BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN006K01

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095399.1|  PREDICTED: protein translation factor SUI1 h...    216   4e-68   Sesamum indicum [beniseed]
ref|XP_006346213.1|  PREDICTED: protein translation factor SUI1 h...    214   1e-67   Solanum tuberosum [potatoes]
ref|XP_004244116.1|  PREDICTED: protein translation factor SUI1 h...    214   2e-67   Solanum lycopersicum
ref|XP_009628718.1|  PREDICTED: protein translation factor SUI1 h...    213   5e-67   Nicotiana tomentosiformis
ref|XP_011097879.1|  PREDICTED: protein translation factor SUI1 h...    212   9e-67   Sesamum indicum [beniseed]
ref|XP_006586085.1|  PREDICTED: protein translation factor SUI1 h...    213   3e-66   Glycine max [soybeans]
ref|XP_002280065.1|  PREDICTED: protein translation factor SUI1 h...    208   3e-65   Vitis vinifera
ref|XP_004500068.1|  PREDICTED: protein translation factor SUI1 h...    208   4e-65   Cicer arietinum [garbanzo]
gb|AFY13590.1|  translation factor SUI1                                 207   8e-65   Aeschynomene evenia
gb|ADK79108.1|  putative eukaryotic translation initiation factor...    207   9e-65   Catharanthus roseus [chatas]
gb|KCW66993.1|  hypothetical protein EUGRSUZ_F00759                     212   1e-64   Eucalyptus grandis [rose gum]
gb|KCW66994.1|  hypothetical protein EUGRSUZ_F00759                     212   1e-64   Eucalyptus grandis [rose gum]
ref|XP_006602202.1|  PREDICTED: protein translation factor SUI1 h...    206   2e-64   Glycine max [soybeans]
ref|XP_004152930.1|  PREDICTED: protein translation factor SUI1 h...    206   4e-64   
gb|AFY13584.1|  translation factor SUI1                                 206   4e-64   Aeschynomene evenia
ref|XP_007146479.1|  hypothetical protein PHAVU_006G043900g             205   5e-64   Phaseolus vulgaris [French bean]
gb|AGS78110.1|  translation factor SUI1                                 205   5e-64   Aeschynomene filosa
gb|AGS78105.1|  translation factor SUI1                                 204   2e-63   Aeschynomene indica
ref|XP_010060345.1|  PREDICTED: protein translation factor SUI1 h...    203   3e-63   Eucalyptus grandis [rose gum]
gb|AFK38938.1|  unknown                                                 202   7e-63   Lotus japonicus
ref|XP_003600096.1|  Translation factor SUI1-like protein               202   9e-63   Medicago truncatula
gb|EPS65465.1|  hypothetical protein M569_09317                         202   1e-62   Genlisea aurea
ref|XP_004139787.1|  PREDICTED: protein translation factor SUI1 h...    201   2e-62   Cucumis sativus [cucumbers]
gb|ACJ85979.1|  unknown                                                 200   5e-62   Medicago truncatula
gb|ABY75807.1|  SUI1 B protein                                          200   5e-62   Opuntia streptacantha
ref|XP_010545223.1|  PREDICTED: protein translation factor SUI1 h...    200   7e-62   Tarenaya hassleriana [spider flower]
ref|XP_010675717.1|  PREDICTED: protein translation factor SUI1 h...    199   9e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|ADB85107.1|  translation initiation factor-like protein              199   1e-61   Jatropha curcas
emb|CDP05760.1|  unnamed protein product                                198   3e-61   Coffea canephora [robusta coffee]
ref|XP_009360995.1|  PREDICTED: protein translation factor SUI1 h...    198   4e-61   Pyrus x bretschneideri [bai li]
gb|EYU33643.1|  hypothetical protein MIMGU_mgv1a016664mg                198   4e-61   Erythranthe guttata [common monkey flower]
emb|CDY52575.1|  BnaC03g71830D                                          199   7e-61   Brassica napus [oilseed rape]
ref|XP_004171416.1|  PREDICTED: protein translation factor SUI1 h...    197   7e-61   
ref|XP_002866067.1|  hypothetical protein ARALYDRAFT_918633             197   8e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_008359266.1|  PREDICTED: protein translation factor SUI1 h...    197   1e-60   
ref|XP_007212250.1|  hypothetical protein PRUPE_ppa013625mg             197   1e-60   Prunus persica
gb|ACV50429.1|  eukaryotic translation initiation factor SUI1           196   2e-60   Jatropha curcas
ref|XP_009132417.1|  PREDICTED: protein translation factor SUI1 h...    196   2e-60   Brassica rapa
ref|NP_568818.1|  translation initiation factor SUI1 family protein     196   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491401.1|  PREDICTED: protein translation factor SUI1 h...    196   3e-60   Cicer arietinum [garbanzo]
ref|XP_010448878.1|  PREDICTED: protein translation factor SUI1 h...    195   4e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010092161.1|  Protein translation factor SUI1-2-like protein     194   9e-60   Morus notabilis
ref|XP_010482910.1|  PREDICTED: protein translation factor SUI1 h...    194   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006401506.1|  hypothetical protein EUTSA_v10015063mg             194   1e-59   Eutrema salsugineum [saltwater cress]
gb|KJB11840.1|  hypothetical protein B456_002G088900                    194   1e-59   Gossypium raimondii
ref|XP_009338696.1|  PREDICTED: protein translation factor SUI1 h...    194   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_003617548.1|  Translation factor SUI1-like protein               194   1e-59   Medicago truncatula
ref|XP_008349901.1|  PREDICTED: protein translation factor SUI1 h...    194   2e-59   
emb|CDY43020.1|  BnaA03g11670D                                          193   3e-59   Brassica napus [oilseed rape]
ref|XP_007020819.1|  Translation initiation factor SUI1 family pr...    193   3e-59   
ref|XP_006281351.1|  hypothetical protein CARUB_v10027407mg             193   3e-59   
ref|XP_004294387.1|  PREDICTED: protein translation factor SUI1 h...    192   8e-59   Fragaria vesca subsp. vesca
gb|EEC79466.1|  hypothetical protein OsI_20483                          195   1e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_010276095.1|  PREDICTED: protein translation factor SUI1 h...    191   1e-58   Nelumbo nucifera [Indian lotus]
gb|ABQ42057.1|  putative translation factor                             191   1e-58   Sonneratia alba
gb|KHN11920.1|  Protein translation factor SUI1-like protein            191   2e-58   Glycine soja [wild soybean]
ref|XP_008365050.1|  PREDICTED: protein translation factor SUI1 h...    191   2e-58   
gb|AAM77753.1|AF521961_1  translation initiation factor B04             191   3e-58   Helianthus annuus
gb|KJB62620.1|  hypothetical protein B456_009G426500                    191   3e-58   Gossypium raimondii
ref|XP_007142286.1|  hypothetical protein PHAVU_008G267800g             190   5e-58   Phaseolus vulgaris [French bean]
gb|ABQ42058.1|  putative translation factor                             190   6e-58   Sonneratia caseolaris
ref|XP_006413104.1|  hypothetical protein EUTSA_v10026037mg             194   7e-58   
ref|XP_009120023.1|  PREDICTED: protein translation factor SUI1 h...    189   7e-58   
emb|CDY17292.1|  BnaA10g09260D                                          193   1e-57   Brassica napus [oilseed rape]
ref|XP_006304318.1|  hypothetical protein CARUB_v10010698mg             189   2e-57   Capsella rubella
gb|AFD22856.1|  eukaryotic translation initiation factor SUI1-lik...    189   2e-57   Tamarix androssowii
ref|NP_175831.1|  protein translation factor SUI1-2                     188   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378877.1|  PREDICTED: protein translation factor SUI1 h...    188   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_008365631.1|  PREDICTED: protein translation factor SUI1 h...    188   3e-57   Malus domestica [apple tree]
emb|CDY46663.1|  BnaA03g48450D                                          191   3e-57   Brassica napus [oilseed rape]
gb|KHG12156.1|  hypothetical protein F383_20129                         188   4e-57   Gossypium arboreum [tree cotton]
gb|AFW78548.1|  LOW QUALITY PROTEIN: protein translation factor SUI1    190   5e-57   
ref|XP_002522857.1|  translation factor sui1, putative                  188   6e-57   
ref|NP_001055949.1|  Os05g0498400                                       187   6e-57   
emb|CDX92777.1|  BnaC07g40350D                                          190   7e-57   
ref|XP_009417250.1|  PREDICTED: protein translation factor SUI1 h...    187   7e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278682.1|  PREDICTED: protein translation factor SUI1 h...    187   7e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010501111.1|  PREDICTED: protein translation factor SUI1 h...    187   7e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009106912.1|  PREDICTED: protein translation factor SUI1 h...    187   9e-57   Brassica rapa
gb|EEE67305.1|  hypothetical protein OsJ_24532                          191   1e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539284.1|  PREDICTED: protein translation factor SUI1 h...    186   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_010232448.1|  PREDICTED: protein translation factor SUI1 h...    187   1e-56   Brachypodium distachyon [annual false brome]
ref|XP_006279715.1|  hypothetical protein CARUB_v10027405mg             186   1e-56   Capsella rubella
ref|XP_011011189.1|  PREDICTED: protein translation factor SUI1 h...    186   2e-56   Populus euphratica
gb|AFK35113.1|  unknown                                                 186   2e-56   Lotus japonicus
gb|AFK48465.1|  unknown                                                 186   2e-56   Lotus japonicus
ref|XP_010448172.1|  PREDICTED: protein translation factor SUI1 h...    186   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008784556.1|  PREDICTED: protein translation factor SUI1 h...    186   2e-56   Phoenix dactylifera
ref|XP_002867520.1|  hypothetical protein ARALYDRAFT_492082             186   2e-56   
ref|NP_194443.1|  protein translation factor SUI1-1                     186   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AFK48865.1|  unknown                                                 186   2e-56   Lotus japonicus
gb|KHN46541.1|  Protein translation factor SUI1 like 1                  187   2e-56   Glycine soja [wild soybean]
ref|NP_200287.1|  translation initiation factor SUI1 family protein     186   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542418.1|  PREDICTED: protein translation factor SUI1 h...    186   3e-56   Tarenaya hassleriana [spider flower]
emb|CDY26128.1|  BnaC06g10680D                                          186   3e-56   Brassica napus [oilseed rape]
gb|KHN38274.1|  Protein translation factor SUI1 like                    185   3e-56   Glycine soja [wild soybean]
gb|KDP39065.1|  hypothetical protein JCGZ_00822                         185   4e-56   Jatropha curcas
ref|XP_007216425.1|  hypothetical protein PRUPE_ppa022105mg             187   4e-56   
gb|KHG23747.1|  hypothetical protein F383_10557                         185   4e-56   Gossypium arboreum [tree cotton]
gb|KJB62619.1|  hypothetical protein B456_009G426400                    188   4e-56   Gossypium raimondii
gb|KJB13596.1|  hypothetical protein B456_002G083300                    185   5e-56   Gossypium raimondii
ref|XP_007213988.1|  hypothetical protein PRUPE_ppa013607mg             185   5e-56   Prunus persica
ref|XP_011096112.1|  PREDICTED: protein translation factor SUI1 h...    185   5e-56   Sesamum indicum [beniseed]
ref|XP_010545205.1|  PREDICTED: protein translation factor SUI1 h...    185   5e-56   Tarenaya hassleriana [spider flower]
gb|KHG06773.1|  hypothetical protein F383_09794                         185   6e-56   Gossypium arboreum [tree cotton]
ref|XP_008244365.1|  PREDICTED: protein translation factor SUI1 h...    184   7e-56   Prunus mume [ume]
ref|NP_001150984.1|  GOS2 homolog                                       184   1e-55   
ref|XP_010930963.1|  PREDICTED: protein translation factor SUI1 h...    184   1e-55   Elaeis guineensis
ref|XP_010062975.1|  PREDICTED: protein translation factor SUI1 h...    184   1e-55   Eucalyptus grandis [rose gum]
sp|Q9SQF4.1|SUI1_BRAOL  RecName: Full=Protein translation factor ...    184   1e-55   Brassica oleracea
gb|KHG30632.1|  hypothetical protein F383_00215                         184   1e-55   Gossypium arboreum [tree cotton]
gb|EYU27827.1|  hypothetical protein MIMGU_mgv1a016640mg                184   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_007021029.1|  Translation initiation factor SUI1 family pr...    184   1e-55   
gb|ADV04053.1|  eukaryotic translation initiation factor 2              184   1e-55   Hevea brasiliensis [jebe]
ref|XP_006284787.1|  hypothetical protein CARUB_v10006056mg             183   2e-55   
ref|XP_009109147.1|  PREDICTED: protein translation factor SUI1 h...    183   2e-55   Brassica rapa
ref|XP_009137639.1|  PREDICTED: protein translation factor SUI1 h...    183   2e-55   Brassica rapa
ref|XP_008803218.1|  PREDICTED: protein translation factor SUI1 h...    183   3e-55   Phoenix dactylifera
ref|XP_010931827.1|  PREDICTED: protein translation factor SUI1 h...    183   3e-55   Elaeis guineensis
gb|KJB81730.1|  hypothetical protein B456_013G159400                    183   3e-55   Gossypium raimondii
ref|XP_011097918.1|  PREDICTED: protein translation factor SUI1 h...    183   3e-55   Sesamum indicum [beniseed]
ref|XP_009594373.1|  PREDICTED: protein translation factor SUI1 h...    183   3e-55   Nicotiana tomentosiformis
ref|XP_002281872.1|  PREDICTED: protein translation factor SUI1 h...    183   3e-55   Vitis vinifera
gb|KHG06771.1|  hypothetical protein F383_09792                         183   3e-55   Gossypium arboreum [tree cotton]
ref|XP_009774027.1|  PREDICTED: protein translation factor SUI1 h...    183   3e-55   Nicotiana sylvestris
ref|XP_004294347.1|  PREDICTED: protein translation factor SUI1 h...    183   3e-55   Fragaria vesca subsp. vesca
ref|XP_009388867.1|  PREDICTED: protein translation factor SUI1 h...    182   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007132953.1|  hypothetical protein PHAVU_011G139000g             182   4e-55   Phaseolus vulgaris [French bean]
ref|XP_004244151.1|  PREDICTED: protein translation factor SUI1 h...    182   4e-55   Solanum lycopersicum
ref|XP_002458630.1|  hypothetical protein SORBIDRAFT_03g036990          182   4e-55   Sorghum bicolor [broomcorn]
ref|XP_007132952.1|  hypothetical protein PHAVU_011G138900g             182   4e-55   Phaseolus vulgaris [French bean]
emb|CAC84489.1|  putative translation factor                            182   4e-55   Pinus pinaster [cluster pine]
ref|NP_001152681.1|  LOC100286322                                       182   5e-55   Zea mays [maize]
ref|XP_007215170.1|  hypothetical protein PRUPE_ppa013601mg             182   5e-55   Prunus persica
ref|XP_002532561.1|  translation factor sui1, putative                  182   5e-55   Ricinus communis
ref|XP_006370639.1|  hypothetical protein POPTR_0001s44450g             182   5e-55   Populus trichocarpa [western balsam poplar]
ref|XP_003564393.1|  PREDICTED: protein translation factor SUI1 h...    182   5e-55   Brachypodium distachyon [annual false brome]
gb|ADV04054.1|  eukaryotic translation initiation factor 3              182   6e-55   Hevea brasiliensis [jebe]
emb|CDY10602.1|  BnaC03g70120D                                          182   6e-55   Brassica napus [oilseed rape]
gb|KHG11307.1|  hypothetical protein F383_12372                         182   7e-55   Gossypium arboreum [tree cotton]
ref|XP_002280157.1|  PREDICTED: protein translation factor SUI1 h...    182   7e-55   
ref|XP_004957905.1|  PREDICTED: protein translation factor SUI1 h...    182   7e-55   
ref|NP_001059843.1|  Os07g0529800                                       182   8e-55   
ref|XP_011048301.1|  PREDICTED: protein translation factor SUI1 h...    182   8e-55   Populus euphratica
ref|XP_003596650.1|  Translation factor Sui1-like protein               182   9e-55   Medicago truncatula
ref|XP_007132567.1|  hypothetical protein PHAVU_011G105700g             182   9e-55   Phaseolus vulgaris [French bean]
ref|XP_009401666.1|  PREDICTED: protein translation factor SUI1 h...    182   9e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408662.1|  PREDICTED: protein translation factor SUI1 h...    182   9e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS65463.1|  hypothetical protein M569_09315                         182   9e-55   Genlisea aurea
gb|KHG17081.1|  Protein translation factor SUI1                         183   1e-54   Gossypium arboreum [tree cotton]
ref|NP_001239651.1|  uncharacterized protein LOC100784390               182   1e-54   Glycine max [soybeans]
ref|XP_010035571.1|  PREDICTED: protein translation factor SUI1 h...    182   1e-54   Eucalyptus grandis [rose gum]
ref|XP_003568176.1|  PREDICTED: protein translation factor SUI1 h...    181   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_008809850.1|  PREDICTED: protein translation factor SUI1 h...    181   1e-54   Phoenix dactylifera
ref|XP_010909791.1|  PREDICTED: protein translation factor SUI1 h...    181   1e-54   Elaeis guineensis
sp|O82569.1|SUI1_PIMBR  RecName: Full=Protein translation factor ...    181   1e-54   Spuriopimpinella brachycarpa
ref|XP_006363526.1|  PREDICTED: protein translation factor SUI1 h...    181   1e-54   Solanum tuberosum [potatoes]
ref|NP_001104887.1|  protein translation factor SUI1 homolog            181   1e-54   Zea mays [maize]
ref|XP_009397784.1|  PREDICTED: protein translation factor SUI1 h...    181   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFC01199.1|  eukaryotic translation initiation factor                181   1e-54   Ammopiptanthus mongolicus
ref|XP_009412007.1|  PREDICTED: protein translation factor SUI1 h...    181   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004234488.1|  PREDICTED: protein translation factor SUI1 h...    181   2e-54   Solanum lycopersicum
ref|NP_001044504.2|  Os01g0794500                                       181   2e-54   
ref|XP_010240920.1|  PREDICTED: protein translation factor SUI1 h...    181   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_004159225.1|  PREDICTED: protein translation factor SUI1 h...    183   2e-54   
sp|Q9SM41.1|SUI1_SPOST  RecName: Full=Protein translation factor ...    181   2e-54   Sporobolus stapfianus [resurrection grass]
ref|XP_004970238.1|  PREDICTED: protein translation factor SUI1 h...    181   3e-54   Setaria italica
ref|NP_001236633.1|  uncharacterized protein LOC100499833               180   3e-54   Glycine max [soybeans]
ref|XP_002310460.1|  hypothetical protein POPTR_0007s02520g             180   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_004487600.1|  PREDICTED: protein translation factor SUI1 h...    180   3e-54   
ref|XP_002310461.1|  SUI1 family protein                                180   3e-54   Populus trichocarpa [western balsam poplar]
gb|EEE55519.1|  hypothetical protein OsJ_03741                          182   4e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004144489.1|  PREDICTED: protein translation factor SUI1 h...    180   4e-54   Cucumis sativus [cucumbers]
ref|XP_009800522.1|  PREDICTED: protein translation factor SUI1 h...    180   5e-54   Nicotiana sylvestris
gb|ABO15891.1|  translation initiation factor eIF1                      180   5e-54   synthetic construct
ref|XP_006475205.1|  PREDICTED: protein translation factor SUI1 h...    180   5e-54   Citrus sinensis [apfelsine]
ref|XP_010694233.1|  PREDICTED: protein translation factor SUI1 h...    180   5e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU33614.1|  hypothetical protein MIMGU_mgv1a016641mg                180   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_008341842.1|  PREDICTED: protein translation factor SUI1 h...    180   5e-54   Malus domestica [apple tree]
ref|XP_004287929.1|  PREDICTED: protein translation factor SUI1 h...    180   6e-54   Fragaria vesca subsp. vesca
ref|XP_010923943.1|  PREDICTED: protein translation factor SUI1 h...    179   6e-54   Elaeis guineensis
ref|XP_002960838.1|  hypothetical protein SELMODRAFT_437304             180   6e-54   Selaginella moellendorffii
ref|XP_010267759.1|  PREDICTED: protein translation factor SUI1 h...    179   8e-54   Nelumbo nucifera [Indian lotus]
ref|XP_004248369.1|  PREDICTED: protein translation factor SUI1 h...    179   8e-54   Solanum lycopersicum
ref|XP_002316980.1|  hypothetical protein POPTR_0011s13810g             179   8e-54   Populus trichocarpa [western balsam poplar]
emb|CDP20340.1|  unnamed protein product                                179   8e-54   Coffea canephora [robusta coffee]
ref|XP_003527319.1|  PREDICTED: protein translation factor SUI1 h...    179   8e-54   Glycine max [soybeans]
ref|XP_008341979.1|  PREDICTED: protein translation factor SUI1 h...    179   9e-54   Malus domestica [apple tree]
ref|XP_004304159.1|  PREDICTED: protein translation factor SUI1 h...    179   1e-53   Fragaria vesca subsp. vesca
sp|O48650.1|SUI1_SALBA  RecName: Full=Protein translation factor ...    179   1e-53   Salix bakko [Japanese willow]
ref|XP_011030847.1|  PREDICTED: protein translation factor SUI1 h...    179   1e-53   Populus euphratica
ref|XP_006352492.1|  PREDICTED: protein translation factor SUI1 h...    179   1e-53   Solanum tuberosum [potatoes]
ref|NP_001238017.1|  uncharacterized protein LOC100306129               179   1e-53   Glycine max [soybeans]
ref|XP_003527483.1|  PREDICTED: protein translation factor SUI1 h...    179   2e-53   Glycine max [soybeans]
gb|ABI48954.1|  putative protein translation factor Sui1                178   2e-53   Viola baoshanensis
gb|EPS74118.1|  hypothetical protein M569_00639                         178   2e-53   Genlisea aurea
ref|XP_006447521.1|  hypothetical protein CICLE_v10017243mg             178   2e-53   Citrus clementina [clementine]
gb|KHN41202.1|  Protein translation factor SUI1 like                    177   3e-53   Glycine soja [wild soybean]
ref|XP_009771770.1|  PREDICTED: protein translation factor SUI1 h...    177   3e-53   Nicotiana sylvestris
ref|XP_009342251.1|  PREDICTED: protein translation factor SUI1 h...    177   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_004515084.1|  PREDICTED: protein translation factor SUI1 h...    177   4e-53   Cicer arietinum [garbanzo]
ref|XP_009603077.1|  PREDICTED: protein translation factor SUI1 h...    177   4e-53   Nicotiana tomentosiformis
ref|XP_008230087.1|  PREDICTED: protein translation factor SUI1 h...    177   5e-53   Prunus mume [ume]
gb|EEC82174.1|  hypothetical protein OsI_26284                          192   5e-53   Oryza sativa Indica Group [Indian rice]
gb|ACG24808.1|  protein translation factor SUI1                         177   6e-53   Zea mays [maize]
ref|XP_002316065.1|  hypothetical protein POPTR_0010s16160g             177   6e-53   Populus trichocarpa [western balsam poplar]
gb|KCW46999.1|  hypothetical protein EUGRSUZ_K00804                     177   6e-53   Eucalyptus grandis [rose gum]
ref|XP_009611793.1|  PREDICTED: protein translation factor SUI1 h...    177   6e-53   Nicotiana tomentosiformis
gb|EYU19220.1|  hypothetical protein MIMGU_mgv1a016636mg                177   7e-53   Erythranthe guttata [common monkey flower]
gb|ABY75806.1|  SUI1 A protein                                          177   7e-53   Opuntia streptacantha
emb|CDO99708.1|  unnamed protein product                                177   7e-53   Coffea canephora [robusta coffee]
gb|ACN30624.1|  unknown                                                 177   8e-53   Zea mays [maize]
ref|XP_009624679.1|  PREDICTED: protein translation factor SUI1 h...    177   9e-53   Nicotiana tomentosiformis
gb|AGT16828.1|  protein translation factor SUI1                         177   1e-52   Saccharum hybrid cultivar R570
gb|KEH29652.1|  eukaryotic translation initiation factor SUI1           176   1e-52   Medicago truncatula
emb|CAD58628.1|  SUI1 protein                                           176   1e-52   Coffea arabica [arabica coffee]
ref|XP_008810164.1|  PREDICTED: protein translation factor SUI1 h...    179   1e-52   
ref|XP_002985789.1|  hypothetical protein SELMODRAFT_234882             176   1e-52   Selaginella moellendorffii
ref|XP_006644837.1|  PREDICTED: protein translation factor SUI1 h...    176   1e-52   Oryza brachyantha
emb|CDP05794.1|  unnamed protein product                                176   1e-52   Coffea canephora [robusta coffee]
ref|XP_009398183.1|  PREDICTED: protein translation factor SUI1 h...    176   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK43238.1|  unknown                                                 176   2e-52   Medicago truncatula
ref|NP_001274850.1|  uncharacterized protein LOC102577437               174   6e-52   Solanum tuberosum [potatoes]
