R   +    P    F ++        + R+G    +G   FM  FG
Sbjct  460  LEGVTGMQGSPKRLRTSEETMMQPINADFSSNEKLTMKILEERQGLR-SDGGYPFMGNFG  518

Query  174  SYPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ--  326
             Y M++M RF       E     YS   N VSLTLGL H ++LS   S  H  F+     
Sbjct  519  QYQMDEMSRFEVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLS---STHHQGFMQTHHG  575

Query  327  --MGRGVVIGEAE-------ANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
              +GR V IGEA+            +  T  +SA   + ++  NIQN+KR+ AQLLPDFV
Sbjct  576  IPIGRRVKIGEADDYGAAALNGGGGSAATVHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  635

Query  480  T  482
             
Sbjct  636  A  636



>ref|XP_010931060.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
 ref|XP_010931061.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=621

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +3

Query  75   SDMPALMKF--GNDRQNREGFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVS  248
            S+   LMKF  G  R   +GF L+ G+T+    F +YP+  +GRF +EQF P +S N VS
Sbjct  525  SNRELLMKFMDGRQRAGDQGFSLIAGNTSHGGNFEAYPVAGIGRFDSEQFAPSFSGNGVS  584

Query  249  LTLGLQHSENLSAAMSATHHNFLPNQMGRGV  341
            LTLGL   EN S  +S    +FL +++ RG+
Sbjct  585  LTLGLPQCENFS--LSGAQPSFLTSRVERGL  613



>gb|AFB32724.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
Length=129

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 71/135 (53%), Gaps = 20/135 (15%)
 Frame = +3

Query  96   KFGNDRQNREGFPLVEGSTNFM------AAFGSYPMEQMGRFTTEQFPPPYS-TNAVSLT  254
            KF ++RQN E +  V    N M       +FGSY +  + R+  E F P +S +  VSLT
Sbjct  3    KFSDERQNTEDYSFVH---NVMVHPDNSGSFGSYHIGDLSRYGHESFTPRFSGSGGVSLT  59

Query  255  LGLQHSENLSAAMSATHHNFLPNQ---MGRGVVIGEAEANDFVAGMTTPTSA-HPTSVFD  422
            LGLQ  + LS  +     N++  Q   +GR   +G   ++D+       TSA HP ++++
Sbjct  60   LGLQRIDGLS--LQGAQQNYMLTQSLALGRRHDLG-GNSSDYC---NIETSAPHPANLYE  113

Query  423  NFNIQNRKRFPAQLL  467
            N NIQ RK F  QL+
Sbjct  114  NINIQPRKCFATQLM  128



>ref|XP_002313498.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
 gb|EEE87453.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
Length=662

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 55/108 (51%), Gaps = 23/108 (21%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKP-------------------RGGSDMPALMKFGNDRQNRE  125
            GF LIGP+ ME I+  S KKP                   +G +       FG +R  ++
Sbjct  559  GFTLIGPAEMEGISLRSSKKPSSDMQNSPSSILSMDMDVKQGETSREISANFGGERLIKD  618

Query  126  GFPLVEGSTNFMAAFGSYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQH  269
            G+PL+  S      FG+YPM  +GRF  EQ  P +S N+VSL+LGL H
Sbjct  619  GYPLITSS----GGFGAYPMGDLGRFNLEQMTPRFSGNSVSLSLGLPH  662



>gb|AEW09250.1| hypothetical protein UMN_1142_01, partial [Pinus lambertiana]
 gb|AFB34663.1| hypothetical protein UMN_1142_01, partial [Pinus cembra]
 gb|AFB34664.1| hypothetical protein UMN_1142_01, partial [Pinus cembra]
Length=100

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +3

Query  192  MGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ-MGRGVVIGEAEAN  365
            + R+  E F P YS    VSLTLGLQH ++LS  +S T  ++   Q +G G     A  +
Sbjct  4    LSRYGQETFTPKYSGIGGVSLTLGLQHCDDLS--LSGTQQSYNSTQGLGSGRRHDLASDS  61

Query  366  DFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            D    +   ++    S +DN ++QN KRF   +L DFV
Sbjct  62   DDYCHIHDTSAVRGASNYDNMSMQNGKRFATHMLHDFV  99



>ref|XP_003539151.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006591059.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006591060.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=764

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 61/115 (53%), Gaps = 16/115 (14%)
 Frame = +3

