BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN006G03

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011078375.1|  PREDICTED: 36.4 kDa proline-rich protein-like      118   3e-29   Sesamum indicum [beniseed]
ref|XP_011017834.1|  PREDICTED: 36.4 kDa proline-rich protein-like      117   5e-29   Populus euphratica
ref|XP_011020188.1|  PREDICTED: 36.4 kDa proline-rich protein-like      117   5e-29   Populus euphratica
gb|AAT42190.1|  putative proline-rich protein                           115   2e-28   Nicotiana tabacum [American tobacco]
ref|XP_009613824.1|  PREDICTED: repetitive proline-rich cell wall...    116   5e-28   Nicotiana tomentosiformis
ref|XP_002308060.1|  hypothetical protein POPTR_0006s06430g             114   5e-28   
ref|XP_004251730.1|  PREDICTED: 36.4 kDa proline-rich protein           115   1e-27   
ref|XP_009793400.1|  PREDICTED: repetitive proline-rich cell wall...    115   1e-27   Nicotiana sylvestris
ref|XP_006345219.1|  PREDICTED: 36.4 kDa proline-rich protein-like      114   1e-27   Solanum tuberosum [potatoes]
ref|XP_010090189.1|  hypothetical protein L484_011178                   114   2e-27   Morus notabilis
ref|XP_002324631.2|  hypothetical protein POPTR_0018s12630g             115   2e-27   
ref|XP_009340667.1|  PREDICTED: 36.4 kDa proline-rich protein-like      112   3e-27   
ref|XP_008336989.1|  PREDICTED: 36.4 kDa proline-rich protein-like      112   4e-27   
ref|XP_008354364.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...    112   2e-26   
ref|XP_008354363.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...    112   2e-26   
gb|KJB23625.1|  hypothetical protein B456_004G107700                    109   4e-26   Gossypium raimondii
ref|XP_008242820.1|  PREDICTED: repetitive proline-rich cell wall...    112   4e-26   Prunus mume [ume]
ref|XP_009363973.1|  PREDICTED: 36.4 kDa proline-rich protein-like      111   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_007202524.1|  hypothetical protein PRUPE_ppa010958mg             110   5e-26   
gb|EYU18244.1|  hypothetical protein MIMGU_mgv1a011967mg                110   5e-26   Erythranthe guttata [common monkey flower]
ref|XP_010656474.1|  PREDICTED: 36.4 kDa proline-rich protein           110   6e-26   
ref|XP_010241580.1|  PREDICTED: 36.4 kDa proline-rich protein           109   6e-26   Nelumbo nucifera [Indian lotus]
dbj|BAJ34930.1|  hypothetical protein                                   110   8e-26   Vitis hybrid cultivar
ref|XP_008443950.1|  PREDICTED: 36.4 kDa proline-rich protein iso...    108   8e-26   
gb|EYU18245.1|  hypothetical protein MIMGU_mgv11b010660mg               109   9e-26   Erythranthe guttata [common monkey flower]
ref|XP_010250205.1|  PREDICTED: 36.4 kDa proline-rich protein-like      109   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008443949.1|  PREDICTED: 36.4 kDa proline-rich protein iso...    108   1e-25   Cucumis melo [Oriental melon]
gb|KJB53996.1|  hypothetical protein B456_009G015500                    108   1e-25   Gossypium raimondii
ref|XP_011084187.1|  PREDICTED: 36.4 kDa proline-rich protein-like      110   1e-25   Sesamum indicum [beniseed]
gb|KGN65120.1|  hypothetical protein Csa_1G228960                       107   2e-25   Cucumis sativus [cucumbers]
ref|XP_004150208.1|  PREDICTED: uncharacterized protein LOC101204493    108   3e-25   
emb|CDP10452.1|  unnamed protein product                                108   3e-25   Coffea canephora [robusta coffee]
gb|AAL35979.1|AF104392_1  extensin-like protein                         108   3e-25   Cucumis sativus [cucumbers]
ref|NP_565348.1|  Bifunctional inhibitor/lipid-transfer protein/s...    108   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287279.1|  PREDICTED: 36.4 kDa proline-rich protein           107   5e-25   Fragaria vesca subsp. vesca
ref|XP_002885841.1|  hypothetical protein ARALYDRAFT_480276             108   5e-25   
gb|EPS72315.1|  hypothetical protein M569_02443                         106   1e-24   Genlisea aurea