gb|KDP20792.1|  hypothetical protein JCGZ_21263                         174   8e-52   Jatropha curcas
ref|XP_010272070.1|  PREDICTED: protein translation factor SUI1 h...    174   1e-51   Nelumbo nucifera [Indian lotus]
emb|CAD58629.1|  SUI1 protein                                           174   1e-51   Coffea arabica [arabica coffee]
ref|XP_006827315.1|  hypothetical protein AMTR_s00010p00266770          175   3e-51   
ref|XP_002976303.1|  hypothetical protein SELMODRAFT_232756             172   4e-51   Selaginella moellendorffii
gb|ABK24036.1|  unknown                                                 172   5e-51   Picea sitchensis
ref|XP_006452372.1|  hypothetical protein CICLE_v10009975mg             172   5e-51   Citrus clementina [clementine]
ref|XP_006352509.1|  PREDICTED: protein translation factor SUI1 h...    172   1e-50   Solanum tuberosum [potatoes]
gb|KJB39023.1|  hypothetical protein B456_007G314400                    171   1e-50   Gossypium raimondii
gb|KEH38844.1|  eukaryotic translation initiation factor SUI1           169   7e-50   Medicago truncatula
gb|EMS51805.1|  Protein translation factor SUI1-like protein            171   8e-50   Triticum urartu
gb|AAM34279.1|AF508969_1  translation initiation factor                 169   9e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008647990.1|  PREDICTED: LOC100286322 isoform X2                 169   2e-49   Zea mays [maize]
ref|XP_003562997.1|  PREDICTED: protein translation factor SUI1 h...    167   3e-49   Brachypodium distachyon [annual false brome]
gb|ADJ67213.1|  hypothetical protein                                    166   5e-49   Jatropha curcas
gb|EMS63057.1|  Protein translation factor SUI1-like protein            167   7e-49   Triticum urartu
gb|EMT21575.1|  Protein translation factor SUI1-like protein            167   8e-49   
gb|ACS68685.1|  putative translation factor                             166   1e-48   Sonneratia alba
ref|XP_001756581.1|  predicted protein                                  166   1e-48   
ref|XP_006833020.1|  hypothetical protein AMTR_s00094p00033760          166   1e-48   
gb|ADU56181.1|  hypothetical protein                                    165   2e-48   Jatropha curcas
gb|KCW70138.1|  hypothetical protein EUGRSUZ_F03432                     167   3e-48   Eucalyptus grandis [rose gum]
ref|XP_010105571.1|  Protein translation factor SUI1-1-like protein     169   3e-48   
gb|KHN02839.1|  Protein translation factor SUI1 like 2                  166   3e-48   Glycine soja [wild soybean]
ref|XP_008351221.1|  PREDICTED: protein translation factor SUI1 h...    165   3e-48   
ref|XP_010109526.1|  Protein translation factor SUI1-1-like protein     166   3e-48   
gb|ADJ67174.1|  hypothetical protein                                    164   5e-48   Jatropha curcas
gb|EMT13356.1|  Protein translation factor SUI1-like protein            164   9e-48   
ref|XP_004961617.1|  PREDICTED: protein translation factor SUI1 h...    162   8e-47   
gb|AFW78550.1|  hypothetical protein ZEAMMB73_586492                    161   1e-46   
ref|XP_006370638.1|  hypothetical protein POPTR_0001s44450g             161   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006372949.1|  hypothetical protein POPTR_0017s06480g             160   2e-46   
gb|KEH38847.1|  eukaryotic translation initiation factor SUI1           160   3e-46   Medicago truncatula
ref|XP_004970237.1|  PREDICTED: protein translation factor SUI1 h...    160   4e-46   
ref|XP_010327265.1|  PREDICTED: protein translation factor SUI1 h...    160   4e-46   Solanum lycopersicum
ref|XP_006475204.1|  PREDICTED: protein translation factor SUI1 h...    159   4e-46   
gb|KEH38845.1|  eukaryotic translation initiation factor SUI1           159   5e-46   Medicago truncatula
ref|XP_010533344.1|  PREDICTED: protein translation factor SUI1 h...    159   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_007021023.1|  Translation initiation factor SUI1 family pr...    161   5e-46   
emb|CAB56294.1|  putative protein translation factor                    157   2e-45   Phleum pratense [timothy]
ref|XP_004144491.1|  PREDICTED: protein translation factor SUI1 h...    157   2e-45   
ref|XP_004487599.1|  PREDICTED: protein translation factor SUI1 h...    158   3e-45   
ref|XP_001752498.1|  predicted protein                                  157   4e-45   
ref|XP_009624686.1|  PREDICTED: protein translation factor SUI1 h...    156   7e-45   
ref|XP_006591819.1|  PREDICTED: uncharacterized protein LOC100306...    156   7e-45   
ref|XP_005645489.1|  translation initiation factor SU                   154   1e-43   Coccomyxa subellipsoidea C-169
gb|KJB39025.1|  hypothetical protein B456_007G314400                    153   1e-43   Gossypium raimondii
dbj|BAN10326.1|  translation initiation factor SUI1 family protein      150   6e-43   Buxus microphylla var. japonica
dbj|BAN10309.1|  eukaryotic translation initiation factor SUI1          149   2e-42   Chamaecyparis obtusa
ref|XP_010092162.1|  Protein translation factor SUI1-like protein       150   2e-42   Morus notabilis
ref|XP_001691459.1|  translation initiation protein                     149   6e-42   Chlamydomonas reinhardtii
gb|KDD75795.1|  hypothetical protein H632_c495p1                        149   7e-42   Helicosporidium sp. ATCC 50920
ref|XP_002949286.1|  hypothetical protein VOLCADRAFT_109710             149   9e-42   Volvox carteri f. nagariensis
gb|EMT19520.1|  Protein translation factor SUI1-like protein            149   5e-41   
dbj|BAF63490.1|  translational initiation factor eIF1                   145   6e-41   Potamogeton distinctus
gb|KIZ01467.1|  putative Protein translation factor SUI1 like pro...    145   2e-39   Monoraphidium neglectum
ref|XP_008776100.1|  PREDICTED: protein translation factor SUI1 h...    144   2e-39   
ref|XP_008382302.1|  PREDICTED: protein translation factor SUI1 h...    141   9e-39   
ref|XP_005847583.1|  hypothetical protein CHLNCDRAFT_133842             140   3e-38   
ref|XP_003580602.2|  PREDICTED: splicing factor, proline- and glu...    144   6e-38   
ref|XP_011396751.1|  Translation factor SUI1-like protein 1             139   8e-38   
gb|KJB62621.1|  hypothetical protein B456_009G426500                    137   1e-37   
gb|EAY95661.1|  hypothetical protein OsI_17527                          141   2e-37   
gb|ACD99647.1|  translation initiation factor                           141   2e-37   
emb|CAJ86367.1|  OSIGBa0117N13.11                                       140   3e-37   
emb|CDH49154.1|  eukaryotic translation initiation factor 1             136   4e-37   
gb|AFN10635.1|  translation initiation factor-like protein              135   4e-37   
gb|KJB45591.1|  hypothetical protein B456_007G314200                    133   4e-36   
ref|NP_001053955.1|  Os04g0627900                                       137   5e-36   
gb|KJB78392.1|  hypothetical protein B456_013G163400                    133   6e-36   
ref|XP_010090607.1|  Protein translation factor SUI1-like protein       133   8e-36   
gb|AFW78551.1|  hypothetical protein ZEAMMB73_586492                    133   9e-36   
gb|KJB13597.1|  hypothetical protein B456_002G083300                    132   1e-35   
dbj|BAK05450.1|  predicted protein                                      132   2e-35   
emb|CEG82542.1|  Putative Translation initiation factor SUI1            131   4e-35   
gb|KJB13598.1|  hypothetical protein B456_002G083300                    130   5e-35   
ref|XP_002448570.1|  hypothetical protein SORBIDRAFT_06g029340          135   6e-35   
ref|XP_006284788.1|  hypothetical protein CARUB_v10006056mg             131   6e-35   
gb|AFW75026.1|  hypothetical protein ZEAMMB73_109319                    130   7e-35   
emb|CEJ03608.1|  Putative Translation initiation factor SUI1            130   1e-34   
tpg|DAA62968.1|  TPA: translation initiation factor1                    130   1e-34   
gb|KEH38846.1|  eukaryotic translation initiation factor SUI1           129   1e-34   
dbj|BAD97168.1|  translation factor sui1 homolog                        130   1e-34   
emb|CAE04242.3|  OSJNBa0089N06.3                                        138   2e-34   
ref|XP_008650268.1|  PREDICTED: protein translation factor SUI1 h...    129   2e-34   
ref|XP_009138116.1|  PREDICTED: probable phenylalanine--tRNA liga...    132   3e-34   
ref|XP_005539321.1|  probable eukaryotic translation initiation f...    128   6e-34   
ref|XP_006041882.1|  PREDICTED: eukaryotic translation initiation...    128   7e-34   
gb|ADB54840.1|  eukaryotic translation initiation factor 1              128   8e-34   
emb|CDO92794.1|  unnamed protein product                                127   9e-34   
ref|XP_452335.1|  hypothetical protein                                  127   9e-34   
dbj|GAN03056.1|  eukaryotic translation initiation factor SUI1          127   1e-33   
gb|AFN10636.1|  translation initiation factor-like protein              126   1e-33   
dbj|GAC71792.1|  translation initiation factor 1                        127   1e-33   
emb|CBQ73048.1|  probable translation initiation factor SUI1            127   1e-33   
ref|XP_004515083.1|  PREDICTED: protein translation factor SUI1 h...    127   2e-33   
gb|KIY98436.1|  putative Protein translation factor SUI1 like pro...    127   2e-33   
ref|XP_004706531.1|  PREDICTED: eukaryotic translation initiation...    127   2e-33   
gb|ENN73110.1|  hypothetical protein YQE_10251                          127   2e-33   
ref|XP_009025362.1|  hypothetical protein HELRODRAFT_163156             127   2e-33   
emb|CEG78008.1|  Putative Translation initiation factor SUI1            127   2e-33   
ref|XP_004177891.1|  hypothetical protein TBLA_0A05790                  126   3e-33   
gb|EPB81403.1|  hypothetical protein HMPREF1544_11892                   126   3e-33   
ref|NP_001037082.1|  protein translation factor SUI1 homolog            126   4e-33   
ref|XP_004519899.1|  PREDICTED: protein translation factor SUI1 h...    126   4e-33   
emb|CDR41170.1|  CYFA0S06e03092g1_1                                     127   4e-33   
ref|XP_004712205.1|  PREDICTED: eukaryotic translation initiation...    125   6e-33   
ref|XP_011389050.1|  putative translation initiation factor eIF1        125   6e-33   
emb|CDI53525.1|  probable translation initiation factor SUI1            125   6e-33   
gb|EIE79257.1|  translation initiation factor SUI1                      125   7e-33   
emb|CEP64385.1|  LALA0S11e02872g1_1                                     125   8e-33   
emb|CCK70740.1|  hypothetical protein KNAG_0F00710                      125   8e-33   
ref|XP_972771.1|  PREDICTED: protein translation factor SUI1 homolog    125   8e-33   
ref|XP_005344888.1|  PREDICTED: eukaryotic translation initiation...    125   8e-33   
ref|XP_002554352.1|  KLTH0F03234p                                       125   8e-33   
ref|XP_008551957.1|  PREDICTED: protein translation factor SUI1 h...    125   8e-33   
ref|XP_003957154.1|  hypothetical protein KAFR_0D03710                  125   8e-33   
gb|EIE77311.1|  translation initiation factor SUI1                      125   8e-33   
ref|XP_004334397.1|  protein translation factor, putative               125   9e-33   
ref|XP_003670956.1|  hypothetical protein NDAI_0F03950                  125   9e-33   
gb|ELU11301.1|  hypothetical protein CAPTEDRAFT_160473                  125   1e-32   
gb|AFM87132.1|  translation factor sui1-like protein                    125   1e-32   
gb|KJB24471.1|  hypothetical protein B456_004G147000                    124   1e-32   
gb|EST05525.1|  translation initiation factor 1                         125   1e-32   
ref|XP_005187256.1|  PREDICTED: protein translation factor SUI1 h...    124   1e-32   
ref|XP_448041.1|  hypothetical protein                                  124   1e-32   
ref|XP_001948896.1|  PREDICTED: protein translation factor SUI1 h...    124   1e-32   
ref|XP_004895335.1|  PREDICTED: eukaryotic translation initiation...    124   1e-32   
ref|XP_002130503.1|  PREDICTED: eukaryotic translation initiation...    124   2e-32   
ref|XP_002432016.1|  translation factor sui1, putative                  124   2e-32   
gb|ETN67045.1|  sui1                                                    124   2e-32   
emb|CDK25787.1|  unnamed protein product                                124   2e-32   
ref|XP_001661080.1|  AAEL010843-PA                                      124   2e-32   
emb|CDY33072.1|  BnaC06g07070D                                          125   2e-32   
ref|NP_983701.1|  ADL395Cp                                              124   3e-32   
ref|XP_003486256.1|  PREDICTED: protein translation factor SUI1 h...    124   3e-32   
ref|XP_001731784.1|  hypothetical protein MGL_1052                      124   3e-32   
ref|XP_007418771.1|  hypothetical protein MELLADRAFT_84135              124   3e-32   
gb|ABR27954.1|  translation initiation factor 1                         124   3e-32   
ref|XP_002066294.1|  GK18213                                            124   3e-32   
dbj|BAN20281.1|  conserved hypothetical protein                         124   3e-32   
gb|AGM32795.1|  eukaryotic initiation factor 1                          124   3e-32   
gb|EFX82803.1|  hypothetical protein DAPPUDRAFT_302358                  124   4e-32   
ref|XP_011056576.1|  PREDICTED: protein translation factor SUI1 h...    126   4e-32   
ref|NP_014155.1|  translation initiation factor eIF1                    123   4e-32   
gb|AAT40136.1|  putative translation initiation factor                  122   4e-32   
emb|CDS29728.1|  protein translation factor sui1                        123   4e-32   
ref|XP_002497891.1|  ZYRO0F15884p                                       123   4e-32   
ref|XP_002019643.1|  GL12102                                            123   4e-32   
emb|CCF52891.1|  probable translation initiation factor SUI1            124   4e-32   
gb|ERZ95524.1|  hypothetical protein GLOINDRAFT_341178                  123   5e-32   
ref|XP_003684518.1|  hypothetical protein TPHA_0B04140                  123   5e-32   
ref|XP_003673034.1|  hypothetical protein NCAS_0A00830                  123   5e-32   
ref|XP_003680684.1|  hypothetical protein TDEL_0C05840                  123   5e-32   
ref|XP_005707772.1|  protein translation factor                         123   5e-32   
ref|NP_001155788.1|  eukaryotic translation initiation factor 1         123   6e-32   
gb|KIY50999.1|  eukaryotic translation initiation factor 1              123   6e-32   
gb|AJT06393.1|  Sui1p                                                   123   7e-32   
ref|XP_011257191.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    126   7e-32   
emb|CCO28058.1|  Protein translation factor SUI1                        123   8e-32   
ref|XP_001646920.1|  hypothetical protein Kpol_2000p26                  122   8e-32   
ref|XP_006675909.1|  hypothetical protein BATDEDRAFT_84447              122   8e-32   
ref|XP_011105142.1|  sui1p                                              122   9e-32   
dbj|BAH71030.1|  ACYPI004195                                            122   9e-32   
dbj|GAA25864.1|  K7_Sui1p                                               122   9e-32   
emb|CDF91750.1|  ZYBA0S14-00166g1_1                                     122   1e-31   
ref|XP_011122353.1|  hypothetical protein AOL_s00079g176                122   1e-31   
gb|ABV44713.1|  translation initiation factor 1-like protein            122   1e-31   
gb|KIL68601.1|  hypothetical protein M378DRAFT_120853                   123   1e-31   
ref|XP_004717826.1|  PREDICTED: eukaryotic translation initiation...    122   1e-31   
ref|XP_004194644.1|  Piso0_005151                                       122   1e-31   
gb|EUC62160.1|  eukaryotic translation initiation factor SUI1           122   2e-31   
ref|XP_316499.2|  AGAP006459-PA                                         122   2e-31   
gb|AFM90303.1|  translation factor sui1-like protein                    122   2e-31   
emb|CDY02665.1|  BnaC02g07700D                                          127   2e-31   
ref|XP_010160350.1|  PREDICTED: eukaryotic translation initiation...    122   2e-31   
gb|ACO10483.1|  translation factor SUI1 homolog                         121   3e-31   
ref|XP_534229.2|  PREDICTED: eukaryotic translation initiation fa...    121   3e-31   
ref|XP_006883883.1|  PREDICTED: eukaryotic translation initiation...    121   3e-31   
ref|XP_001863733.1|  sui1                                               121   3e-31   
ref|XP_003362611.1|  PREDICTED: eukaryotic translation initiation...    121   3e-31   
gb|AAD19900.1|  putative translation initiation factor A121/Sui1        121   3e-31   
gb|KFB35115.1|  AGAP006459-PA-like protein                              121   3e-31   
gb|KHK00035.1|  Translation initiation factor SUI1                      121   3e-31   
gb|ESW98385.1|  Eukaryotic translation initiation factor eIF-1          121   4e-31   
ref|XP_004195741.1|  Piso0_005151                                       120   4e-31   
ref|XP_004434545.1|  PREDICTED: eukaryotic translation initiation...    121   4e-31   
ref|XP_006770429.1|  PREDICTED: eukaryotic translation initiation...    121   4e-31   
gb|AAP36749.1|  Homo sapiens putative translation initiation factor     121   4e-31   
ref|XP_003756178.1|  PREDICTED: eukaryotic translation initiation...    120   4e-31   
ref|XP_001863732.1|  eukaryotic translation initiation factor 1b        120   4e-31   
ref|NP_001291770.1|  eukaryotic translation initiation factor 1         120   4e-31   
ref|NP_005792.1|  eukaryotic translation initiation factor 1            120   4e-31   
ref|XP_007267881.1|  eukaryotic translation initiation factor SUI1      120   5e-31   
gb|ELR53946.1|  Eukaryotic translation initiation factor 1              120   5e-31   
ref|NP_647792.1|  CG17737                                               120   5e-31   
pdb|2IF1|A  Chain A, Human Translation Initiation Factor Eif1, Nm...    121   5e-31   
ref|XP_004855393.1|  PREDICTED: eukaryotic translation initiation...    120   5e-31   
ref|XP_004363304.1|  translation initiation factor SUI1                 120   5e-31   
gb|ETS64770.1|  hypothetical protein PaG_00729                          125   6e-31   
ref|XP_006196298.1|  PREDICTED: eukaryotic translation initiation...    121   6e-31   
gb|KIM87020.1|  hypothetical protein PILCRDRAFT_815455                  120   6e-31   
gb|ELK01507.1|  Eukaryotic translation initiation factor 1              122   6e-31   
emb|CDJ79841.1|  eukaryotic translation initiation factor 1             120   6e-31   
ref|XP_007763994.1|  eukaryotic translation initiation factor SUI1      120   6e-31   
gb|KDR15926.1|  Translation factor SUI1-like protein                    120   6e-31   
ref|NP_035638.1|  eukaryotic translation initiation factor 1            120   6e-31   
gb|ACO12696.1|  translation factor SUI1 homolog                         120   7e-31   
ref|XP_006634521.1|  PREDICTED: eukaryotic translation initiation...    120   7e-31   
ref|XP_003499225.1|  PREDICTED: eukaryotic translation initiation...    120   7e-31   
ref|XP_003319710.1|  hypothetical protein PGTG_01884                    120   7e-31   
ref|XP_008328667.1|  PREDICTED: eukaryotic translation initiation...    120   7e-31   
gb|ACO52071.1|  Eukaryotic translation initiation factor 1b             120   8e-31   
ref|NP_001161207.1|  eukaryotic translation initiation factor 1         120   8e-31   
ref|XP_002199008.1|  PREDICTED: eukaryotic translation initiation...    120   8e-31   
ref|XP_002400283.1|  translation factor Sui1, putative                  120   8e-31   
ref|XP_007618569.1|  PREDICTED: eukaryotic translation initiation...    120   9e-31   
gb|KIM24002.1|  hypothetical protein M408DRAFT_332058                   120   1e-30   
ref|XP_003477467.1|  PREDICTED: eukaryotic translation initiation...    120   1e-30   
gb|ACO10238.1|  translation factor SUI1 homolog                         120   1e-30   
ref|XP_011275934.1|  hypothetical protein BN7_1721                      119   1e-30   
ref|XP_460278.1|  DEHA2E22484p                                          119   1e-30   
ref|XP_001989273.1|  GH10143                                            119   1e-30   
ref|XP_004783325.1|  PREDICTED: eukaryotic translation initiation...    120   1e-30   
ref|XP_006264602.1|  PREDICTED: eukaryotic translation initiation...    120   1e-30   
ref|XP_004416968.1|  PREDICTED: eukaryotic translation initiation...    122   1e-30   
ref|XP_001833664.2|  eukaryotic translation initiation factor 1         119   1e-30   
ref|XP_004410340.1|  PREDICTED: eukaryotic translation initiation...    120   1e-30   
ref|XP_011423571.1|  PREDICTED: eukaryotic translation initiation...    120   1e-30   
ref|XP_006638396.1|  PREDICTED: eukaryotic translation initiation...    119   1e-30   
dbj|BAB29089.1|  unnamed protein product                                119   1e-30   
ref|XP_005973972.1|  PREDICTED: eukaryotic translation initiation...    120   1e-30   
ref|XP_004477759.1|  PREDICTED: eukaryotic translation initiation...    119   1e-30   
ref|XP_009686092.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|NP_005866.1|  eukaryotic translation initiation factor 1b           119   2e-30   
gb|AAX37073.1|  translation factor sui1-like                            119   2e-30   
ref|XP_009172778.1|  hypothetical protein T265_08648                    119   2e-30   
ref|XP_008709929.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|XP_001501911.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|XP_006894618.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|XP_006008886.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
gb|KIM49411.1|  hypothetical protein M413DRAFT_438590                   119   2e-30   
ref|XP_006108120.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|XP_005717422.1|  Translation initiation factor eIF1                 119   2e-30   
gb|KII88592.1|  hypothetical protein PLICRDRAFT_111559                  119   2e-30   
ref|XP_004662060.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|XP_005954640.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|NP_989015.1|  eukaryotic translation initiation factor 1B           119   2e-30   
gb|ELR59745.1|  Eukaryotic translation initiation factor 1b             119   2e-30   
ref|XP_010226577.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
gb|ETE68217.1|  Eukaryotic translation initiation factor 1              120   2e-30   
ref|XP_005876693.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
dbj|GAN08090.1|  conserved hypothetical protein                         119   2e-30   
ref|XP_010723031.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|XP_007067400.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|XP_006036433.1|  PREDICTED: eukaryotic translation initiation...    119   2e-30   
ref|XP_007300579.1|  eukaryotic translation initiation factor 1         119   2e-30   
ref|XP_418815.1|  PREDICTED: eukaryotic translation initiation fa...    119   3e-30   
gb|ACN30667.1|  unknown                                                 119   3e-30   
ref|XP_006051026.1|  PREDICTED: eukaryotic translation initiation...    119   3e-30   
gb|EMC80722.1|  Eukaryotic translation initiation factor 1b             119   3e-30   
dbj|BAE29876.1|  unnamed protein product                                119   3e-30   
gb|EJU05625.1|  eukaryotic translation initiation factor 1              119   3e-30   
ref|XP_007631465.1|  PREDICTED: eukaryotic translation initiation...    120   3e-30   
ref|XP_005232732.1|  PREDICTED: eukaryotic translation initiation...    120   3e-30   
ref|XP_001364419.2|  PREDICTED: uncharacterized protein LOC100012315    123   3e-30   
ref|XP_002172371.1|  translation initiation factor eIF1                 119   3e-30   
ref|XP_005439417.1|  PREDICTED: eukaryotic translation initiation...    120   3e-30   
ref|XP_005513423.1|  PREDICTED: eukaryotic translation initiation...    120   3e-30   
ref|XP_004634274.1|  PREDICTED: eukaryotic translation initiation...    119   3e-30   
ref|XP_007286334.1|  translation initiation factor                      119   3e-30   
ref|XP_003931038.1|  PREDICTED: eukaryotic translation initiation...    119   3e-30   
gb|KDQ60757.1|  hypothetical protein JAAARDRAFT_31728                   118   4e-30   
ref|XP_002052718.1|  GJ20177                                            118   4e-30   
gb|ENH77587.1|  translation initiation factor                           118   4e-30   
ref|XP_004707211.1|  PREDICTED: eukaryotic translation initiation...    118   4e-30   
ref|XP_009511501.1|  PREDICTED: eukaryotic translation initiation...    118   4e-30   