Query  183  MEQMGRF------TTEQ--FPPPYSTNAVSLTLGLQHS----ENLSAAMSATHHNFLPNQ  326
            ME +GRF       T+Q    P +  N VSLTLGL HS     NLS + +   H FL   
Sbjct  649  MEDIGRFHHHHHHVTDQQSLAPRFHGNGVSLTLGLPHSTENNNNLSLSGTTHQHGFLSQN  708

Query  327  MGRGVVIGEAEANDFVAGM---TTPTSAHPTSVFDNFNI-QNRKRFPAQLLPDFV  479
            M  G+      AN+   G    T P+++H  + +++ +I QNRKRF AQLL DFV
Sbjct  709  MHLGMRSTTNNANNEFCGAINTTPPSNSHSGTSYESIDIIQNRKRFAAQLLRDFV  763



>gb|AEW09251.1| hypothetical protein UMN_1142_01, partial [Pinus radiata]
 gb|AFG58515.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58516.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58517.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58518.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58519.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58520.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58521.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58522.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58523.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58524.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58525.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58526.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58527.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
Length=100

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 51/98 (52%), Gaps = 4/98 (4%)
 Frame = +3

Query  192  MGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMSATHHNFLPNQ-MGRGVVIGEAEAN  365
            + R+  E F P YS    VSLTLGLQH ++LS  +S T  ++   Q +G G     A   
Sbjct  4    LSRYGQETFTPKYSGIGGVSLTLGLQHCDDLS--LSGTQQSYNSTQGLGSGRRHDLASDT  61

Query  366  DFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            D    +   ++    S +DN ++QN KRF   +L DFV
Sbjct  62   DDYCHIHDASAVRGASNYDNMSMQNGKRFATHMLHDFV  99



>ref|XP_009404911.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 71/131 (54%), Gaps = 10/131 (8%)
 Frame = +3

Query  39   ITQGSPKKPRGGSDMPALMKFGNDRQN--REGFPLVEGSTNFMAAFGSYPMEQMGRFTTE  212
            +T GS  KP   S+   LM+  + RQ    +G+PL+ G+T+    +G+YPM ++  F  E
Sbjct  533  LTVGS--KPDETSNHEILMQLMDGRQGVGEQGYPLLAGTTSHGGNYGAYPMGELRTFDAE  590

Query  213  QFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN---QMGRGVVIGEAEANDFVAGM  383
             F   +S N VSLTLGLQHS NL   +S    + L +   ++GR +    +E +D+ +  
Sbjct  591  HFSRRFSGNGVSLTLGLQHSGNL--PLSGAQASLLSSDSMRLGRRLET-SSEGSDYCSLN  647

Query  384  TTPTSAHPTSV  416
                +AH ++ 
Sbjct  648  HNTAAAHSSNA  658



>gb|KHN19925.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=767

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 61/118 (52%), Gaps = 19/118 (16%)
 Frame = +3

Query  183  MEQMGRF---------TTEQ--FPPPYSTNAVSLTLGLQHS----ENLSAAMSATHHNFL  317
            ME +GRF          T+Q    P +  N VSLTLGL HS     NLS + +   H FL
Sbjct  649  MEDIGRFHHHHHHHHHVTDQQSLAPRFHGNGVSLTLGLPHSTENNNNLSLSGTTHQHGFL  708

Query  318  PNQMGRGVVIGEAEANDFVAGM---TTPTSAHPTSVFDNFNI-QNRKRFPAQLLPDFV  479
               M  G+      AN+   G    T P+++H  + +++ +I QNRKRF AQLL DFV
Sbjct  709  SQNMHLGMRSTTNNANNEFCGAINTTPPSNSHSGTSYESIDIIQNRKRFAAQLLRDFV  766



>ref|XP_010093716.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC39356.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=422

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 54/112 (48%), Gaps = 23/112 (21%)
 Frame = +3

Query  162  AAFGSYPMEQMGRFTTE------QFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPN  323
              FG+YP+  +GRF         Q  P +  N VSLTLGL H EN S          L N
Sbjct  327  VGFGAYPVGDLGRFHLSADHHHHQLAPRFHGNGVSLTLGLPHCENHS----------LSN  376

Query  324  QMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
            Q    ++       D   G    T +  T  +DN ++Q+RKRF AQLLPDFV
Sbjct  377  Q---NIIDPSGTRLDNSIG----TGSESTGNYDNMDMQSRKRFVAQLLPDFV  421