ref|XP_006298325.1|  hypothetical protein CARUB_v10014389mg             106   3e-24   Capsella rubella
gb|ABS79455.1|  At2g10940-like protein                                  100   8e-24   Arabidopsis halleri subsp. halleri
gb|ABS79456.1|  At2g10940-like protein                                  100   9e-24   Arabidopsis halleri subsp. halleri
ref|XP_009392131.1|  PREDICTED: 36.4 kDa proline-rich protein-like      104   1e-23   
gb|ABS79484.1|  At2g10940-like protein                                99.8    1e-23   Arabidopsis lyrata subsp. petraea
gb|ABS79476.1|  At2g10940-like protein                                99.8    1e-23   Arabidopsis lyrata subsp. lyrata
gb|ABS79457.1|  At2g10940-like protein                                99.8    1e-23   Arabidopsis lyrata subsp. petraea
gb|ABS79461.1|  At2g10940-like protein                                99.8    1e-23   Arabidopsis lyrata subsp. petraea
ref|XP_010488821.1|  PREDICTED: 36.4 kDa proline-rich protein-like      104   2e-23   Camelina sativa [gold-of-pleasure]
gb|ABS79459.1|  At2g10940-like protein                                99.4    2e-23   Arabidopsis lyrata subsp. petraea
ref|XP_010413891.1|  PREDICTED: 36.4 kDa proline-rich protein-like      103   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010467159.1|  PREDICTED: 36.4 kDa proline-rich protein-like      103   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006855688.1|  hypothetical protein AMTR_s00044p00134830          101   2e-22   Amborella trichopoda
ref|XP_009390999.1|  PREDICTED: 36.4 kDa proline-rich protein-like    98.6    6e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU25259.1|  hypothetical protein MIMGU_mgv1a020004mg              93.2    2e-20   Erythranthe guttata [common monkey flower]
dbj|BAK07129.1|  predicted protein                                    95.9    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004169261.1|  PREDICTED: 36.4 kDa proline-rich protein-like    92.8    3e-20   
dbj|BAA19128.1|  unnamed protein product                              95.5    4e-20   Daucus carota [carrots]
ref|XP_006409710.1|  hypothetical protein EUTSA_v10022809mg           93.6    5e-20   
ref|XP_006385727.1|  hypothetical protein POPTR_0003s11060g           93.6    7e-20   
ref|XP_011033954.1|  PREDICTED: 36.4 kDa proline-rich protein         94.0    7e-20   Populus euphratica
ref|XP_010533777.1|  PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa pro...  93.6    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_006409711.1|  hypothetical protein EUTSA_v10022809mg           93.6    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_004151037.1|  PREDICTED: uncharacterized protein LOC101220939  93.2    1e-19   
gb|KGN55879.1|  hypothetical protein Csa_3G026150                     93.2    2e-19   Cucumis sativus [cucumbers]
gb|KDP25646.1|  hypothetical protein JCGZ_20802                       92.4    2e-19   Jatropha curcas
ref|XP_008238563.1|  PREDICTED: 36.4 kDa proline-rich protein         92.4    3e-19   Prunus mume [ume]
ref|XP_010533129.1|  PREDICTED: 36.4 kDa proline-rich protein         92.4    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_010093707.1|  hypothetical protein L484_019048                 92.4    3e-19   Morus notabilis
ref|XP_003608742.1|  Proline rich protein                             91.3    3e-19   Medicago truncatula
ref|XP_010933687.1|  PREDICTED: 36.4 kDa proline-rich protein-like    90.1    3e-19   Elaeis guineensis
ref|XP_006477233.1|  PREDICTED: 36.4 kDa proline-rich protein-like    92.0    3e-19   Citrus sinensis [apfelsine]
emb|CDX81428.1|  BnaC09g08390D                                        92.0    3e-19   
gb|KDO61487.1|  hypothetical protein CISIN_1g026333mg                 91.7    4e-19   Citrus sinensis [apfelsine]
ref|XP_008448869.1|  PREDICTED: 36.4 kDa proline-rich protein         91.7    4e-19   Cucumis melo [Oriental melon]
ref|XP_007211118.1|  hypothetical protein PRUPE_ppa025269mg           92.0    4e-19   Prunus persica