>ref|XP_011095399.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011095400.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD++  +PTAFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILK
Sbjct  1    MVDLDLQIPTAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            D+KKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFL+SAG+VKKDQIKIHGF
Sbjct  61   DVKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKKDQIKIHGF  112



>ref|XP_006346213.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=112

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVDI+  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILK
Sbjct  1    MVDIDVQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVS FLV+AG+VKKDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>ref|XP_004244116.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=112

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVDI+  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILK
Sbjct  1    MVDIDIQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVS FLV+AG+VKKDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>ref|XP_009628718.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009778004.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=112

 Score =   213 bits (542),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVDI+  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRK++SY+KILK
Sbjct  1    MVDIDVQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKQFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVS FLV+AG+VKKDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>ref|XP_011097879.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   212 bits (540),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILK
Sbjct  1    MVEVDLQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNG VVQDKELGKVIQLQGDQRKNVSQFL+SAG+VKKDQIKIHGF
Sbjct  61   DLKKEFCCNGTVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKKDQIKIHGF  112



>ref|XP_006586085.1| PREDICTED: protein translation factor SUI1 homolog 2 [Glycine 
max]
 gb|KHM99561.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=157

 Score =   213 bits (541),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  63   LHQASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYS  242
            L QA YMVD+E  +P+AFDPFAEA+ES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+S
Sbjct  40   LQQAKYMVDLEIQVPSAFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFS  99

Query  243  YDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            Y+KILKDLKK+FCCNG VVQDKELGK+IQLQGDQRKNVS FLV AGLV+KDQ+KIHGF
Sbjct  100  YEKILKDLKKDFCCNGTVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQVKIHGF  157



>ref|XP_002280065.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI26638.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFAEAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGL+K+YSY+KILK
Sbjct  1    MVELDLQIPSAFDPFAEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVS FLV AGLVKK+QIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSNFLVQAGLVKKEQIKIHGF  112



>ref|XP_004500068.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cicer 
arietinum]
Length=112

 Score =   208 bits (530),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV++E  +PT FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVELEIQVPTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV  GLV+KDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQVGLVRKDQIKIHGF  112



>gb|AFY13590.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13591.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13592.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13593.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13594.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13595.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13596.1| translation factor SUI1 [Aeschynomene denticulata]
 gb|AGC95066.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95067.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95068.1| translation factor SUI1 [Aeschynomene ciliata]
 gb|AGS78101.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78102.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78103.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78104.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78106.1| translation factor SUI1 [Aeschynomene scabra]
 gb|AGS78107.1| translation factor SUI1 [Aeschynomene rudis]
 gb|AGS78108.1| translation factor SUI1 [Aeschynomene sensitiva]
 gb|AGS78109.1| translation factor SUI1 [Aeschynomene sp. CPI104040]
 gb|AGS78111.1| translation factor SUI1 [Aeschynomene tambacoundensis]
 gb|AGS78112.1| translation factor SUI1 [Aeschynomene deamii]
 gb|AGS78114.1| translation factor SUI1 [Aeschynomene pratensis]
 gb|AGS78115.1| translation factor SUI1 [Aeschynomene virginica]
 gb|AGS78116.1| translation factor SUI1 [Aeschynomene virginica]
Length=112