>ref|XP_010089795.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXB38411.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=687

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 54/111 (49%), Gaps = 23/111 (21%)
 Frame = +3

Query  165  AFGSYPMEQMGRFTTE------QFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPNQ  326
             FG+YP+  +GRF         Q  P +  N VSLTLGL H EN S          L NQ
Sbjct  593  GFGAYPVGDLGRFHLSADHHHHQLAPRFHGNGVSLTLGLPHCENHS----------LSNQ  642

Query  327  MGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQNRKRFPAQLLPDFV  479
                ++       D   G    T +  T  +DN ++Q+RKRF AQLLPDFV
Sbjct  643  ---NIIDPSGTRLDNSIG----TGSESTGNYDNMDMQSRKRFVAQLLPDFV  686



>ref|XP_010676226.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=669

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 22/94 (23%)
 Frame = +3

Query  90   LMKFGNDRQNRE---GFPLVEGSTNFMAA----FGSYPMEQMGRFTTEQFPPP---YSTN  239
            ++KFGN++Q RE   G+P++ G  NF+       G+YP+ ++GRF TE F P       N
Sbjct  568  MIKFGNEKQGRENENGYPIISGGMNFIGMGGGDLGTYPIGEIGRFETEDFSPQPRFLHGN  627

Query  240  AVSLTLGL--------QHSENLSAAMSATHHNFL  317
             +SL+LGL        Q  ENL    SAT+H FL
Sbjct  628  GISLSLGLPPSCENHPQQLENL----SATNHTFL  657



>ref|XP_010676227.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 23/97 (24%)
 Frame = +3

Query  90   LMKFGNDRQNRE---GFPLVEGSTNFMAA----FGSYPMEQMGRFTTEQFPPP---YSTN  239
            ++KFGN++Q RE   G+P++ G  NF+       G+YP+ ++GRF TE F P       N
Sbjct  526  MIKFGNEKQGRENENGYPIISGGMNFIGMGGGDLGTYPIGEIGRFETEDFSPQPRFLHGN  585

Query  240  AVSLTLGL--------QHSENLSAAMSATHHNFL-PN  323
             +SL+LGL        Q  ENL    SAT+H FL PN
Sbjct  586  GISLSLGLPPSCENHPQQLENL----SATNHTFLSPN  618



>ref|XP_010031566.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW50924.1| hypothetical protein EUGRSUZ_J00574 [Eucalyptus grandis]
Length=693

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 80/178 (45%), Gaps = 28/178 (16%)
 Frame = +3

Query  3    GFNLIG-PS*MESITQGSPKKPRGGSDM--PALMKFGNDRQNREGFPLVE----GSTNFM  161
            GF L G  S +E     SPKKPR   D+  P  +        +   P  E    GS  ++
Sbjct  526  GFTLTGRSSNVEVGITSSPKKPRMSPDLMNPHGIILSRAMDMKGSEPSRELGGGGSDEYI  585

Query  162  -AAFGSYPMEQM-GRFTTEQFPPPYSTNAVSLTLGLQHSENL-SAAMSATHHNFLPNQ--  326
               F ++ M  + GR+           N V+LTLGL H +   S ++SA   N+ PNQ  
Sbjct  586  HGGFSAFSMGNIDGRYG----------NCVALTLGLPHRDQSPSLSVSAAPQNYFPNQSM  635

Query  327  ----MGR-GVVIGEAEANDFVAGMTTPTSAHPTSV-FDNFNIQNRKRFPAQLLPDFVT  482
                +GR  +V+G     DF      P  +   S+ ++  +I NRKRF   LLPD+V 
Sbjct  636  NHHQLGRTKLVVGNGGEADFFGIAGAPQQSQSGSINYEAIDINNRKRFADHLLPDYVA  693



>ref|XP_008449596.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
 ref|XP_008449597.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=693

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 82/168 (49%), Gaps = 10/168 (6%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDMPALMKFGNDR---QNREGFPLVEGSTNFMAAFG  173
            GFNL+ PS   +I   +PKKPR  +   A+    N+    +N     ++    + + +  
Sbjct  526  GFNLVPPSSDNNILLSTPKKPRTNTITTAVTTTNNNAVVPENPSSESMLLRDIDIVNS-N  584