ref|XP_006440348.1|  hypothetical protein CICLE_v10021835mg           91.7    4e-19   Citrus clementina [clementine]
ref|XP_009112260.1|  PREDICTED: 36.4 kDa proline-rich protein         91.7    5e-19   Brassica rapa
ref|XP_008376234.1|  PREDICTED: 36.4 kDa proline-rich protein         91.7    6e-19   
ref|XP_008796818.1|  PREDICTED: 36.4 kDa proline-rich protein-like    89.4    6e-19   Phoenix dactylifera
ref|XP_009333634.1|  PREDICTED: 36.4 kDa proline-rich protein-like    91.3    6e-19   Pyrus x bretschneideri [bai li]
emb|CDY18576.1|  BnaA09g08190D                                        91.7    7e-19   Brassica napus [oilseed rape]
ref|XP_009397643.1|  PREDICTED: 36.4 kDa proline-rich protein-like    89.0    9e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397885.1|  PREDICTED: 36.4 kDa proline-rich protein-like    89.4    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913319.1|  PREDICTED: 36.4 kDa proline-rich protein         89.7    1e-18   Elaeis guineensis
ref|XP_004298649.1|  PREDICTED: 36.4 kDa proline-rich protein         89.7    2e-18   Fragaria vesca subsp. vesca
ref|XP_003525816.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.6    2e-18   Glycine max [soybeans]
emb|CBI31905.3|  unnamed protein product                              88.2    2e-18   Vitis vinifera
ref|XP_006841160.1|  hypothetical protein AMTR_s00086p00153720        89.0    2e-18   Amborella trichopoda
emb|CBI34143.3|  unnamed protein product                              87.4    3e-18   Vitis vinifera
ref|XP_007013549.1|  Bifunctional inhibitor/lipid-transfer protei...  89.4    4e-18   
gb|AAL02329.1|  proline-rich protein 1                                87.8    5e-18   Vitis vinifera
ref|XP_004516835.1|  PREDICTED: 36.4 kDa proline-rich protein-like    87.0    6e-18   
emb|CDY12951.1|  BnaA09g13230D                                        89.0    6e-18   Brassica napus [oilseed rape]
ref|XP_011002407.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  87.4    6e-18   Populus euphratica
emb|CDY70376.1|  BnaCnng68070D                                        88.6    6e-18   Brassica napus [oilseed rape]
ref|XP_011081226.1|  PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa pro...  88.6    7e-18   
ref|XP_004965761.1|  PREDICTED: 36.4 kDa proline-rich protein-like    89.0    7e-18   Setaria italica
ref|XP_007013548.1|  Bifunctional inhibitor/lipid-transfer protei...  87.8    7e-18   
ref|XP_009113073.1|  PREDICTED: 36.4 kDa proline-rich protein         88.6    7e-18   Brassica rapa
ref|XP_011002403.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  87.4    7e-18   Populus euphratica
ref|XP_010430304.1|  PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa pro...  88.6    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002271658.2|  PREDICTED: 36.4 kDa proline-rich protein-like    88.2    8e-18   Vitis vinifera
ref|XP_009418218.1|  PREDICTED: 36.4 kDa proline-rich protein-like    87.8    8e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010418242.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.2    9e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006391857.1|  hypothetical protein EUTSA_v10023531mg           89.0    1e-17   Eutrema salsugineum [saltwater cress]
ref|XP_008795904.1|  PREDICTED: 36.4 kDa proline-rich protein-like    87.0    1e-17   
emb|CAN80711.1|  hypothetical protein VITISV_033378                   87.8    1e-17   Vitis vinifera
ref|XP_006657183.1|  PREDICTED: 36.4 kDa proline-rich protein-like    87.0    1e-17   Oryza brachyantha
gb|KJB51915.1|  hypothetical protein B456_008G237700                  87.4    1e-17   Gossypium raimondii
gb|KFK25908.1|  hypothetical protein AALP_AA8G178300                  88.2    1e-17   Arabis alpina [alpine rockcress]
ref|XP_003549908.1|  PREDICTED: 36.4 kDa proline-rich protein-like    86.7    1e-17   Glycine max [soybeans]
gb|EYU30299.1|  hypothetical protein MIMGU_mgv11b015559mg             87.0    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_002531954.1|  lipid binding protein, putative                  87.4    2e-17   