 Score =   207 bits (527),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E   PT FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+K++SY+KILK
Sbjct  1    MVDLEIQFPTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVS FLV AGLV+KDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|ADK79108.1| putative eukaryotic translation initiation factor SUI1 [Catharanthus 
roseus]
Length=112

 Score =   207 bits (527),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD++  +PTAFDPFAEAK+SGAPGAKEYVHIR+QQRNGKK LTT+QGL+KE+S +KILK
Sbjct  1    MVDLDIQIPTAFDPFAEAKDSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKEFSLEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGKVIQLQGDQRKNVSQFL++AG+VKKDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLITAGIVKKDQIKIHGF  112



>gb|KCW66993.1| hypothetical protein EUGRSUZ_F00759 [Eucalyptus grandis]
Length=261

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 115/130 (88%), Gaps = 3/130 (2%)
 Frame = +3

Query  27   SLVKVSDRSDSFLHQASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKS  206
            S++ V  RS    + A+YMV+ +  LPTAFDPFAE K+SGAPGAKEYVHIRIQQRNGKKS
Sbjct  135  SVLFVGSRSS---NPANYMVEGDFELPTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKS  191

Query  207  LTTVQGLRKEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLV  386
            LTTVQGL+K+YSY+KILKDLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV   +V
Sbjct  192  LTTVQGLKKDYSYEKILKDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIV  251

Query  387  KKDQIKIHGF  416
            KKDQIKIHGF
Sbjct  252  KKDQIKIHGF  261



>gb|KCW66994.1| hypothetical protein EUGRSUZ_F00759 [Eucalyptus grandis]
Length=260

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 115/130 (88%), Gaps = 3/130 (2%)
 Frame = +3

Query  27   SLVKVSDRSDSFLHQASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKS  206
            S++ V  RS    + A+YMV+ +  LPTAFDPFAE K+SGAPGAKEYVHIRIQQRNGKKS
Sbjct  134  SVLFVGSRSS---NPANYMVEGDFELPTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKS  190

Query  207  LTTVQGLRKEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLV  386
            LTTVQGL+K+YSY+KILKDLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV   +V
Sbjct  191  LTTVQGLKKDYSYEKILKDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIV  250

Query  387  KKDQIKIHGF  416
            KKDQIKIHGF
Sbjct  251  KKDQIKIHGF  260



>ref|XP_006602202.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Glycine max]
 ref|XP_006602203.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Glycine max]
Length=112

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E  +PT FDPFAEA+ES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDLEIQVPTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNG VVQDKELGK+IQLQGDQRKNVS FLV AGLV+KDQIKIHGF
Sbjct  61   DLKKEFCCNGTVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>ref|XP_004152930.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_004168731.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_008463414.1| PREDICTED: protein translation factor SUI1 homolog 2 [Cucumis 
melo]
 gb|KGN56126.1| hypothetical protein Csa_3G077610 [Cucumis sativus]
Length=112

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD++  +P+AFDPFA+AK+S APG KEYVHIR+QQRNGKK LTTVQGL+KE+SYDKILK
Sbjct  1    MVDLDVQIPSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYDKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV AGLVKKDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF  112



>gb|AFY13584.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13585.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13586.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13587.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13588.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13589.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGS78113.1| translation factor SUI1 [Aeschynomene pratensis]
Length=112

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E   PT FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+K++SY+KILK
Sbjct  1    MVDLEIQFPTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRKNVS FLV AGLV+KDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>ref|XP_007146479.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
 gb|ESW18473.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
Length=112

 Score =   205 bits (522),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV++E  +PT FDPFAEA+ES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVELEIQVPTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRKNVS FLV AGLV+KDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|AGS78110.1| translation factor SUI1 [Aeschynomene filosa]
Length=112

 Score =   205 bits (522),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E   PT FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+K++SY+KILK
Sbjct  1    MVDLEIQFPTPFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVV DKELGK+IQLQGDQRKNVS FLV AGLV+KDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVHDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|AGS78105.1| translation factor SUI1 [Aeschynomene indica]
Length=112

 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E   P+ FDPFAEAKES APGAKEYVHIR+QQRNGKKSLTTVQGL+K +SY+KILK
Sbjct  1    MVDLEIQFPSPFDPFAEAKESDAPGAKEYVHIRVQQRNGKKSLTTVQGLKKGFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVS FLV AGLV+KDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>ref|XP_010060345.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Eucalyptus 
grandis]
 ref|XP_010060381.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Eucalyptus 
grandis]
 gb|KCW67040.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
 gb|KCW67041.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
 gb|KCW67042.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
Length=112

 Score =   203 bits (517),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+ +  LPTAFDPFAE K+SGAPGAKEYVHIRIQQRNGKKSLTTVQGL+K+YSY+KILK
Sbjct  1    MVEGDFELPTAFDPFAEGKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV   +VKKDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKKDQIKIHGF  112



>gb|AFK38938.1| unknown [Lotus japonicus]
Length=112

 Score =   202 bits (514),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E  +P  FDPFAEAKES APG KEYVH+RIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDLEIQIPNRFDPFAEAKESDAPGVKEYVHVRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVV DKELGK+IQLQGDQRKNVS FLV AGLVKKD+IKIHGF
Sbjct  61   DLKKEFCCNGNVVHDKELGKIIQLQGDQRKNVSHFLVQAGLVKKDRIKIHGF  112



>ref|XP_003600096.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AES70347.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK42757.1| unknown [Medicago truncatula]
Length=112

 Score =   202 bits (514),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +PTAFDPFA+A ES APG KEYVHIRIQQRNGKKSLTTVQGL+K+YSY+KILK
Sbjct  1    MVELDIQIPTAFDPFADAIESDAPGGKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRK VSQFLV AGLV+KDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQAGLVRKDQIKIHGF  112



>gb|EPS65465.1| hypothetical protein M569_09317 [Genlisea aurea]
Length=113

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 107/113 (95%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKE-SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            MV++E  + +AFDPFAEAKE S APGAKEY+HIRIQQRNGKKSLTTVQGLRKE+SY+KIL
Sbjct  1    MVELEVEIRSAFDPFAEAKEDSDAPGAKEYIHIRIQQRNGKKSLTTVQGLRKEFSYEKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKK+FCCNGNVV DKELGKVIQLQGDQRKNVSQFL++AGLVKKDQIKIHGF
Sbjct  61   KDLKKDFCCNGNVVHDKELGKVIQLQGDQRKNVSQFLINAGLVKKDQIKIHGF  113



>ref|XP_004139787.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis 
sativus]
 ref|XP_008447738.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis 
melo]
 gb|KGN44162.1| hypothetical protein Csa_7G209580 [Cucumis sativus]
Length=112

 Score =   201 bits (512),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFA+AK+S APG KEYVHIR+QQRNGKK LTTVQGL+KE+SY+KILK
Sbjct  1    MVELDFQIPSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            D+KKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV AGLVKKDQIKIHGF
Sbjct  61   DVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF  112



>gb|ACJ85979.1| unknown [Medicago truncatula]
Length=112

 Score =   200 bits (509),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +PTAFDPFA+A ES APG KEYVHIRIQQRNGKK LTTVQGL+K+YSY+KILK
Sbjct  1    MVELDIQIPTAFDPFADAIESDAPGGKEYVHIRIQQRNGKKGLTTVQGLKKDYSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRK VSQFLV AGLV+KDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQAGLVRKDQIKIHGF  112



>gb|ABY75807.1| SUI1 B protein [Opuntia streptacantha]
Length=112

 Score =   200 bits (509),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD E  +P AFDPF+ AK+SGAPGAKEYV IRIQQRNGKKSLTTVQGLRK++SY++ILK
Sbjct  1    MVDYEVQIPAAFDPFSGAKDSGAPGAKEYVRIRIQQRNGKKSLTTVQGLRKDFSYERILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV+ FLV AGLVKKD IKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVANFLVQAGLVKKDHIKIHGF  112



>ref|XP_010545223.1| PREDICTED: protein translation factor SUI1 homolog [Tarenaya 
hassleriana]
Length=112

 Score =   200 bits (508),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD++  +PTAFDPFAEA++S APGAKEY+HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVDLDIQIPTAFDPFAEARDSDAPGAKEYIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVV DKE GK+IQLQGDQRKNVSQF V  G+ KKDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVHDKEQGKIIQLQGDQRKNVSQFFVQKGICKKDQIKIHGF  112



>ref|XP_010675717.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=111

 Score =   199 bits (507),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 1/112 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVDI+  +P A DPFAEA ESGAPG KEYVHIRIQQRNGKKSLTTVQGL+K+YSY+KILK
Sbjct  1    MVDIDFQIPAALDPFAEA-ESGAPGVKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKILK  59

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRK V+ FLV AGLVKKDQIKIHGF
Sbjct  60   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKKVANFLVQAGLVKKDQIKIHGF  111



>gb|ADB85107.1| translation initiation factor-like protein [Jatropha curcas]
 gb|KDP39133.1| hypothetical protein JCGZ_00890 [Jatropha curcas]
Length=112

 Score =   199 bits (507),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E  +P AFDPF+EAK+SGAPGAKEYVHIRIQQRNG+KSLTTVQGL KE+SY+KI+K
Sbjct  1    MVDLEIQVPAAFDPFSEAKDSGAPGAKEYVHIRIQQRNGRKSLTTVQGLPKEFSYEKIVK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             LKKEFCCNGNVVQDKELGKVIQLQGDQRKNV  FLV+A LV+KDQIKIHGF
Sbjct  61   ALKKEFCCNGNVVQDKELGKVIQLQGDQRKNVQSFLVNAQLVRKDQIKIHGF  112



>emb|CDP05760.1| unnamed protein product [Coffea canephora]
Length=112

 Score =   198 bits (504),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD++  +P AFDPF E  +SGAPGAKEYVHIR+QQRNGKK LTT+QGL+K++S +KILK
Sbjct  1    MVDLDIQIPAAFDPFTEDNDSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKDFSLEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGKVIQLQGDQRKN SQFLV+AG+VKKDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNASQFLVTAGIVKKDQIKIHGF  112



>ref|XP_009360995.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=112

 Score =   198 bits (503),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+ +  +PTAFDPFAEAK+  APGAKEYVHIR+QQRNGKK LTTVQGL+K++SYDKILK
Sbjct  1    MVERDVQIPTAFDPFAEAKDVDAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYDKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKKDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>gb|EYU33643.1| hypothetical protein MIMGU_mgv1a016664mg [Erythranthe guttata]
Length=112

 Score =   198 bits (503),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFA+A++ GA GAKEYVHIRIQQRNGKKSLTTVQGL+KE++Y+KILK
Sbjct  1    MVELDIQIPSAFDPFADAEDLGAIGAKEYVHIRIQQRNGKKSLTTVQGLKKEFNYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            +LKKEFCCNGNVVQDKELGKV+QLQGDQRKNVSQFL+ AG+VKKDQIKIHGF
Sbjct  61   NLKKEFCCNGNVVQDKELGKVVQLQGDQRKNVSQFLIGAGIVKKDQIKIHGF  112



>emb|CDY52575.1| BnaC03g71830D, partial [Brassica napus]
Length=158

 Score =   199 bits (505),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  66   HQASYMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSY  245
            +Q  YMV+++  +P+AFDPFAEA+ES APG KEY+H+RIQQRNGKKSLTTVQGL+K YSY
Sbjct  42   NQVYYMVELDIQVPSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSY  101

Query  246  DKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            +KILKDLKK+FCCNGNVVQDKELGK+IQLQGDQRK VS FLV  G+ KK+QIKIHGF
Sbjct  102  EKILKDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFLVQTGIAKKEQIKIHGF  158



>ref|XP_004171416.1| PREDICTED: protein translation factor SUI1 homolog 1-like, partial 
[Cucumis sativus]
Length=110

 Score =   197 bits (501),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFA+AK+S APG KEYVHIR+QQRNGKK LTTVQGL+KE+SY+KILK
Sbjct  1    MVELDFQIPSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIH  410
            D+KKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV AGLVKKDQIKIH
Sbjct  61   DVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIH  110



>ref|XP_002866067.1| hypothetical protein ARALYDRAFT_918633 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42326.1| hypothetical protein ARALYDRAFT_918633 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score =   197 bits (501),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFAEAK+S APGAKE +HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQIPSAFDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV  G+ KKDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF  112



>ref|XP_008359266.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=112

 Score =   197 bits (500),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +PTAFDPF+EAK++ APGAKEYVHIR+QQRNGKK LTTVQGL+K++SY KILK
Sbjct  1    MVELDVQIPTAFDPFSEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYXKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKKDQIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>ref|XP_007212250.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_007212251.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_008226898.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008226900.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 gb|EMJ13449.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 gb|EMJ13450.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
Length=112

 Score =   197 bits (500),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +PTAFDPFAEAK++ APGAKEYVHIR+QQRNGKK LTTVQGL+K++SY+KILK
Sbjct  1    MVELDVQIPTAFDPFAEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKK+QIK+HGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKEQIKMHGF  112



>gb|ACV50429.1| eukaryotic translation initiation factor SUI1 [Jatropha curcas]
Length=120

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E  +P AFDPF+EAK+SGAPGAKEYVHIRIQQRNG+KSLTTVQGL KE+SY+KI+K
Sbjct  1    MVDLEIQVPAAFDPFSEAKDSGAPGAKEYVHIRIQQRNGRKSLTTVQGLPKEFSYEKIVK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             LKKEFCCNGNVVQDKELGKVIQLQGDQ KNV  FLV+A LV+KDQIKIHGF
Sbjct  61   ALKKEFCCNGNVVQDKELGKVIQLQGDQLKNVQSFLVNAQLVRKDQIKIHGF  112



>ref|XP_009132417.1| PREDICTED: protein translation factor SUI1 homolog [Brassica 
rapa]
Length=112

 Score =   196 bits (498),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++ H+P+AFDPFAEA+ES APG KEY+H+RIQQRNGKKSLTTVQGL+K YSY+KILK
Sbjct  1    MVELDIHVPSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VS F V  G+ KKDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFFVQTGIAKKDQIKIHGF  112



>ref|NP_568818.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_851192.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AAK60326.1|AF385736_1 AT5g54940/MBG8_21 [Arabidopsis thaliana]
 dbj|BAB08773.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AAM64690.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AAM91507.1| AT5g54940/MBG8_21 [Arabidopsis thaliana]
 gb|AED96560.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96561.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=112

 Score =   196 bits (498),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+A+DPFAEAK+S APGAKE +HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQIPSAYDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV  G+ KKDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF  112



>ref|XP_004491401.1| PREDICTED: protein translation factor SUI1 homolog [Cicer arietinum]
Length=110

 Score =   196 bits (497),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 103/112 (92%), Gaps = 2/112 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVDI+  +PT FDPF+EAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDIQ--IPTTFDPFSEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  58

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVV  KELGK+IQLQGDQRKNV+ FLV AGLV+KD IKIHGF
Sbjct  59   DLKKEFCCNGNVVNCKELGKIIQLQGDQRKNVTHFLVHAGLVRKDNIKIHGF  110



>ref|XP_010448878.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
 ref|XP_010443083.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
Length=112

 Score =   195 bits (496),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+A+DPFAEAK+S APGAK+Y+HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQVPSAYDPFAEAKDSDAPGAKDYIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV  G+ KKD IKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDHIKIHGF  112



>ref|XP_010092161.1| Protein translation factor SUI1-2-like protein [Morus notabilis]
 gb|EXB50312.1| Protein translation factor SUI1-2-like protein [Morus notabilis]
Length=111

 Score =   194 bits (494),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 1/112 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD +  +PT FDPFA A +S APGAKEYVHIR+QQRNGKK LTTVQGL+KE+SY+KILK
Sbjct  1    MVDQDVQIPTTFDPFA-AIDSDAPGAKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILK  59

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNVSQFLV AGLVKKD IKIHGF
Sbjct  60   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDHIKIHGF  111



>ref|XP_010482910.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=112

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+A+DPFAEAK+S APGAKE +HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQVPSAYDPFAEAKDSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQ+KELGK+IQLQGDQRK VSQFLV AG+ +KDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQNKELGKIIQLQGDQRKKVSQFLVQAGIAEKDQIKIHGF  112



>ref|XP_006401506.1| hypothetical protein EUTSA_v10015063mg [Eutrema salsugineum]
 dbj|BAJ34327.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42959.1| hypothetical protein EUTSA_v10015063mg [Eutrema salsugineum]
Length=112

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFAEA+++ APG KEYVHIRIQQRNGKKSLTTVQGL+K+YSY++ILK
Sbjct  1    MVELDIQIPSAFDPFAEAQDTDAPGTKEYVHIRIQQRNGKKSLTTVQGLKKDYSYERILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV  G+  KDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIANKDQIKIHGF  112



>gb|KJB11840.1| hypothetical protein B456_002G088900 [Gossypium raimondii]
Length=112