Query  174  SYPMEQMGR-FTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPNQMGRGVVIG  350
            +YP+ ++G  F +E   P +  N VSLTL L H+ +   ++S    N+      + + +G
Sbjct  585  TYPVGEIGSTFNSELLTPRFHANGVSLTLALPHNNSDHLSLSPNQTNYHHLSSNQNLHLG  644

Query  351  EAEANDFVAGMTTP---TSAHPTS--VFDNFNIQNRKRFPAQLLPDFV  479
             +   D       P   +  +P +   +D+ ++Q  KRF AQLLPDFV
Sbjct  645  RSSRLDITNHHPGPPDFSDVNPAAPPAYDHVDMQTTKRFAAQLLPDFV  692



>ref|XP_010553582.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Tarenaya hassleriana]
Length=563

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 77/163 (47%), Gaps = 27/163 (17%)
 Frame = +3

Query  45   QGSPKKPRGGSDM---PALMKF-GNDRQN-----REGFPLVEGSTNFMAAFGSYPMEQMG  197
            QGSPK+ R   +M   P    F  N++        EG  L +G +    +FG Y M+++ 
Sbjct  405  QGSPKRRRTNDEMLIQPINTDFLSNEKLTVNHILEEGRGLRDGYSFLSNSFGQYQMDELP  464

Query  198  RFTT-----EQFPPPYSTNAVSLTLGLQHSENLSAAMSATHH---NFLPN---QMGRGVV  344
            RF       E        N VSLTLGL   E L    S+THH   NF+PN   Q+GR V 
Sbjct  465  RFEVSDHMIEAQRAFSGNNGVSLTLGLPRCETL----SSTHHHHQNFMPNHTIQLGRSVK  520

Query  345  IGEAEANDFVA--GMTTPTSAHPTSVFDNFNIQNRKRFPAQLL  467
            I +   ++F A     +      +  ++ FNI+N+KRF   L+
Sbjct  521  I-DGVPDEFGAMNASASSAPHSSSGAYNGFNIENQKRFVGHLV  562



>ref|XP_004140170.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 ref|XP_004156066.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN48050.1| hypothetical protein Csa_6G426360 [Cucumis sativus]
Length=698

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 83/169 (49%), Gaps = 11/169 (7%)
 Frame = +3

Query  3    GFNLIGPS*MESITQGSPKKPRGGSDMPALMKFGND----RQNREGFPLVEGSTNFMAAF  170
            GF+L+ PS   +I   +PKKPR  +   A+    N+     +N     ++    + + + 
Sbjct  530  GFSLVPPSSDNNILLSTPKKPRTTTTTAAITTTNNNNNVVSENPSSESMLLRDIDIVNS-  588

Query  171  GSYPMEQMGR-FTTEQFPPPYSTNAVSLTLGLQHSENLSAAMSATHHNFLPNQMGRGVVI  347
             S+P+ ++G  F +E   P +  N VSLTL L H+ +   ++S    N+      + + +
Sbjct  589  NSFPVGEIGSTFNSELLTPRFHANGVSLTLALPHNNSDHLSLSPNQTNYHHLSSNQNLHL  648

Query  348  GEAEANDFVAGMTTP---TSAHPTS--VFDNFNIQNRKRFPAQLLPDFV  479
            G +   D       P   +  +PT+   +D+ ++Q  KRF AQLLPDFV
Sbjct  649  GRSSRLDITNHHPGPPDFSDVNPTAPPSYDHVDMQTTKRFAAQLLPDFV  697



>ref|NP_001234599.1| bell-like homeodomain protein 2 [Solanum lycopersicum]
 ref|XP_010322314.1| PREDICTED: bell-like homeodomain protein 2 isoform X1 [Solanum 
lycopersicum]
 gb|AAP47025.1|AF375966_1 bell-like homeodomain protein 2 [Solanum lycopersicum]
Length=699

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 59/119 (50%), Gaps = 25/119 (21%)
 Frame = +3

Query  141  EGSTN-FMAAFGSYPMEQMGRFT--TEQFPPPY-STNAVSLTLGLQHSENLSAAMSATHH  308
            +G TN  MAA   Y M   GRF    +Q    +   N VSLTLGL  SENL  AM  +  
Sbjct  596  KGFTNPLMAA---YAMGDFGRFDPHDQQMTANFHGNNGVSLTLGLPPSENL--AMPVSQQ  650