ref|XP_009346908.1|  PREDICTED: uncharacterized protein LOC103938610  90.1    2e-17   
ref|XP_011002408.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  85.9    2e-17   Populus euphratica
ref|XP_002264442.1|  PREDICTED: 36.4 kDa proline-rich protein-like    86.3    2e-17   
emb|CDP09933.1|  unnamed protein product                              87.4    2e-17   Coffea canephora [robusta coffee]
ref|XP_004242756.1|  PREDICTED: 36.4 kDa proline-rich protein-like    85.1    2e-17   Solanum lycopersicum
ref|XP_006380877.1|  hypothetical protein POPTR_0006s01020g           85.9    2e-17   
ref|XP_006358307.1|  PREDICTED: 36.4 kDa proline-rich protein-like    84.7    3e-17   Solanum tuberosum [potatoes]
ref|XP_010258986.1|  PREDICTED: 36.4 kDa proline-rich protein-like    86.3    3e-17   Nelumbo nucifera [Indian lotus]
ref|XP_007039885.1|  Bifunctional inhibitor/lipid-transfer protei...  86.3    3e-17   
ref|XP_007155642.1|  hypothetical protein PHAVU_003G219000g           85.1    3e-17   Phaseolus vulgaris [French bean]
ref|XP_002520567.1|  Repetitive proline-rich cell wall protein 2 ...  86.7    3e-17   Ricinus communis
ref|XP_003631735.1|  PREDICTED: 36.4 kDa proline-rich protein         86.7    4e-17   Vitis vinifera
ref|XP_008380324.1|  PREDICTED: 36.4 kDa proline-rich protein-like    86.3    4e-17   
gb|EPS72593.1|  hypothetical protein M569_02163                       84.7    4e-17   Genlisea aurea
gb|ABK95045.1|  unknown                                               85.1    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010047989.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  86.3    4e-17   
ref|XP_011002404.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  85.1    4e-17   Populus euphratica
ref|XP_009607969.1|  PREDICTED: 36.4 kDa proline-rich protein-like    84.3    4e-17   Nicotiana tomentosiformis
ref|NP_001058178.1|  Os06g0643500                                     86.3    4e-17   
ref|XP_010047988.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  86.3    4e-17   
ref|XP_010473466.1|  PREDICTED: 36.4 kDa proline-rich protein-like    86.3    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009365676.1|  PREDICTED: 36.4 kDa proline-rich protein         85.1    5e-17   Pyrus x bretschneideri [bai li]
emb|CAN77497.1|  hypothetical protein VITISV_040680                   85.1    5e-17   Vitis vinifera
ref|XP_009785634.1|  PREDICTED: 36.4 kDa proline-rich protein-like    84.0    5e-17   Nicotiana sylvestris
gb|AFK39919.1|  unknown                                               85.5    5e-17   Lotus japonicus
ref|XP_002888023.1|  hypothetical protein ARALYDRAFT_475096           86.3    5e-17   
ref|XP_007155053.1|  hypothetical protein PHAVU_003G169100g           85.5    5e-17   Phaseolus vulgaris [French bean]
ref|XP_008368547.1|  PREDICTED: 36.4 kDa proline-rich protein-like    84.7    6e-17   
gb|AFK49537.1|  unknown                                               85.1    9e-17   Medicago truncatula
ref|XP_008342310.1|  PREDICTED: 36.4 kDa proline-rich protein         84.7    1e-16   
ref|NP_176439.1|  bifunctional inhibitor/lipid-transfer protein/s...  85.5    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84260.1|  unknown                                               84.7    1e-16   Medicago truncatula
gb|KJB27067.1|  hypothetical protein B456_004G2756001                 83.2    1e-16   Gossypium raimondii
ref|XP_010687917.1|  PREDICTED: 36.4 kDa proline-rich protein         84.7    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010093116.1|  hypothetical protein L484_009307                 84.7    1e-16   Morus notabilis
ref|XP_010055512.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  84.7    1e-16   
ref|XP_009595816.1|  PREDICTED: 36.4 kDa proline-rich protein         84.7    1e-16   Nicotiana tomentosiformis
ref|XP_011100461.1|  PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa pro...  84.7    2e-16   