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD++  +PT FDPFAEA E G  G KEYVHIRIQQRNGKKSLTTVQGLR + SY+KILK
Sbjct  1    MVDLDVQIPTTFDPFAEAGEFGGTGTKEYVHIRIQQRNGKKSLTTVQGLRHDLSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             LKK+FCCNGNVV+DKELGK+IQLQGDQRKNVSQFLV+AG+VKKDQIKIHGF
Sbjct  61   SLKKDFCCNGNVVKDKELGKIIQLQGDQRKNVSQFLVNAGIVKKDQIKIHGF  112



>ref|XP_009338696.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009338697.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=112

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +PTAFDPF+EAK++ APGAK+YVHIR+QQRNGKK LTTVQGL+K++ YDKILK
Sbjct  1    MVELDVQIPTAFDPFSEAKDADAPGAKDYVHIRVQQRNGKKCLTTVQGLKKDFIYDKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKKD+IKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDRIKIHGF  112



>ref|XP_003617548.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AET00507.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK47392.1| unknown [Medicago truncatula]
Length=110

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 103/112 (92%), Gaps = 2/112 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVDI+  +P+ FDPFAEAKES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDIQ--IPSTFDPFAEAKESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  58

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVV  K+LGK+IQLQGDQRKNVS FL+ AGLV+KD IKIHGF
Sbjct  59   DLKKEFCCNGNVVNCKDLGKIIQLQGDQRKNVSHFLIHAGLVRKDNIKIHGF  110



>ref|XP_008349901.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_008349902.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=112

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +PTAFDPF+EAK++ APGAKEYVHIR+QQRNGKK LTTVQGL+K++SY KILK
Sbjct  1    MVELDVQIPTAFDPFSEAKDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYXKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK FCCNGNVVQDKELGK+IQLQGDQRKNV QFLV A +VKKDQIKIHGF
Sbjct  61   DLKKVFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>emb|CDY43020.1| BnaA03g11670D [Brassica napus]
Length=112

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFAEA+ES APG KEY+H+RIQQRNGKKSLTTVQGL+K YSY+KILK
Sbjct  1    MVELDIQVPSAFDPFAEAQESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VS FLV  G+ KK+QIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFLVQTGIAKKEQIKIHGF  112



>ref|XP_007020819.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
 gb|EOY12344.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
Length=112

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVDI + +PT FDPFAEA+E G  G KEYVHIRIQQRNGKKSLTTVQGL+++ SY+KILK
Sbjct  1    MVDIGSQIPTTFDPFAEAEEFGGTGTKEYVHIRIQQRNGKKSLTTVQGLKQDLSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             LKK+FCCNGNVV DKELGK+IQLQGDQRKNVSQFLV+AG+VKKDQIKIHGF
Sbjct  61   CLKKDFCCNGNVVNDKELGKIIQLQGDQRKNVSQFLVNAGIVKKDQIKIHGF  112



>ref|XP_006281351.1| hypothetical protein CARUB_v10027407mg [Capsella rubella]
 gb|EOA14249.1| hypothetical protein CARUB_v10027407mg [Capsella rubella]
Length=112

 Score =   193 bits (490),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+A+DPFAEA +S APG KE +HIRIQQRNGKKSLTTVQGL+KEYSY++ILK
Sbjct  1    MVELDIQIPSAYDPFAEAIDSDAPGTKENIHIRIQQRNGKKSLTTVQGLKKEYSYERILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDKELGK+IQLQGDQRK VSQFLV +GL KKDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQSGLAKKDQIKIHGF  112



>ref|XP_004294387.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=112

 Score =   192 bits (488),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  + TAFDPFAEA+++ APGAKEYVHIR+QQRNGKK LTTVQGL+K++SY+KILK
Sbjct  1    MVELDVVITTAFDPFAEARDADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVVQDKELGK+IQLQGDQRKNV QFL+ A +VKK+QIKIHGF
Sbjct  61   DLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLIQARIVKKEQIKIHGF  112



>gb|EEC79466.1| hypothetical protein OsI_20483 [Oryza sativa Indica Group]
 gb|EEE64240.1| hypothetical protein OsJ_19073 [Oryza sativa Japonica Group]
Length=213

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = +3

Query  6    LPSTLSSSLVKVSDRSDSFLHQASYMVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHI  176
            LP   S SL+     +     Q S+M D++  LP+AFDPFAEA  ++SGA PGAK+YVH+
Sbjct  78   LPRPTSKSLICPVPTN----QQTSFMSDLDVQLPSAFDPFAEANAEDSGAGPGAKDYVHV  133

Query  177  RIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNV  356
            RIQQRNG+KSLTTVQGL+KEYSY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV
Sbjct  134  RIQQRNGRKSLTTVQGLKKEYSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV  193

Query  357  SQFLVSAGLVKKDQIKIHGF  416
            + FLV AG+ KKD IKIHGF
Sbjct  194  ATFLVQAGIAKKDNIKIHGF  213



>ref|XP_010276095.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPF EAK+SGAPGAKEYVHIRIQQRNGKKSLTTVQGL+K +SY+KILK
Sbjct  1    MVELDIQIPSAFDPFFEAKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKTFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKEL-GKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNG VV D+EL GKVIQLQGDQRKNVS FLV AG+VKK+QIKIHGF
Sbjct  61   DLKKEFCCNGTVVPDEELGGKVIQLQGDQRKNVSNFLVKAGIVKKEQIKIHGF  113



>gb|ABQ42057.1| putative translation factor [Sonneratia alba]
 gb|ABQ42059.1| putative translation factor [Sonneratia ovata]
 gb|ABQ42060.1| putative translation factor [Sonneratia apetala]
Length=114

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +3

Query  78   YMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            +MVD++A +PTAFDPFA+A  E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    FMVDLDAQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD+IKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDRIKIHGF  114



>gb|KHN11920.1| Protein translation factor SUI1-like protein [Glycine soja]
Length=114

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 105/114 (92%), Gaps = 2/114 (2%)
 Frame = +3

Query  81   MVDIEAH-LPTA-FDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            MV++  + +PT+ FDPFAEAKE+ APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KI
Sbjct  1    MVEVGIYQIPTSTFDPFAEAKETDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNGNVV DKELGK+IQLQGDQRKNVS FL+ A LV+KDQIKIHGF
Sbjct  61   LKDLKKEFCCNGNVVHDKELGKIIQLQGDQRKNVSHFLIHARLVRKDQIKIHGF  114



>ref|XP_008365050.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=113

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  93   EAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKK  272
            +  +PTAFDPFAEAK++ APGAKEYVH+R+QQRNGKK LTTVQGL+K+++YDKILKDLKK
Sbjct  6    DXQIPTAFDPFAEAKDADAPGAKEYVHVRVQQRNGKKCLTTVQGLKKDFNYDKILKDLKK  65

Query  273  EFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            EFCCNGNVVQDKELGK+IQLQGDQRK V QFLV A +VKKDQIKIHGF
Sbjct  66   EFCCNGNVVQDKELGKIIQLQGDQRKKVLQFLVQAKIVKKDQIKIHGF  113



>gb|AAM77753.1|AF521961_1 translation initiation factor B04 [Helianthus annuus]
Length=114

 Score =   191 bits (484),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKE--SGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            MVDIE  +P+AFDPFA+ ++   G  G KEYVHIRIQQRNG+KSLTTVQGL+KE SYDKI
Sbjct  1    MVDIEVQIPSAFDPFADVEQDSGGGAGVKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQDKELGKVIQLQGDQRKNVS FL  AG+VKKDQIKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDKELGKVIQLQGDQRKNVSAFLSRAGIVKKDQIKIHGF  114



>gb|KJB62620.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
 gb|KJB62622.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
Length=113

 Score =   191 bits (484),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++ H+PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIHIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELGKVIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF  113



>ref|XP_007142286.1| hypothetical protein PHAVU_008G267800g [Phaseolus vulgaris]
 gb|ESW14280.1| hypothetical protein PHAVU_008G267800g [Phaseolus vulgaris]
Length=114

 Score =   190 bits (482),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  108  TAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCN  287
             +FDPFAEA +  APGAKEYVHIRIQQRNGKKSLTTVQGLRKE+SY+KILKDLKKEFCCN
Sbjct  12   NSFDPFAEATDRDAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKILKDLKKEFCCN  71

Query  288  GNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            GNVV DKELGK+IQLQGDQRKNVS FL+ AGLV+KDQIKIHGF
Sbjct  72   GNVVHDKELGKIIQLQGDQRKNVSHFLIQAGLVRKDQIKIHGF  114



>gb|ABQ42058.1| putative translation factor [Sonneratia caseolaris]
Length=114

 Score =   190 bits (482),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +3

Query  78   YMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            +MVD++A +PTAFDPFA+A  E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    FMVDLDAQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK++IKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKERIKIHGF  114



>ref|XP_006413104.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
 gb|ESQ54557.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
Length=256

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 114/140 (81%), Gaps = 10/140 (7%)
 Frame = +3

Query  3    LLPSTLSSSLVKVSDRSDSFLHQASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHI  176
            L  S LS S+V  SD       Q S+M ++++ +PTAFDPFA+A  ++SGA G KEYVHI
Sbjct  125  LFESGLSFSVVCPSD-------QQSFMSELDSQVPTAFDPFADANAEDSGA-GTKEYVHI  176

Query  177  RIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNV  356
            R+QQRNG+KSLTTVQGL+KEYSY KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV
Sbjct  177  RVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNV  236

Query  357  SQFLVSAGLVKKDQIKIHGF  416
            S FLV AGLVKKD IKIHGF
Sbjct  237  STFLVQAGLVKKDNIKIHGF  256



>ref|XP_009120023.1| PREDICTED: protein translation factor SUI1 homolog [Brassica 
rapa]
Length=112

 Score =   189 bits (481),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P A+DPFAEA+++ APG KEY+H+RIQQRNGKKSLTTVQGL+KEYSY+KILK
Sbjct  1    MVELDIQVPLAYDPFAEAQDTDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKEYSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKK+FCCNGNVVQDK LGK+IQLQGDQRK VS FLV  G+ KKDQIKIHGF
Sbjct  61   DLKKDFCCNGNVVQDKVLGKIIQLQGDQRKKVSHFLVQTGIAKKDQIKIHGF  112



>emb|CDY17292.1| BnaA10g09260D [Brassica napus]
Length=232

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +3

Query  78   YMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            YMV+++  +P A+DPFAEA+++ APG KEY+H+RIQQRNGKKSLTTVQGL+KEYSY+KIL
Sbjct  120  YMVELDIQVPLAYDPFAEAQDTDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKEYSYEKIL  179

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKK+FCCNGNVVQDK LGK+IQLQGDQRK VS FLV  G+ KKDQIKIHGF
Sbjct  180  KDLKKDFCCNGNVVQDKVLGKIIQLQGDQRKKVSHFLVQTGIAKKDQIKIHGF  232



>ref|XP_006304318.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
 ref|XP_010462345.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 ref|XP_010480023.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 gb|EOA37216.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
Length=113

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D+E  +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>gb|AFD22856.1| eukaryotic translation initiation factor SUI1-like protein [Tamarix 
androssowii]
Length=113

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDP-FAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            MVD++  +PTAFDP FA+AK++ APG KEYVHIRIQQRNG+KSLTTVQGL+K++SY+KIL
Sbjct  1    MVDLQVQIPTAFDPGFADAKDTDAPGVKEYVHIRIQQRNGRKSLTTVQGLKKDFSYEKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLK+EFCCNGNVVQDKE GK+IQLQGDQRK V+Q LV AG+ KKDQIKIHGF
Sbjct  61   KDLKREFCCNGNVVQDKESGKIIQLQGDQRKKVAQSLVQAGITKKDQIKIHGF  113



>ref|NP_175831.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 ref|XP_002894486.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006392693.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
 sp|Q94JV4.1|SUI12_ARATH RecName: Full=Protein translation factor SUI1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAD25609.1|AC005287_11 translation initiation factor [Arabidopsis thaliana]
 gb|AAK49626.1|AF372910_1 At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|AAN18215.1| At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|EFH70745.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE33076.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 gb|ESQ29979.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
Length=113

 Score =   188 bits (478),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D+E  +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_009378877.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Pyrus 
x bretschneideri]
Length=113

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M DI+  LPTAFDPFAEA  ++SGA G KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDIDVQLPTAFDPFAEATAEDSGA-GTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_008365631.1| PREDICTED: protein translation factor SUI1 homolog 2 [Malus domestica]
 ref|XP_009358111.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
 ref|XP_009345194.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
Length=113

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M DI+  LPTAFDPFAEA  ++SGA G KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDIDVQLPTAFDPFAEATAEDSGA-GTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>emb|CDY46663.1| BnaA03g48450D [Brassica napus]
Length=196

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  69   QASYMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSY  245
            Q S+M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY
Sbjct  80   QQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSY  139

Query  246  DKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  140  SKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  196



>gb|KHG12156.1| hypothetical protein F383_20129 [Gossypium arboreum]
Length=113

 Score =   188 bits (477),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELGKVIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF  113



>gb|AFW78548.1| LOW QUALITY PROTEIN: protein translation factor SUI1 [Zea mays]
Length=185

 Score =   190 bits (482),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 3/119 (3%)
 Frame = +3

Query  69   QASYMVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEY  239
            Q S+M D++  LP+AFDPFAEA  ++SGA PG K+YVH+RIQQRNG+KSLTTVQGL+KE+
Sbjct  67   QPSFMSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEF  126

Query  240  SYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK+ IKIHGF
Sbjct  127  SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKENIKIHGF  185



>ref|XP_002522857.1| translation factor sui1, putative [Ricinus communis]
 gb|EEF39555.1| translation factor sui1, putative [Ricinus communis]
Length=138

 Score =   188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = +3

Query  60   FLHQASYMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE  236
            F  Q S+M ++E+ +PT FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE
Sbjct  19   FTDQLSFMSELESQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKE  78

Query  237  YSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            +SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL  AG+VKK+ IKIHGF
Sbjct  79   FSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLTGAGIVKKENIKIHGF  138



>ref|NP_001055949.1| Os05g0498400 [Oryza sativa Japonica Group]
 ref|XP_006654596.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 gb|AAT44286.1| putative protein translation factor Sui1 [Oryza sativa Japonica 
Group]
 dbj|BAF17863.1| Os05g0498400 [Oryza sativa Japonica Group]
 dbj|BAG91879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score =   187 bits (475),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 103/115 (90%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA  ++SGA PGAK+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KKD IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKDNIKIHGF  115



>emb|CDX92777.1| BnaC07g40350D [Brassica napus]
Length=203

 Score =   190 bits (483),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  69   QASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYS  242
            Q S+M ++++ +PTAFDPFA+A  ++SGA G KEYVHIR+QQRNG+KSLTTVQGL+KEYS
Sbjct  87   QQSFMSELDSQVPTAFDPFADANAEDSGA-GTKEYVHIRVQQRNGRKSLTTVQGLKKEYS  145

Query  243  YDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            Y KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  146  YSKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  203



>ref|XP_009417250.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   187 bits (475),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++ H+PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVHIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG++KK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIIKKEHIKIHGF  113



>ref|XP_010278682.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278683.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278684.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   187 bits (475),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +P+AFDPFAEAK+SG PG KEYVHIRIQQRNGKK LTTVQGL+KE+SY+KILK
Sbjct  1    MVELDVQIPSAFDPFAEAKDSGVPGVKEYVHIRIQQRNGKKCLTTVQGLKKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKEL-GKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            +LKKEFCCNG +V D+EL GKVIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   NLKKEFCCNGTIVPDEELGGKVIQLQGDQRKNVSNFLVKAGIVKKEHIKIHGF  113



>ref|XP_010501111.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Camelina 
sativa]
Length=113

 Score =   187 bits (475),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D+E  +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDVGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_009106912.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 ref|XP_009107080.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 emb|CDY08224.1| BnaA05g13950D [Brassica napus]
Length=115

 Score =   187 bits (474),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 101/115 (88%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D+E  +PTAFDPFA+A  +++GA  G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  115



>gb|EEE67305.1| hypothetical protein OsJ_24532 [Oryza sativa Japonica Group]
Length=230

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 3/121 (2%)
 Frame = +3

Query  63   LHQASYMVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRK  233
             HQ S+M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+K
Sbjct  110  FHQQSFMSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKK  169

Query  234  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHG  413
            E+SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHG
Sbjct  170  EFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHG  229

Query  414  F  416
            F
Sbjct  230  F  230



>ref|XP_010539284.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
 ref|XP_010539285.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
Length=113

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  LPT FDPFA+A  E    G+KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLDTQLPTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_010232448.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Brachypodium distachyon]
Length=143

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 3/120 (3%)
 Frame = +3

Query  66   HQASYMVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE  236
             Q S+M D++  LP+AFDPFAEA     S   G+K+YVH+R+QQRNG+KSLTTVQGL+KE
Sbjct  24   QQPSFMSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKE  83

Query  237  YSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            YSY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AGL KK+ IKIHGF
Sbjct  84   YSYNKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  143



>ref|XP_006279715.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
 gb|EOA12613.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
Length=113

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E  + G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSSAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_011011189.1| PREDICTED: protein translation factor SUI1 homolog 2 [Populus 
euphratica]
Length=112

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV +E  +P+AFDPFA+AK+SG  G KEYVHIRIQQRNGKKSLTTVQGL KE SY+ ILK
Sbjct  1    MVGLEFEIPSAFDPFADAKQSGGAGTKEYVHIRIQQRNGKKSLTTVQGLPKELSYETILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             LKK+FCCNGNVVQDKELGKVIQLQGDQRKNV  FLV+  +VKKDQIKIHGF
Sbjct  61   TLKKDFCCNGNVVQDKELGKVIQLQGDQRKNVQNFLVNQNIVKKDQIKIHGF  112