Query  309  NFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQN-RKRFPAQLLPDFVT  482
            N+L N++G    IG               S +    ++N + Q+  KRFP QLLPDFVT
Sbjct  651  NYLSNELGSRPEIG---------------SHYNRMGYENIDFQSGNKRFPTQLLPDFVT  694



>ref|NP_001274921.1| BEL1-related homeotic protein 5 [Solanum tuberosum]
 gb|AAN03621.1|AF406697_1 BEL1-related homeotic protein 5 [Solanum tuberosum]
Length=688

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 58/119 (49%), Gaps = 25/119 (21%)
 Frame = +3

Query  141  EGSTN-FMAAFGSYPMEQMGRFT--TEQFPPPY-STNAVSLTLGLQHSENLSAAMSATHH  308
            +G TN  MAA   Y M   GRF    +Q    +   N VSLTLGL  SENL  AM  +  
Sbjct  585  KGFTNPLMAA---YAMGDFGRFDPHDQQMTANFHGNNGVSLTLGLPPSENL--AMPVSQQ  639

Query  309  NFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQN-RKRFPAQLLPDFVT  482
            N+L N +G    +G               S +    ++N + Q+  KRFP QLLPDFVT
Sbjct  640  NYLSNDLGSRSEMG---------------SHYNRMGYENIDFQSGNKRFPTQLLPDFVT  683



>ref|XP_006361091.1| PREDICTED: BEL1-related homeotic protein 5 [Solanum tuberosum]
Length=684

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 58/119 (49%), Gaps = 25/119 (21%)
 Frame = +3

Query  141  EGSTN-FMAAFGSYPMEQMGRFT--TEQFPPPY-STNAVSLTLGLQHSENLSAAMSATHH  308
            +G TN  MAA   Y M   GRF    +Q    +   N VSLTLGL  SENL  AM  +  
Sbjct  581  KGFTNPLMAA---YAMGDFGRFDPHDQQITANFHGNNGVSLTLGLPPSENL--AMPVSQQ  635

Query  309  NFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQN-RKRFPAQLLPDFVT  482
            N+L N +G    +G               S +    ++N + Q+  KRFP QLLPDFVT
Sbjct  636  NYLSNDLGSRPEMG---------------SHYNRMGYENIDFQSGNKRFPTQLLPDFVT  679



>emb|CAC82983.1| putative BEL1-like protein [Gnetum gnemon]
Length=376

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 58/130 (45%), Gaps = 25/130 (19%)
 Frame = +3

Query  153  NFMAAFGSYPMEQMGRFTTEQFPPPYST--------------NAVSLTLGLQHSENLSAA  290
            +    FGSY ++ + R+  E    PY+                 VSLTLGLQH ++LS +
Sbjct  232  DVTGDFGSYQIDGLSRYGQE----PYTHQHHHHHHHHKFGGIGGVSLTLGLQHCDDLSLS  287

Query  291  --MSATHHNFLPNQMGRGVVIGEAEANDF-----VAGMTTPTSAHPTSVFDNFNIQNRKR  449
               +A  H +  NQ+ R   +G   ++ F     +   +   SA  T  +D  N+ N+KR
Sbjct  288  AAAAAAQHPYAGNQLPRRSDLGIESSSQFHPHQHIHSTSDVGSAATTPNYDTLNLHNQKR  347

Query  450  FPAQLLPDFV  479
            F   LL D  
Sbjct  348  FATHLLHDLC  357



>gb|ACD39464.1| BEL5 protein [Solanum palustre]
Length=698

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 57/119 (48%), Gaps = 25/119 (21%)
 Frame = +3

Query  141  EGSTN-FMAAFGSYPMEQMGRFT--TEQFPPPY-STNAVSLTLGLQHSENLSAAMSATHH  308
            +G TN  MAA   Y M   GRF    +Q    +   N VSLTLGL  SENL  AM     
Sbjct  595  KGFTNPLMAA---YAMGDFGRFDPHDQQMTANFHGNNGVSLTLGLPPSENL--AMPVNQQ  649

Query  309  NFLPNQMGRGVVIGEAEANDFVAGMTTPTSAHPTSVFDNFNIQN-RKRFPAQLLPDFVT  482
            N+L N++G    +G               S +    ++N   Q+  KRFP QLLPDFVT
Sbjct  650  NYLSNELGSRPEMG---------------SHYNRMGYENIEFQSGNKRFPTQLLPDFVT  693



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250