gb|KJB37623.1|  hypothetical protein B456_006G213000                  84.0    2e-16   Gossypium raimondii
ref|XP_010055511.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  84.7    2e-16   Eucalyptus grandis [rose gum]
emb|CAA75594.1|  MtN4                                                 84.3    2e-16   Medicago truncatula
ref|XP_010532493.1|  PREDICTED: 36.4 kDa proline-rich protein-like    84.3    2e-16   Tarenaya hassleriana [spider flower]
gb|KHN15055.1|  36.4 kDa proline-rich protein                         82.8    2e-16   Glycine soja [wild soybean]
emb|CAA49341.1|  ADR11                                                82.4    2e-16   Glycine max [soybeans]
ref|XP_004508457.1|  PREDICTED: 36.4 kDa proline-rich protein-like    84.0    2e-16   Cicer arietinum [garbanzo]
ref|XP_004245751.1|  PREDICTED: 36.4 kDa proline-rich protein         84.3    3e-16   Solanum lycopersicum
ref|XP_008362354.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.5    3e-16   
ref|XP_006355521.1|  PREDICTED: 36.4 kDa proline-rich protein-like    83.6    3e-16   
ref|XP_006301895.1|  hypothetical protein CARUB_v10022370mg           84.0    3e-16   
ref|XP_003549740.1|  PREDICTED: 36.4 kDa proline-rich protein         82.8    3e-16   
ref|XP_009759781.1|  PREDICTED: 36.4 kDa proline-rich protein         84.0    4e-16   Nicotiana sylvestris
gb|KCW47606.1|  hypothetical protein EUGRSUZ_K01352                   80.5    4e-16   Eucalyptus grandis [rose gum]
ref|XP_003609406.1|  proline-rich protein                             83.6    4e-16   
ref|NP_001150138.1|  36.4 kDa proline-rich protein precursor          83.2    5e-16   
ref|XP_008788893.1|  PREDICTED: 36.4 kDa proline-rich protein-like    82.0    6e-16   
gb|ACF88427.1|  unknown                                               83.2    6e-16   Zea mays [maize]
ref|XP_004166254.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.9    7e-16   
ref|XP_002437338.1|  hypothetical protein SORBIDRAFT_10g025210        82.8    7e-16   Sorghum bicolor [broomcorn]
gb|KFK25004.1|  hypothetical protein AALP_AA8G053900                  83.6    7e-16   Arabis alpina [alpine rockcress]
gb|EYU42870.1|  hypothetical protein MIMGU_mgv1a011120mg              82.8    8e-16   Erythranthe guttata [common monkey flower]
gb|EMS66044.1|  36.4 kDa proline-rich protein                         80.1    8e-16   Triticum urartu
gb|EMT06542.1|  36.4 kDa proline-rich protein                         80.1    8e-16   
gb|AGT16397.1|  hypothetical protein SHCRBa_181_K17_R_210             82.8    9e-16   Saccharum hybrid cultivar R570
ref|XP_009135778.1|  PREDICTED: 36.4 kDa proline-rich protein-like    82.4    9e-16   Brassica rapa
ref|XP_003542640.1|  PREDICTED: 36.4 kDa proline-rich protein-like    82.0    9e-16   
ref|XP_011001017.1|  PREDICTED: 36.4 kDa proline-rich protein         83.2    1e-15   Populus euphratica
ref|NP_001144590.1|  uncharacterized protein LOC100277605 precursor   82.4    1e-15   
dbj|BAJ34557.1|  unnamed protein product                              82.8    1e-15   Eutrema halophilum
ref|XP_002323166.2|  hypothetical protein POPTR_0016s01720g           84.0    1e-15   
ref|XP_004304516.1|  PREDICTED: 36.4 kDa proline-rich protein         82.0    2e-15   Fragaria vesca subsp. vesca
emb|CDP06245.1|  unnamed protein product                              83.2    2e-15   Coffea canephora [robusta coffee]
emb|CAA57810.1|  proline-rich-like protein                            80.5    2e-15   Asparagus officinalis
ref|XP_008464631.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.9    2e-15   
ref|XP_004146070.1|  PREDICTED: uncharacterized protein LOC101218239  81.3    2e-15   
ref|XP_010490020.1|  PREDICTED: 36.4 kDa proline-rich protein         80.5    2e-15   
gb|AFH57274.1|  proline-rich protein                                  83.2    2e-15   Gossypium hirsutum [American cotton]
ref|XP_003601475.1|  Proline rich protein                             81.6    3e-15   Medicago truncatula