>gb|AFK35113.1| unknown [Lotus japonicus]
 gb|AFK48780.1| unknown [Lotus japonicus]
Length=114

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 2/114 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M +++A +PTAFDPFAEA  ++SGA  +KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAAIPTAFDPFAEANAEDSGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  114



>gb|AFK48465.1| unknown [Lotus japonicus]
Length=116

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 4/116 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGA--KEYVHIRIQQRNGKKSLTTVQGLRKEYSYD  248
            M +++A +PTAFDPFAEA   ESGA GA  K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+
Sbjct  1    MSELDAQIPTAFDPFAEANVDESGAGGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  60

Query  249  KILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  116



>ref|XP_010448172.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=113

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_008784556.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=113

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D+ A LPT FDPFAEA  E    GAKEYVH+R QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLNAQLPTTFDPFAEANAEDSGAGAKEYVHVRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+QIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEQIKIHGF  113



>ref|XP_002867520.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009143120.1| PREDICTED: protein translation factor SUI1 homolog 1 [Brassica 
rapa]
 gb|EFH43779.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CDY29277.1| BnaC01g19290D [Brassica napus]
 emb|CDX89276.1| BnaA01g16170D [Brassica napus]
Length=113

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|NP_194443.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 ref|XP_010448590.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010443052.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010482884.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 sp|P41568.2|SUI11_ARATH RecName: Full=Protein translation factor SUI1 homolog 1 [Arabidopsis 
thaliana]
 gb|AAB68033.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB38843.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB79568.1| translation initiation factor [Arabidopsis thaliana]
 gb|AAK59834.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAL31168.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAM65827.1| translation initiation factor [Arabidopsis thaliana]
 gb|AEE85305.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 emb|CDY14282.1| BnaA08g14130D [Brassica napus]
 emb|CDX97378.1| BnaC08g12430D [Brassica napus]
Length=113

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>gb|AFK48865.1| unknown [Lotus japonicus]
Length=116

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 4/116 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGA--KEYVHIRIQQRNGKKSLTTVQGLRKEYSYD  248
            M +++A +PTAFDPFAEA   ESGA GA  K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+
Sbjct  1    MSELDAQIPTAFDPFAEANVDESGAGGAGIKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  60

Query  249  KILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  116



>gb|KHN46541.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=155

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 3/120 (3%)
 Frame = +3

Query  63   LHQASYMVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKE  236
            L ++S+M +++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE
Sbjct  37   LSESSFMSELDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKE  95

Query  237  YSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            +SY+KILKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  96   FSYNKILKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  155



>ref|NP_200287.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001119436.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001190540.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|XP_002864353.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010433396.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 ref|XP_010438654.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 dbj|BAB08755.1| protein translation factor Sui1 homolog [Arabidopsis thaliana]
 gb|AAO64771.1| At5g54760 [Arabidopsis thaliana]
 gb|EFH40612.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96536.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96537.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96538.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=113

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_010542418.1| PREDICTED: protein translation factor SUI1 homolog 1 [Tarenaya 
hassleriana]
Length=113

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D+++ +PT FDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSDLDSQIPTTFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>emb|CDY26128.1| BnaC06g10680D [Brassica napus]
 emb|CDY08222.1| BnaA05g13970D [Brassica napus]
Length=115

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D+E  +PTAFDPFA+A  +++GA  G KEYVHIR+QQRNG+KSLTTVQG++KEYSY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGIKKEYSYTK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AGLVKKD IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLIQAGLVKKDNIKIHGF  115



>gb|KHN38274.1| Protein translation factor SUI1 like [Glycine soja]
Length=114

 Score =   185 bits (470),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 2/114 (2%)
 Frame = +3

Query  81   MVDIEAH-LPTA-FDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            MV++  + +PT+  DPFAEAKE+ APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KI
Sbjct  1    MVEVGIYQIPTSSLDPFAEAKETDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKE CCNGNVV DKELGK+IQLQGDQRKNVS FL+ A L +KDQIKIHGF
Sbjct  61   LKDLKKELCCNGNVVHDKELGKIIQLQGDQRKNVSHFLIHARLARKDQIKIHGF  114



>gb|KDP39065.1| hypothetical protein JCGZ_00822 [Jatropha curcas]
Length=113

 Score =   185 bits (470),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++EA +PT FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELEAQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_007216425.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
 gb|EMJ17624.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
Length=170

 Score =   187 bits (475),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 107/121 (88%), Gaps = 3/121 (2%)
 Frame = +3

Query  60   FLHQASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRK  233
            FL Q+S+M + +  +P+AFDPFA+A  ++SGA G KEYVH+R+QQRNG+KSLTTVQGL+K
Sbjct  51   FLQQSSFMSEFDTQVPSAFDPFADANAEDSGA-GTKEYVHVRVQQRNGRKSLTTVQGLKK  109

Query  234  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHG  413
            EYSY+KILKDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK+ IK+HG
Sbjct  110  EYSYNKILKDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEDIKLHG  169

Query  414  F  416
            F
Sbjct  170  F  170



>gb|KHG23747.1| hypothetical protein F383_10557 [Gossypium arboreum]
 gb|KJB45588.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45589.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45590.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB78391.1| hypothetical protein B456_013G163400 [Gossypium raimondii]
Length=113

 Score =   185 bits (470),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|KJB62619.1| hypothetical protein B456_009G426400 [Gossypium raimondii]
Length=213

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = +3

Query  75   SYMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            S+M D++  +PTAFDPFA+A  E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+K
Sbjct  99   SFMSDLDVQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  158

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  159  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  213



>gb|KJB13596.1| hypothetical protein B456_002G083300 [Gossypium raimondii]
Length=113

 Score =   185 bits (469),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_007213988.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
 gb|EMJ15187.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
Length=113

 Score =   185 bits (469),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PTAFDPFAEA  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_011096112.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011096113.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   185 bits (469),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D +  +P+AFDPFAEAK E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDVQIPSAFDPFAEAKAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_010545205.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
 ref|XP_010545206.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
Length=113

 Score =   185 bits (469),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +I+  +PT FDPFA+A  E    G+KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEIDTQIPTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>gb|KHG06773.1| hypothetical protein F383_09794 [Gossypium arboreum]
Length=113

 Score =   185 bits (469),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAF+PFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTAFNPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_008244365.1| PREDICTED: protein translation factor SUI1 homolog 2 [Prunus 
mume]
Length=113

 Score =   184 bits (468),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PTAFDPFAEA  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLIQAGIVKKDNIKIHGF  113



>ref|NP_001150984.1| GOS2 homolog [Zea mays]
 gb|ACG41169.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48501.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA57283.1| TPA: protein translation factor SUI1 isoform 1 [Zea mays]
 tpg|DAA57284.1| TPA: protein translation factor SUI1 isoform 2 [Zea mays]
Length=115

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKKD IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKDSIKIHGF  115



>ref|XP_010930963.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D++  +PTAFDPFAEA   +SGA GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLDVQIPTAFDPFAEANADDSGA-GAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_010062975.1| PREDICTED: protein translation factor SUI1 homolog 2 [Eucalyptus 
grandis]
Length=113

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++A +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDAQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>sp|Q9SQF4.1|SUI1_BRAOL RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Translation initiation factor nps45 [Brassica oleracea]
 gb|AAF04624.1|AF098672_1 translation initiation factor nps45 [Brassica oleracea]
Length=113

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD I+IHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDDIQIHGF  113



>gb|KHG30632.1| hypothetical protein F383_00215 [Gossypium arboreum]
Length=113

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E    GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|EYU27827.1| hypothetical protein MIMGU_mgv1a016640mg [Erythranthe guttata]
Length=113

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +P+ FDPFAEAK E    G+KEYVHIRIQQRNG+KSLTTVQGL+KE+SY KIL
Sbjct  1    MSDLDTQIPSPFDPFAEAKAEDSGVGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>ref|XP_007021029.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
 gb|EOY12554.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
Length=113

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKK FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKVFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|ADV04053.1| eukaryotic translation initiation factor 2 [Hevea brasiliensis]
Length=113

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++E  +PT FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELETQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_006284787.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
 gb|EOA17685.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
Length=113

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV A LVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQASLVKKDNIKIHGF  113



>ref|XP_009109147.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+K+YSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVQGLKKDYSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_009137639.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++++ +PTAFDPFA+A  E    G KEYVHIR+QQRNG+KSLTTV+GL+KEYSY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVKGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AGLVKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_008803218.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PT FDPFAEA  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTTFDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_010931827.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D+   LPT FDPFAEA   +SGA GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLNVQLPTTFDPFAEANADDSGA-GAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>gb|KJB81730.1| hypothetical protein B456_013G159400 [Gossypium raimondii]
 gb|KJB81731.1| hypothetical protein B456_013G159400 [Gossypium raimondii]
Length=112

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MV+++  +PT FDPFAEA+E G+ G K+YVHIRIQQRNG+KSLTTV+GL++E S DKILK
Sbjct  1    MVELDIQIPTTFDPFAEAEEFGSTGTKDYVHIRIQQRNGRKSLTTVEGLKQELSSDKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             LKKEFCCNGNVV DKELGK+IQLQGDQRK V+ FLV+AG+VKK+QIKIHGF
Sbjct  61   SLKKEFCCNGNVVHDKELGKIIQLQGDQRKKVAHFLVNAGIVKKEQIKIHGF  112



>ref|XP_011097918.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E+   GAK+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQVPTAFDPFADANAENSGAGAKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_009594373.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009594374.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
Length=113

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++A +PTAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDAQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_002281872.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI23936.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PTAFDPFAEA  E    G+K+YVHIRIQQRNG+KSLTTVQGLRKE+SY+KIL
Sbjct  1    MSELDIQIPTAFDPFAEANAEDSGAGSKDYVHIRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEDIKIHGF  113



>gb|KHG06771.1| hypothetical protein F383_09792 [Gossypium arboreum]
 gb|KJB11988.1| hypothetical protein B456_002G083600 [Gossypium raimondii]
Length=113

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E    GAK+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_009774027.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009774028.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++A +PTAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDAQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKKEHIKIHGF  113



>ref|XP_004294347.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PTAFDPFAEA  E    G KEYVHIR+QQRNG+KSLTTVQGL+K++SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_009388867.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D++  +PT FDPFA+A   +SGA GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLDVQIPTTFDPFADANADDSGA-GAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLK+EFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK++IKIHGF
Sbjct  60   LKDLKREFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKERIKIHGF  113



>ref|XP_007132953.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
 gb|ESW04947.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
Length=113

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 103/114 (90%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M +++A +PTAFDPFAEA   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTAFDPFAEANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_004244151.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
 ref|XP_004244152.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_002458630.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
 gb|EES03750.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
Length=115

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVEAGIVKKESIKIHGF  115



>ref|XP_007132952.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
 gb|ESW04946.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
Length=113

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 103/114 (90%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M +++A +PTAFDPFAEA   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTAFDPFAEANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKKEHIKIHGF  113



>emb|CAC84489.1| putative translation factor [Pinus pinaster]
 gb|ABK20970.1| unknown [Picea sitchensis]
 gb|ABK22220.1| unknown [Picea sitchensis]
 gb|ABK23355.1| unknown [Picea sitchensis]
 gb|ABK26752.1| unknown [Picea sitchensis]
 gb|ABR16497.1| unknown [Picea sitchensis]
 gb|ABR18467.1| unknown [Picea sitchensis]
 gb|ACN39759.1| unknown [Picea sitchensis]
 gb|ACN40001.1| unknown [Picea sitchensis]
 gb|ACN40379.1| unknown [Picea sitchensis]
 gb|ACN40927.1| unknown [Picea sitchensis]
Length=113

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +P A+DPFA+A  E    G+KEYVH+RIQQRNG+KSLTTVQGLRKE+SY+KIL
Sbjct  1    MSDLDVQIPGAYDPFADANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKDNIKIHGF  113



>ref|NP_001152681.1| LOC100286322 [Zea mays]
 ref|XP_002440017.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 ref|XP_004961618.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
 ref|XP_008647991.1| PREDICTED: LOC100286322 isoform X1 [Zea mays]
 gb|ACF83099.1| unknown [Zea mays]
 gb|ACG26980.1| protein translation factor SUI1 [Zea mays]
 gb|ACG32428.1| protein translation factor SUI1 [Zea mays]
 gb|ACG47286.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48899.1| protein translation factor SUI1 [Zea mays]
 gb|ACN35402.1| unknown [Zea mays]
 gb|EES18447.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 gb|AFW78549.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   182 bits (463),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA  ++SGA PG K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKENIKIHGF  115



>ref|XP_007215170.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
 ref|XP_008230362.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Prunus 
mume]
 gb|EMJ16369.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
Length=113

 Score =   182 bits (463),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PTAFDPFAEA  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_002532561.1| translation factor sui1, putative [Ricinus communis]
 gb|EEF29822.1| translation factor sui1, putative [Ricinus communis]
Length=109

 Score =   182 bits (462),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E  +PTAFDPF+EAK+SGA   K+YVHIRI QRNGKK+LTTVQGL KEYS +KILK
Sbjct  1    MVDLEVQIPTAFDPFSEAKDSGA---KDYVHIRIYQRNGKKNLTTVQGLPKEYSLEKILK  57

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             LKKEFCCNGNVVQDK+LGK+IQLQGDQRKNV  FLVSA LV+KD IKIHGF
Sbjct  58   SLKKEFCCNGNVVQDKDLGKIIQLQGDQRKNVQSFLVSANLVRKDLIKIHGF  109



>ref|XP_006370639.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 ref|XP_006370640.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
 gb|ABK94414.1| unknown [Populus trichocarpa]
 gb|ERP67208.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 gb|ERP67209.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
Length=113

 Score =   182 bits (462),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++   PTAFDPFA+A  E    GAKEYVHIR QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_003564393.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Brachypodium distachyon]
Length=115

 Score =   182 bits (463),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA     S   G+K+YVH+R+QQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AGL KK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  115



>gb|ADV04054.1| eukaryotic translation initiation factor 3 [Hevea brasiliensis]
Length=113

 Score =   182 bits (462),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++E  +P+ FDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELETQIPSTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKIHGF  113



>emb|CDY10602.1| BnaC03g70120D [Brassica napus]
 emb|CDY02466.1| BnaA08g00730D [Brassica napus]
Length=116

 Score =   182 bits (462),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 4/116 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D+E  +PTAFDPFA+A  +++GA  G KEYVHIR+QQRNG+KSLTTVQGL+KEYSY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV-SAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  AGLVKKD IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQQAGLVKKDNIKIHGF  116



>gb|KHG11307.1| hypothetical protein F383_12372 [Gossypium arboreum]
Length=113

 Score =   182 bits (462),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDILIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGIVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_002280157.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 ref|XP_003633291.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 emb|CBI28951.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   182 bits (461),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++A++PT FDPFA+A  E    G KEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDANIPTTFDPFADANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_004957905.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
 ref|XP_004957906.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   182 bits (462),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDVQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|NP_001059843.1| Os07g0529800 [Oryza sativa Japonica Group]
 sp|Q0D5W6.1|SUI1_ORYSJ RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Japonica Group]
 sp|A6MZM2.1|SUI1_ORYSI RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Indica Group]
 gb|AAK56324.1|AF380357_1 translational initiation factor eIF1 [Oryza coarctata]
 emb|CAA36190.1| GOS2 [Oryza sativa Indica Group]
 gb|AAC67556.1| translation initiation factor [Oryza sativa Japonica Group]
 dbj|BAC45143.1| translational initiation factor eIF1 [Oryza sativa Japonica Group]
 dbj|BAF21757.1| Os07g0529800 [Oryza sativa Japonica Group]
 gb|ABR25442.1| putative protein translation factor sui1 [Oryza sativa Indica 
Group]
 gb|ABR26117.1| protein translation factor sui1 [Oryza sativa Indica Group]
 gb|ACJ09228.1| translation initiation factor eIF1 [Oryza sativa Indica Group]
 dbj|BAH00131.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71284.1| protein translation factor SUI 1 [Oryza sativa Japonica Group]
Length=115

 Score =   182 bits (461),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_011048301.1| PREDICTED: protein translation factor SUI1 homolog 2 [Populus 
euphratica]
Length=113

 Score =   182 bits (461),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++   PTAFDPFA+A  E    GAKEYVHIR QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_003596650.1| Translation factor Sui1-like protein [Medicago truncatula]
 gb|AES66901.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK43860.1| unknown [Medicago truncatula]
Length=114

 Score =   182 bits (461),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 2/114 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M +++A +PTA+DPFAEA  +++GA  +KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  114



>ref|XP_007132567.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
 gb|ESW04561.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
Length=113

 Score =   182 bits (461),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + E ++P+AFDPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFETNIPSAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKLHGF  113



>ref|XP_009401666.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   182 bits (461),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  LPTAFDPFAEA  +    GAKEYVH+R+QQRNG+K LTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDVQLPTAFDPFAEANADDSGVGAKEYVHVRVQQRNGRKCLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_009408662.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408663.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   182 bits (461),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D+EA +P+AFDPFA+A   +SGA G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLEAQIPSAFDPFADANADDSGA-GTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKN S FLV AG+VKK+ IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNASNFLVQAGIVKKEHIKIHGF  113



>gb|EPS65463.1| hypothetical protein M569_09315 [Genlisea aurea]
Length=113

 Score =   182 bits (461),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++   P +FDPFA+A  E+  PG+K+Y+HIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIETPISFDPFADANAENSGPGSKDYIHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|KHG17081.1| Protein translation factor SUI1 [Gossypium arboreum]
Length=164