ref|XP_008342311.1|  PREDICTED: 36.4 kDa proline-rich protein-like    81.3    3e-15   
ref|XP_003560341.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.9    3e-15   Brachypodium distachyon [annual false brome]
emb|CAA47812.1|  ptxA                                                 81.6    3e-15   Pisum sativum [garden pea]
ref|XP_006453085.1|  hypothetical protein CICLE_v10009567mg           80.1    3e-15   
dbj|BAE71274.1|  hypothetical protein                                 80.5    4e-15   Trifolium pratense [peavine clover]
gb|EEC84097.1|  hypothetical protein OsI_30410                        80.5    4e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001056927.1|  Os06g0168700                                     80.5    4e-15   
gb|EAZ35967.1|  hypothetical protein OsJ_20271                        80.5    4e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KDP30246.1|  hypothetical protein JCGZ_17028                       79.7    5e-15   Jatropha curcas
ref|XP_002437917.1|  hypothetical protein SORBIDRAFT_10g004790        80.5    5e-15   Sorghum bicolor [broomcorn]
gb|AAD03487.1|  proline-rich cell wall protein                        81.3    5e-15   Medicago sativa [alfalfa]
gb|AAF32353.1|AF220197_1  proline rich protein 2                      76.3    6e-15   Vitis riparia [frost grape]
ref|XP_006853546.1|  hypothetical protein AMTR_s00032p00233360        79.0    7e-15   
dbj|BAJ89958.1|  predicted protein                                    79.7    8e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88732.1|  predicted protein                                    79.7    8e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT16919.1|  proline-rich protein                                  80.1    9e-15   Saccharum hybrid cultivar R570
ref|XP_010038743.1|  PREDICTED: 36.4 kDa proline-rich protein-like    79.3    1e-14   Eucalyptus grandis [rose gum]
ref|XP_008785888.1|  PREDICTED: 36.4 kDa proline-rich protein-like    79.0    1e-14   
ref|XP_010420896.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.9    1e-14   
ref|XP_003564254.1|  PREDICTED: 36.4 kDa proline-rich protein-like    78.6    2e-14   Brachypodium distachyon [annual false brome]
ref|XP_009145429.1|  PREDICTED: 36.4 kDa proline-rich protein-like    79.3    2e-14   Brassica rapa
gb|EMT21385.1|  36.4 kDa proline-rich protein                         78.2    2e-14   
ref|XP_010466481.1|  PREDICTED: 36.4 kDa proline-rich protein-like    78.2    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004966695.1|  PREDICTED: 36.4 kDa proline-rich protein-like    78.6    2e-14   Setaria italica
gb|AAC06386.1|  proline rich protein                                  75.1    2e-14   Malus domestica [apple tree]
emb|CAA64425.1|  cell wall-plasma membrane linker protein             79.3    3e-14   Brassica napus [oilseed rape]
gb|AAS20977.1|  protease inhibitor/seed storage/lipid transfer pr...  75.9    3e-14   Hyacinthus orientalis [common hyacinth]
ref|XP_010466478.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  79.3    3e-14   
ref|XP_010510955.1|  PREDICTED: 36.4 kDa proline-rich protein-like    79.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006856527.1|  hypothetical protein AMTR_s00046p00138910        77.8    3e-14   Amborella trichopoda
ref|XP_004502092.1|  PREDICTED: repetitive proline-rich cell wall...  79.0    6e-14   Cicer arietinum [garbanzo]
ref|XP_002307866.2|  hypothetical protein POPTR_0006s01030g           76.6    6e-14   
ref|XP_006652908.1|  PREDICTED: 36.4 kDa proline-rich protein-like    77.0    6e-14   Oryza brachyantha
gb|ABK26093.1|  unknown                                               76.6    6e-14   Picea sitchensis
gb|ACN36521.1|  unknown                                               77.0    6e-14   Zea mays [maize]
gb|ACG39902.1|  36.4 kDa proline-rich protein                         77.0    6e-14   Zea mays [maize]
ref|NP_001149720.1|  hybrid proline-rich protein1 precursor           77.0    7e-14   Zea mays [maize]
ref|XP_006655834.1|  PREDICTED: 36.4 kDa proline-rich protein-like    76.3    9e-14   Oryza brachyantha
ref|XP_006853490.1|  hypothetical protein AMTR_s00032p00211090        75.5    1e-13   
gb|ABK24042.1|  unknown                                               75.9    1e-13   Picea sitchensis
gb|ADW66157.1|  proline-rich protein                                  73.6    1e-13   Solanum nigrum
ref|XP_009380947.1|  PREDICTED: 36.4 kDa proline-rich protein-like    74.3    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR13301.1|  putative proline-rich cell wall protein               73.9    2e-13   Prunus dulcis [sweet almond]
gb|AAD11796.1|  cell wall-plasma membrane linker protein homolog      75.1    4e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAF75825.1|AF101789_1  proline-rich protein                        73.2    4e-13   Pinus taeda
ref|XP_009414495.1|  PREDICTED: 36.4 kDa proline-rich protein-like    74.3    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010680174.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  76.6    5e-13   
gb|EMS54619.1|  14 kDa proline-rich protein DC2.15                    72.4    5e-13   Triticum urartu
ref|XP_010680173.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  76.6    6e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010490022.1|  PREDICTED: 36.4 kDa proline-rich protein-like    72.8    6e-13   
gb|KHN31117.1|  36.4 kDa proline-rich protein                         75.1    8e-13   Glycine soja [wild soybean]
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  72.0    9e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KJB42884.1|  hypothetical protein B456_007G172300                  73.9    9e-13   Gossypium raimondii
ref|XP_010914263.1|  PREDICTED: 36.4 kDa proline-rich protein         72.8    1e-12   Elaeis guineensis
ref|XP_003542174.1|  PREDICTED: 36.4 kDa proline-rich protein-like    74.7    1e-12   
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           72.0    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_006605589.1|  PREDICTED: 36.4 kDa proline-rich protein-like    73.9    1e-12   Glycine max [soybeans]
gb|AGW00930.1|  PRP                                                   72.4    1e-12   Citrus trifoliata [hardy orange]
ref|NP_188851.2|  cell wall-plasma membrane linker protein            74.3    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ACU22880.1|  unknown                                               72.8    1e-12   Glycine max [soybeans]
ref|XP_010440330.1|  PREDICTED: 36.4 kDa proline-rich protein         73.6    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002870258.1|  hypothetical protein ARALYDRAFT_493374           75.1    1e-12   
gb|KJB08619.1|  hypothetical protein B456_001G094000                  75.1    1e-12   Gossypium raimondii
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  71.6    1e-12   Vitis vinifera
ref|XP_010436582.1|  PREDICTED: 36.4 kDa proline-rich protein-like    72.8    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009621287.1|  PREDICTED: 36.4 kDa proline-rich protein-like    73.2    1e-12   Nicotiana tomentosiformis
ref|NP_001054058.2|  Os04g0644400                                     72.4    2e-12   
gb|ACU20743.1|  unknown                                               72.8    2e-12   Glycine max [soybeans]
ref|XP_009109207.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  72.4    2e-12   
ref|XP_006429793.1|  hypothetical protein CICLE_v10012789mg           72.0    2e-12   
ref|XP_010449961.1|  PREDICTED: 36.4 kDa proline-rich protein-like    73.2    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006492911.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  72.0    2e-12   
ref|NP_001141199.1|  uncharacterized protein LOC100273286 precursor   72.0    2e-12   
ref|XP_004977017.1|  PREDICTED: 36.4 kDa proline-rich protein-like    72.4    2e-12   