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  78   YMVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            YMV++   +PT FDPFAEA+E G  G K+YVHIRIQQRNG+KSLTTV+GL++E S DKIL
Sbjct  52   YMVELGIQIPTTFDPFAEAEEFGRTGTKDYVHIRIQQRNGRKSLTTVEGLKQELSSDKIL  111

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            K LKKEFCCNGNVV DKELGK+IQLQGDQRK V+ FLV+AG+VKK+QIKIHGF
Sbjct  112  KSLKKEFCCNGNVVHDKELGKIIQLQGDQRKKVAHFLVNAGIVKKEQIKIHGF  164



>ref|NP_001239651.1| uncharacterized protein LOC100784390 [Glycine max]
 ref|XP_006591863.1| PREDICTED: uncharacterized protein LOC100784390 isoform X1 [Glycine 
max]
 gb|ACU18971.1| unknown [Glycine max]
 gb|KHN22844.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + + ++PTAFDPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPTAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKLHGF  113



>ref|XP_010035571.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 ref|XP_010035572.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 gb|KCW46998.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=113

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PT FDPFA+AK E    G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQVPTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKERIKIHGF  113



>ref|XP_003568176.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA  +++GA PGAK+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDVTLPSAFDPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKELIKIHGF  115



>ref|XP_008809850.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D++  +PTA+DPFAEA   +SGA G+KEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLDVQIPTAYDPFAEANAGDSGA-GSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_010909791.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D+   LPTAFD FAEA  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY KIL
Sbjct  1    MSDLNVQLPTAFDSFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>sp|O82569.1|SUI1_PIMBR RecName: Full=Protein translation factor SUI1 homolog [Spuriopimpinella 
brachycarpa]
 gb|AAC61599.1| protein translation factor SUI1 homolog [Spuriopimpinella brachycarpa]
Length=113

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGA-KEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            MVD +  +PT+FDPFAEA+ + A G+ KEYVHIRIQQRNG+KSLTTVQGL+KE SYDKIL
Sbjct  1    MVDSDIQIPTSFDPFAEAEITDATGSTKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKK  CCNG VV DKELGKVIQLQGDQRKNVS F+V AG+VKKDQIK+H F
Sbjct  61   KDLKKALCCNGTVVNDKELGKVIQLQGDQRKNVSTFIVQAGIVKKDQIKVHNF  113



>ref|XP_006363526.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Solanum 
tuberosum]
Length=113

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +P AFDPFAEA  E+   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLQVPNAFDPFAEANAENSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGVVKKEHIKIHGF  113



>ref|NP_001104887.1| protein translation factor SUI1 homolog [Zea mays]
 ref|XP_006657782.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 ref|XP_006659299.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 sp|P56330.1|SUI1_MAIZE RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2 [Zea mays]
 gb|AAB88615.1| translation initiation factor [Zea mays]
 gb|ACF80856.1| unknown [Zea mays]
 gb|ACG27240.1| protein translation factor SUI1 [Zea mays]
 gb|ACG28108.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30000.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30907.1| protein translation factor SUI1 [Zea mays]
 gb|ACG37835.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA62967.1| TPA: translation initiation factor1 [Zea mays]
Length=115

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_009397784.1| PREDICTED: protein translation factor SUI1 homolog 2 [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D+   +PTAFDPFA+A  E    G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLNVQIPTAFDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>gb|AFC01199.1| eukaryotic translation initiation factor [Ammopiptanthus mongolicus]
Length=113

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + + ++PT FDPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPTTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_009412007.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412008.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D++  LPTAFDPFAEA   +SGA GAKEYVH+R+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSDLDVQLPTAFDPFAEANADDSGA-GAKEYVHVRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL   G+VKK+ IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLSQTGIVKKEYIKIHGF  113



>ref|XP_004234488.1| PREDICTED: protein translation factor SUI1 homolog 1 [Solanum 
lycopersicum]
 ref|XP_006343300.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Solanum 
tuberosum]
Length=113

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M +++  +PT FDPFA+A  + SGA GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDIQVPTTFDPFADANAQNSGA-GAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKDNIKIHGF  113



>ref|NP_001044504.2| Os01g0794500 [Oryza sativa Japonica Group]
 dbj|BAD53005.1| putative translation initiation factor [Oryza sativa Japonica 
Group]
 gb|EEC71629.1| hypothetical protein OsI_04056 [Oryza sativa Indica Group]
 dbj|BAF06418.2| Os01g0794500 [Oryza sativa Japonica Group]
Length=115

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKESIKIHGF  115



>ref|XP_010240920.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PT FDPFAEA  E    G+KEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDIQIPTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_004159225.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis sativus]
Length=177

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 3/122 (2%)
 Frame = +3

Query  57   SFLHQASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLR  230
            S+  Q S+M +    +P+AFDPFA+A  ++SGA GAKEYVH+RIQQRNG+KS TTVQGL+
Sbjct  57   SYSGQPSFMSEFNVQIPSAFDPFADANAEDSGA-GAKEYVHVRIQQRNGRKSPTTVQGLK  115

Query  231  KEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIH  410
            KE+SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIH
Sbjct  116  KEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIH  175

Query  411  GF  416
            GF
Sbjct  176  GF  177



>sp|Q9SM41.1|SUI1_SPOST RecName: Full=Protein translation factor SUI1 homolog [Sporobolus 
stapfianus]
 emb|CAB61837.1| putative translation initiation factor eIF-1 [Sporobolus stapfianus]
Length=115

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  +PTAFDPF+EA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+K
Sbjct  1    MSDLDIQIPTAFDPFSEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_004970238.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA     S   G+KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FL  AG+ KK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLTQAGIAKKETIKIHGF  115



>ref|NP_001236633.1| uncharacterized protein LOC100499833 [Glycine max]
 gb|ACU13849.1| unknown [Glycine max]
Length=113

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M +++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>ref|XP_002310460.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_006380311.1| SUI1 family protein [Populus trichocarpa]
 ref|XP_006380312.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_011026342.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 ref|XP_011026343.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 gb|ABK95531.1| unknown [Populus trichocarpa]
 gb|EEE90910.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 gb|ERP58108.1| SUI1 family protein [Populus trichocarpa]
 gb|ERP58109.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
Length=113

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +  +PTAFDPFAEA  E    G K+YVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_004487600.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X2 [Cicer arietinum]
Length=113

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++A +PT FDPFAEA  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDAQIPTTFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FL+ AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQAGIVKKEHIKIHGF  113



>ref|XP_002310461.1| SUI1 family protein [Populus trichocarpa]
 gb|EEE90911.1| SUI1 family protein [Populus trichocarpa]
Length=113

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +  +PTAFDPFAEA  E    G K+YVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKESIKIHGF  113



>gb|EEE55519.1| hypothetical protein OsJ_03741 [Oryza sativa Japonica Group]
Length=165

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 3/121 (2%)
 Frame = +3

Query  63   LHQASYMVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRK  233
            L  A++  D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+K
Sbjct  45   LKLANFRSDLDVQLPSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKK  104

Query  234  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHG  413
            EYSY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHG
Sbjct  105  EYSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKESIKIHG  164

Query  414  F  416
            F
Sbjct  165  F  165



>ref|XP_004144489.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
1 [Cucumis sativus]
 ref|XP_004144490.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
2 [Cucumis sativus]
 ref|XP_008455418.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455419.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455420.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 gb|KGN43535.1| hypothetical protein Csa_7G044260 [Cucumis sativus]
Length=113

 Score =   180 bits (457),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +    +P+AFDPFA+A  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_009800522.1| PREDICTED: protein translation factor SUI1 homolog 2 [Nicotiana 
sylvestris]
Length=113

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M +I+  +PT FDPFA+A  + SGA GAKEYVHIR+QQRNG+KSLTTVQGL++E+SY+KI
Sbjct  1    MSEIDVQIPTNFDPFADANAQNSGA-GAKEYVHIRVQQRNGRKSLTTVQGLKREFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK+ IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKENIKIHGF  113



>gb|ABO15891.1| translation initiation factor eIF1 [synthetic construct]
 gb|ABX61094.1| putative translation initiation factor [Triticum aestivum]
 gb|ADD62702.1| eukaryotic translation initiation factor 1 [Leymus chinensis]
 emb|CDM84532.1| unnamed protein product [Triticum aestivum]
Length=115

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 101/115 (88%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  +PTAFDPFAEA  ++SGA  G+K YVH+R+QQRNG+KSLTTVQGL+K+YSY+K
Sbjct  1    MSDLDVQVPTAFDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AGL KK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  115



>ref|XP_006475205.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO52967.1| hypothetical protein CISIN_1g033711mg [Citrus sinensis]
Length=113

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D +  +P AFDPFA+AK E    G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF  113



>ref|XP_010694233.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=113

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M DI+  +P A+DPFA+A  E+   G+K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDIDVQIPAAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>gb|EYU33614.1| hypothetical protein MIMGU_mgv1a016641mg [Erythranthe guttata]
Length=113

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PT FDPFA+A  E+   G K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTTFDPFADANAENSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_008341842.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_009371031.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009373712.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PTAFDPFAEA  E    G K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSAFLVQAGIVKKDHIKIHGF  113



>ref|XP_004287929.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   180 bits (456),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M ++E  +P+ FDPFA+A  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSELETQVPSTFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKENIKLHGF  113



>ref|XP_010923943.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   179 bits (455),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M  ++  +PTA+DPFAEA  E    GAKEYVH+RIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSGLDIQVPTAYDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_002960838.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
 ref|XP_002983834.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ14846.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ38377.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
Length=114

 Score =   180 bits (456),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M + +  +P A+DPFAEA  +ESG  G+ EYVH+R+QQRNG+KSLTTVQGLRKE++Y+KI
Sbjct  1    MSEADIQIPGAYDPFAEANAEESGGVGSAEYVHVRVQQRNGRKSLTTVQGLRKEFNYNKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD KKEFCCNG VVQD ELG+VIQLQGDQRKNVSQFLV AG+VKKD IKIHGF
Sbjct  61   LKDFKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSQFLVQAGVVKKDLIKIHGF  114



>ref|XP_010267759.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   179 bits (455),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PT FDPFAEA  E    G+KEYVH+RIQQRNG+KSLTTVQGLRKE+SY+KIL
Sbjct  1    MSELDIQIPTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV A +VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQARIVKKEHIKIHGF  113



>ref|XP_004248369.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   179 bits (455),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLQVPAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_002316980.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 ref|XP_006377838.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ABK93182.1| unknown [Populus trichocarpa]
 gb|ABK93949.1| unknown [Populus trichocarpa]
 gb|EEE97592.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ERP55635.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
Length=113

 Score =   179 bits (455),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D +A  P+A+DPFA+A  E    G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDAQTPSAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKESIKIHGF  113



>emb|CDP20340.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   179 bits (454),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M + +   PT FDPFA+A   +SGA GAKEYVH+R+QQRNG+KSLTTVQGLRKEYSY+KI
Sbjct  1    MSEHDIQTPTTFDPFADATADDSGA-GAKEYVHVRVQQRNGRKSLTTVQGLRKEYSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKK+FCCNG VVQD ELGKVIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  60   LKDLKKDFCCNGTVVQDPELGKVIQLQGDQRKNVSAFLVQAGIVKKENIKIHGF  113



>ref|XP_003527319.1| PREDICTED: protein translation factor SUI1 homolog 1 [Glycine 
max]
 gb|KHN46542.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   179 bits (454),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M  ++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSGLDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>ref|XP_008341979.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=113

 Score =   179 bits (454),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +  +P+AFDPFA+A  E+   G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDTQVPSAFDPFADANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_004304159.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PTAFDPFAEA  E    G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSAFLVQAGIVKKENIKIHGF  113



>sp|O48650.1|SUI1_SALBA RecName: Full=Protein translation factor SUI1 homolog [Salix 
bakko]
 dbj|BAA24697.1| SUI1 homolog [Salix bakko]
Length=113

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +  +PTAFDPFAEA  E    G K+YVH+R+QQRNG+KSLTTVQGL+K+YSY+KIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKDYSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKENIKIHGF  113



>ref|XP_011030847.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
Length=113

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D +A  PTA+DPFA+A  E    G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDAQTPTAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  G+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKESIKIHGF  113



>ref|XP_006352492.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=113

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLQVPAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEYIKIHGF  113



>ref|NP_001238017.1| uncharacterized protein LOC100306129 [Glycine max]
 gb|ACU14161.1| unknown [Glycine max]
 gb|KHN47859.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M +++  +PTAFDPFA+A   +SGA G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSELDDQIPTAFDPFADANADDSGA-GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  60   LKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_003527483.1| PREDICTED: protein translation factor SUI1 homolog isoform 1 
[Glycine max]
 ref|XP_003527484.1| PREDICTED: protein translation factor SUI1 homolog isoform 2 
[Glycine max]
Length=113

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + + ++PTAFDPFA+A  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK+ IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLMQAGIVKKEYIKLHGF  113



>gb|ABI48954.1| putative protein translation factor Sui1 [Viola baoshanensis]
Length=113

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D++  +P+AFDPFA+A  ++SGA G K+YVHIRIQQRNG+KSLTTVQGL+K++SY+KI
Sbjct  1    MSDLDIQIPSAFDPFADASTEDSGA-GTKDYVHIRIQQRNGRKSLTTVQGLKKDFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  60   LKDXKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|EPS74118.1| hypothetical protein M569_00639 [Genlisea aurea]
Length=113

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D +  +PT FDPFA+A  E+   G+K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDFDVQIPTTFDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_006447521.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 ref|XP_006469705.1| PREDICTED: protein translation factor SUI1 homolog [Citrus sinensis]
 gb|ESR60761.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 gb|KDO59835.1| hypothetical protein CISIN_1g039810mg [Citrus sinensis]
Length=113

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +  +P+AFDPFAEA  E    G+K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF  113



>gb|KHN41202.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + + ++PTAFDPFA+A  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK+ IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLMQAGIVKKEFIKLHGF  113



>ref|XP_009771770.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009771771.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLQVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  G+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKEHIKIHGF  113



>ref|XP_009342251.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +  +P+AFDPF +A  E+   G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDTQVPSAFDPFTDANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_004515084.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Cicer arietinum]
Length=113

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + + ++P+ FDPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY KIL
Sbjct  1    MSEFDTNIPSTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK+ IK+HGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKLHGF  113



>ref|XP_009603077.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Nicotiana 
tomentosiformis]
Length=113

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M + +  +PT FDPFA+A  + SGA GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KI
Sbjct  1    MSEHDVQIPTTFDPFADANAQNSGA-GAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK+ IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLIQAGIVKKENIKIHGF  113



>ref|XP_008230087.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008230088.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
Length=113

 Score =   177 bits (449),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +  +P+AFDPFA+A  E    G KEYVH+R+QQRNG+KSLTTVQGL+KEYSY+KIL
Sbjct  1    MSEFDTQVPSAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK+ IK+HGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEDIKLHGF  113



>gb|EEC82174.1| hypothetical protein OsI_26284 [Oryza sativa Indica Group]
Length=843

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 3/121 (2%)
 Frame = +3

Query  63   LHQASYMVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRK  233
             HQ S+M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+K
Sbjct  723  FHQQSFMSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKK  782

Query  234  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHG  413
            E+SY+KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHG
Sbjct  783  EFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHG  842

Query  414  F  416
            F
Sbjct  843  F  843



>gb|ACG24808.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 100/115 (87%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEF CNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFYCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_002316065.1| hypothetical protein POPTR_0010s16160g [Populus trichocarpa]
 gb|ABK94563.1| unknown [Populus trichocarpa]
 gb|EEF02236.1| hypothetical protein POPTR_0010s16160g [Populus trichocarpa]
Length=108

 Score =   177 bits (448),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +3

Query  90   IEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLK  269
            +E  +P+AFDPFA+AK+SG    KEYVHIRIQQRNGKKSLTTVQGL KE SY+KILK LK
Sbjct  3    LEFEIPSAFDPFADAKQSGT---KEYVHIRIQQRNGKKSLTTVQGLPKELSYEKILKTLK  59

Query  270  KEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            K+FCCNGNVVQDKELGKVIQLQGDQRKNV  FLV+  +VKKDQIKIHGF
Sbjct  60   KDFCCNGNVVQDKELGKVIQLQGDQRKNVQNFLVNQNIVKKDQIKIHGF  108



>gb|KCW46999.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=114

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PT FDPFA+AK E    G+KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDVQVPTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLV-SAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  AG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQQAGIVKKERIKIHGF  114



>ref|XP_009611793.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009792850.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009792852.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PTAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDLQVPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV A +VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAEIVKKEHIKIHGF  113



>gb|EYU19220.1| hypothetical protein MIMGU_mgv1a016636mg [Erythranthe guttata]
Length=113

 Score =   177 bits (448),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +P+A+DPFA+A  E+   G+K+YVHIR+QQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDIQVPSAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>gb|ABY75806.1| SUI1 A protein [Opuntia streptacantha]
Length=113

 Score =   177 bits (448),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +P A+DPFA+A  E+   GAK+YVHIR+QQRNG+KSLTTVQGL K++SY+KIL
Sbjct  1    MSDLDIQVPAAYDPFADANAENSGAGAKDYVHIRVQQRNGRKSLTTVQGLNKQFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVZDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>emb|CDO99708.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   177 bits (448),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  +PT FDPFA+A  ++ + G+KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSELDIQIPTTFDPFADANADNSSAGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AG+VKK+ IK+HGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKENIKLHGF  113



>gb|ACN30624.1| unknown [Zea mays]
Length=110

 Score =   177 bits (448),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 3/108 (3%)
 Frame = +3

Query  102  LPTAFDPFAEAK--ESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKK  272
            +PTAFDPFAEA   +SGA  G+K+YVH+RIQQRNG+KSLTTVQGL+KE+SY KILKDLKK
Sbjct  3    IPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKK  62

Query  273  EFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            EFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  63   EFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  110



>ref|XP_009624679.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Nicotiana tomentosiformis]
Length=113

 Score =   177 bits (448),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +P AFDPFAEA  ++   G K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDLLVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV  G+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKEHIKIHGF  113



>gb|AGT16828.1| protein translation factor SUI1 [Saccharum hybrid cultivar R570]
Length=116

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = +3

Query  81   MVDIE-AHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYD  248
            M D++   LP+AFDPFAEA     S   G+K+YVH+R QQRNG+KSLTTVQGL+KEYSY+
Sbjct  1    MSDLDLQQLPSAFDPFAEANAEDSSAGAGSKDYVHVRSQQRNGRKSLTTVQGLKKEYSYN  60

Query  249  KILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKKD IKIHGF
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKDSIKIHGF  116



>gb|KEH29652.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=113

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + + ++PT +DPFAEA  E    G KEYVH+R+QQRNG+KSLTTVQGL+KE+SY KIL
Sbjct  1    MSEFDTNIPTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEFSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK++IK+HGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKLHGF  113



>emb|CAD58628.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +   P AFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGDGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_008810164.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=180

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  LPT+FDPFAEA  E    GAKEYVH+RIQQRNG+K LTTVQGL+KE+S +KIL
Sbjct  1    MSDLDVQLPTSFDPFAEANAEDSDAGAKEYVHVRIQQRNGRKCLTTVQGLKKEFSCNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_002985789.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
 gb|EFJ12966.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
Length=113

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D +  +P AFDPFAEA  +    G+KEYVH+RIQQRNG+KSLTTVQGL+KE++Y++IL
Sbjct  1    MSDFDIQIPGAFDPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNRIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KD K+EFCCNG VV D ELG+VIQLQGDQRKNVSQFLV AG+ KKDQIKIHGF
Sbjct  61   KDFKREFCCNGTVVDDTELGQVIQLQGDQRKNVSQFLVQAGVAKKDQIKIHGF  113



>ref|XP_006644837.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
Length=115

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK---ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  LP+AFDPFAEA     S   G+K+YVH+RIQQRNG+KSLTTVQGL+KEYSY+K
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSVGTGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNV+ FL  AG+ KK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLDKAGIAKKESIKIHGF  115



>emb|CDP05794.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +   P AFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL KE+SY+KIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_009398183.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++A +PTAFDPFA+A    +  G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDAQIPTAFDPFADANADDSDAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKENIKIHGF  113



>gb|AFK43238.1| unknown [Medicago truncatula]
Length=113

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + + ++PT +DPFAEA  E    G KEYVH+R+QQRNG++SLTTVQGL+KE+SY KIL
Sbjct  1    MSEFDTNIPTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRRSLTTVQGLKKEFSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VV+D ELG+VIQLQGDQRKNVS FLV AG+VKK++IK+HGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKLHGF  113



>ref|NP_001274850.1| uncharacterized protein LOC102577437 [Solanum tuberosum]
 gb|ABB02649.1| unknown [Solanum tuberosum]
Length=113

 Score =   174 bits (442),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  + TAFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIRTAFDPFAEANADNFGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLKKEFCCNG VVQD ELG+VIQLQ DQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQDDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>gb|KDP20792.1| hypothetical protein JCGZ_21263 [Jatropha curcas]
Length=113

 Score =   174 bits (441),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK--ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M + +  +PTAFDP AEA   +SGA GAKEYVHIR+QQRNG+KSLTTVQGL+KE+SY+ I
Sbjct  1    MSERDIQIPTAFDPLAEANAADSGA-GAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNMI  59

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV A +VKK+ IKIHGF
Sbjct  60   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQARIVKKEHIKIHGF  113



>ref|XP_010272070.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272071.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272072.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=112

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFAEA  E    G+KEYVH+RIQQRNG+KSLTTVQGL KE+SY KIL
Sbjct  1    MSDLDVQIPTAFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLTKEFSYTKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDLK E CCNG VVQD ELG+V+QLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   KDLK-ELCCNGTVVQDPELGQVVQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  112



>emb|CAD58629.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M + +   P AFDPFAEA  ++   G+K+YVHIRIQQRNG+KSLTTVQGL KE+SY+KIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHG  413
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHG
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHG  112



>ref|XP_006827315.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
 gb|ERM94552.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
Length=177

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 100/115 (87%), Gaps = 3/115 (3%)
 Frame = +3

Query  78   YMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            +M D++  +P  FDPFA+A  ++SGA G K+YVH+R+QQRNG+K LTTVQG++KE++Y+K
Sbjct  64   FMSDLDIQVPGVFDPFADALGEDSGA-GTKDYVHVRVQQRNGRKCLTTVQGVKKEFNYNK  122

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKD KKEFCCNG VVQDKELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  123  ILKDFKKEFCCNGTVVQDKELGQVIQLQGDQRKNVSNFLVQAGIVKKDNIKIHGF  177



>ref|XP_002976303.1| hypothetical protein SELMODRAFT_232756 [Selaginella moellendorffii]
 gb|EFJ22563.1| hypothetical protein SELMODRAFT_232756 [Selaginella moellendorffii]
Length=114

 Score =   172 bits (437),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +3

Query  81   MVDIEAHLPTAF-DPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D +  +P AF DPFAEA  +    G+KEYVH+RIQQRNG+KSLTTVQGL+KE++Y+KI
Sbjct  1    MSDFDIQIPGAFADPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNKI  60

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD K+EFCCNG VV D ELG+VIQLQGDQRKNVSQFLV AG+ KKDQIKIHGF
Sbjct  61   LKDFKREFCCNGTVVDDTELGQVIQLQGDQRKNVSQFLVQAGVAKKDQIKIHGF  114



>gb|ABK24036.1| unknown [Picea sitchensis]
Length=112

 Score =   172 bits (436),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 4/114 (4%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPF--AEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKI  254
            M D +  +PT FDPF  +EA ++G PG K+YVH+RIQQRNG+K LTT+QGLRK+Y+Y+KI
Sbjct  1    MSDQDIQIPT-FDPFKDSEADDAG-PGTKDYVHVRIQQRNGRKCLTTIQGLRKDYNYNKI  58

Query  255  LKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKD KKEFCCNG VVQD ELG++IQLQGDQRKNVSQFL++AGLVKKD+IKIHGF
Sbjct  59   LKDFKKEFCCNGTVVQDLELGQIIQLQGDQRKNVSQFLINAGLVKKDKIKIHGF  112



>ref|XP_006452372.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 ref|XP_006452373.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 ref|XP_006475068.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006475069.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X2 [Citrus sinensis]
 gb|ESR65612.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 gb|ESR65613.1| hypothetical protein CICLE_v10009975mg [Citrus clementina]
 gb|KDO62726.1| hypothetical protein CISIN_1g033744mg [Citrus sinensis]
Length=112

 Score =   172 bits (436),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVDI++ +PT++DPFA+ K+S APG K YVH+R+QQRNGKK LTTVQGL++++ Y KILK
Sbjct  1    MVDIDSQIPTSYDPFADIKDSLAPGDKGYVHLRVQQRNGKKCLTTVQGLKEDFGYQKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            DLKKEFCCNGNVV DK LGKVIQLQGD RKNV  FLV + +V KD+IKIHGF
Sbjct  61   DLKKEFCCNGNVVNDKVLGKVIQLQGDHRKNVMIFLVKSKIVDKDRIKIHGF  112



>ref|XP_006352509.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=132

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 10/134 (7%)
 Frame = +3

Query  18   LSSSLVKVSDRSDSFLHQASYMVDIEAHLPTAFDPFAEAKESGAPGAK-EYVHIRIQQRN  194
            +S+S    +D  DS         D +  +P +FDPFAE+K+ GA G K EYVHIR+QQRN
Sbjct  8    ISTSFDPFADAVDS---------DSDVQIPRSFDPFAESKDLGARGTKKEYVHIRVQQRN  58

Query  195  GKKSLTTVQGLRKEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVS  374
            GKKS T ++GL+K++SY+KILKDLKKE+CCNG ++QDKELGKVIQLQGDQR NVS+FLV 
Sbjct  59   GKKSWTMIEGLKKDFSYEKILKDLKKEYCCNGTIIQDKELGKVIQLQGDQRNNVSKFLVK  118

Query  375  AGLVKKDQIKIHGF  416
            A +VKK+QIK+HGF
Sbjct  119  ADIVKKEQIKVHGF  132



>gb|KJB39023.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39024.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39026.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39027.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
Length=111

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M D++  +PTAFDPFA+A  E    G KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            KDL KEFCCNG VVQD ELG+VIQLQGDQR NVS FLV AG+V KD IKIHGF
Sbjct  61   KDL-KEFCCNGTVVQDPELGQVIQLQGDQRNNVSTFLVQAGIV-KDNIKIHGF  111



>gb|KEH38844.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=116

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 2/107 (2%)
 Frame = +3

Query  102  LPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKE  275
            + T  DPFAEA  +++GA  +KEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KILKDLKKE
Sbjct  10   VATILDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  69

Query  276  FCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            FCCNG VVQD E G+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  70   FCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  116



>gb|EMS51805.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=163

 Score =   171 bits (432),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 3/121 (2%)
 Frame = +3

Query  63   LHQASYMVDIEAHLPTAFDPFAEAKESGAPG---AKEYVHIRIQQRNGKKSLTTVQGLRK  233
            L    +M D++  +PTAFDPFAEA    A     +K+YVH+RIQQRNG+KSLTTVQGL+K
Sbjct  43   LSPGDFMSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKK  102

Query  234  EYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHG  413
            E+SY KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHG
Sbjct  103  EFSYSKILKDLKKEFCCNGTVVQDTELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHG  162

Query  414  F  416
            F
Sbjct  163  F  163



>gb|AAM34279.1|AF508969_1 translation initiation factor [Triticum aestivum]
Length=115

 Score =   169 bits (428),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPG---AKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  +PTAFDPFAEA    A     +K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDTELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_008647990.1| PREDICTED: LOC100286322 isoform X2 [Zea mays]
Length=120

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 3/104 (3%)
 Frame = +3

Query  114  FDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCC  284
             DPFAEA  ++SGA PG K+YVH+RIQQRNG+KSLTTVQGL+KE+SY+KILKDLKKEFCC
Sbjct  17   IDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCC  76

Query  285  NGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            NG VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK+ IKIHGF
Sbjct  77   NGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKENIKIHGF  120



>ref|XP_003562997.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPG---AKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDK  251
            M D++  +PTAFDPFAEA    A     +K+YVH+RIQQRNG+KSLTTVQGL+KE+SY K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGEAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  252  ILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            ILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>gb|ADJ67213.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   166 bits (421),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  120  PFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCNGNV  296
            PFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KILKDLKKEFCCNG V
Sbjct  1    PFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTV  60

Query  297  VQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            VQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  100



>gb|EMS63057.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=119

 Score =   167 bits (422),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = +3

Query  102  LPTAFDPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKK  272
             P   DPFAEA  ++SGA  G+K YVH+R+QQRNG+KSLTTVQGL+K+YSY+KILKDLKK
Sbjct  12   FPRGTDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKK  71

Query  273  EFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            EFCCNG VVQD ELG+VIQLQGDQRKNV+ FLV AGL KK+ IKIHGF
Sbjct  72   EFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  119



>gb|EMT21575.1| Protein translation factor SUI1-like protein [Aegilops tauschii]
Length=124

 Score =   167 bits (422),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 3/103 (3%)
 Frame = +3

Query  117  DPFAEA--KESGA-PGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCN  287
            DPFAEA  +++GA PGAK+YVH+RIQQRNG+KSLTTVQGL+KE+SY+KILKDLKKEFCCN
Sbjct  22   DPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN  81

Query  288  GNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            G VVQD ELG+VIQLQGDQRKNV+ FLV AG+ KK+ IKIHGF
Sbjct  82   GTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKELIKIHGF  124



>gb|ACS68685.1| putative translation factor [Sonneratia alba]
 gb|ACS68756.1| putative translation factor, partial [Sonneratia alba]
Length=102

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = +3

Query  99   HLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKE  275
             +PTAFDPFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY KILKDLKKE
Sbjct  2    QVPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  61

Query  276  FCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKD  395
            FCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+
Sbjct  62   FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE  101



>ref|XP_001756581.1| predicted protein [Physcomitrella patens]
 ref|XP_001781716.1| predicted protein [Physcomitrella patens]
 gb|EDQ53445.1| predicted protein [Physcomitrella patens]
 gb|EDQ78535.1| predicted protein [Physcomitrella patens]
Length=116

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 3/111 (3%)
 Frame = +3

Query  93   EAHLPTAFDPFAEAK-ESGAPGAKE--YVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKD  263
            +  +P +FDPFAEA  E    G+K   YVH+R+QQRNG+KSLTTVQGL+KE++Y+KILKD
Sbjct  6    DTEIPASFDPFAEANVEDSGVGSKGSGYVHVRVQQRNGRKSLTTVQGLKKEFNYNKILKD  65

Query  264  LKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            LKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIHGF
Sbjct  66   LKKEFCCNGVVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKDLIKIHGF  116



>ref|XP_006833020.1| hypothetical protein AMTR_s00094p00033760, partial [Amborella 
trichopoda]
 gb|ERM98298.1| hypothetical protein AMTR_s00094p00033760, partial [Amborella 
trichopoda]
Length=100

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = +3

Query  120  PFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCNGNV  296
            PFAEA  E    G+KEYVH+RIQQRNG+KSLTTVQGL+KE+SY KILKDLKKEFCCNG V
Sbjct  1    PFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGTV  60

Query  297  VQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            VQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  100



>gb|ADU56181.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  AEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCNGNVVQD  305
            A A++SGA GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KILKDLKKEFCCNG VVQD
Sbjct  5    ANAEDSGA-GAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQD  63

Query  306  KELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
             ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  64   PELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  100



>gb|KCW70138.1| hypothetical protein EUGRSUZ_F03432 [Eucalyptus grandis]
Length=180

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +3

Query  69   QASYMVDIEAHLPTAFDPFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSY  245
            Q S ++     L     PFA+A  E    G KEYVHIR+QQRNG+KSLTTVQGL+KE+SY
Sbjct  64   QVSCLISTPRFLLPLVHPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSY  123

Query  246  DKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            +KILKDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  124  NKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  180



>ref|XP_010105571.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC05100.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=222

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 96/112 (86%), Gaps = 3/112 (3%)
 Frame = +3

Query  57   SFLHQASYMVDIEAHLPTAFDPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLR  230
            S ++Q  +M +I+  +PTAFDPFAEA  ++SGA G+KEYVHIRIQQRNG+KSLTTVQGL+
Sbjct  106  SLINQPRFMSEIDDQIPTAFDPFAEANAEDSGA-GSKEYVHIRIQQRNGRKSLTTVQGLK  164

Query  231  KEYSYDKILKDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLV  386
            KE+SY+KILKDLKKEFCCNG VVQD E G+VIQLQGDQRKNVS FL+ A  +
Sbjct  165  KEFSYNKILKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQASFL  216



>gb|KHN02839.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=141

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILK  260
            MVD+E  +PT FDPFAEA+ES APGAKEYVHIRIQQRNGKKSLTTVQGL+KE+SY+KILK
Sbjct  1    MVDLEIQVPTPFDPFAEARESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILK  60

Query  261  DLKKEFCCNGNVVQDKELGKVIQLQGDQ  344
            DLKKEFCCNG VVQDKELGK+IQLQGDQ
Sbjct  61   DLKKEFCCNGTVVQDKELGKIIQLQGDQ  88



>ref|XP_008351221.1| PREDICTED: protein translation factor SUI1 homolog 2-like, partial 
[Malus domestica]
Length=124

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +3

Query  117  DPFAEA--KESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCNG  290
            DPFAEA  ++SGA G KEYVHIR+QQRNG+KSLTTVQGL+KE+SY+KILKDLKKEFCCNG
Sbjct  7    DPFAEATAEDSGA-GTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNG  65

Query  291  NVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIH  410
             VVQD ELG+VIQLQGDQRKNVS FLV AG+VKKD IKIH
Sbjct  66   TVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIH  105



>ref|XP_010109526.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC23130.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=149

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  81   MVDIEAHLPTAFDPFAEAKESGAP-GAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKIL  257
            M +++  LP+AFDPFA+A    +  G KEYVH+R+QQRNG+KSLTTVQGL+K+YSY KIL
Sbjct  1    MSELDQQLPSAFDPFADASADDSSAGGKEYVHVRVQQRNGRKSLTTVQGLKKQYSYSKIL  60

Query  258  KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIH  410
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIH
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIH  111



>gb|ADJ67174.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   164 bits (415),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  120  PFAEAK-ESGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEYSYDKILKDLKKEFCCNGNV  296
            PFA+A  E    GAKEYVHIRIQQRNG+KSLTTVQGL+KE+SY+KILKDLKKEFCCNG V
Sbjct  1    PFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTV  60

Query  297  VQDKELGKVIQLQGDQRKNVSQFLVSAGLVKKDQIKIHGF  416
            VQD ELG+VIQLQGDQRK VS FLV AG+VKK++IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKKVSTFLVQAGIVKKEKIKIHGF  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380