ref|XP_009109198.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  72.0    3e-12   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  70.9    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006492910.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  72.0    3e-12   Citrus sinensis [apfelsine]
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.9    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007049066.1|  Bifunctional inhibitor/lipid-transfer protei...  73.9    3e-12   
dbj|BAJ86617.1|  predicted protein                                    72.8    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  70.5    3e-12   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.5    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.5    3e-12   Camelina sativa [gold-of-pleasure]
emb|CDY39502.1|  BnaA01g24860D                                        72.0    4e-12   Brassica napus [oilseed rape]
ref|XP_007049067.1|  Bifunctional inhibitor/lipid-transfer protei...  73.6    4e-12   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           70.5    4e-12   Capsella rubella
emb|CDY19310.1|  BnaC01g31700D                                        72.0    4e-12   Brassica napus [oilseed rape]
ref|XP_010911928.1|  PREDICTED: 36.4 kDa proline-rich protein-like    73.2    4e-12   Elaeis guineensis
emb|CAE01544.2|  OSJNBa0033G05.15                                     71.6    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107833.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  71.6    4e-12   Brassica rapa
gb|EEE61791.1|  hypothetical protein OsJ_16391                        71.6    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           70.1    5e-12   
gb|AAG31637.1|  putative proline-rich protein                         70.5    5e-12   
ref|XP_006286225.1|  hypothetical protein CARUB_v10007792mg           71.2    5e-12   
ref|XP_009107834.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  71.2    6e-12   
gb|EEC78118.1|  hypothetical protein OsI_17654                        71.6    6e-12   
ref|XP_002448629.1|  hypothetical protein SORBIDRAFT_06g030490        70.9    6e-12   
emb|CAJ86153.1|  H0413E07.6                                           71.6    6e-12   
ref|XP_006494496.1|  PREDICTED: 36.4 kDa proline-rich protein-like    70.9    7e-12   
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.7    7e-12   
ref|NP_001148182.1|  LOC100281790 precursor                           70.5    8e-12   
ref|XP_010260719.1|  PREDICTED: 36.4 kDa proline-rich protein         70.9    9e-12   
ref|XP_011082205.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    9e-12   
ref|XP_008777671.1|  PREDICTED: 36.4 kDa proline-rich protein-like    69.7    1e-11   
gb|KFK24098.1|  hypothetical protein AALP_AAs65529U000100             70.9    1e-11   
emb|CDY47794.1|  BnaC01g22500D                                        70.1    1e-11   
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           68.9    1e-11   
ref|XP_010914316.1|  PREDICTED: 36.4 kDa proline-rich protein-like    69.7    1e-11   
ref|XP_008229725.1|  PREDICTED: 36.4 kDa proline-rich protein         72.4    1e-11   
ref|NP_001148843.1|  36.4 kDa proline-rich protein precursor          70.1    1e-11   
dbj|BAD44137.1|  cell wall protein like                               69.7    1e-11   
gb|AGV54787.1|  hypothetical protein                                  71.6    1e-11   
ref|XP_007145990.1|  hypothetical protein PHAVU_006G003700g           71.2    1e-11   
gb|KDP33576.1|  hypothetical protein JCGZ_07147                       68.6    1e-11   
ref|NP_001154236.2|  bifunctional inhibitor/lipid-transfer protei...  69.7    1e-11   
gb|AGV54811.1|  hypothetical protein                                  71.2    2e-11   
emb|CDY22936.1|  BnaA01g18740D                                        70.5    2e-11   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    2e-11   
ref|XP_008807062.1|  PREDICTED: 36.4 kDa proline-rich protein-like    70.5    2e-11   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.2    2e-11   
prf||2022306A  salt-inducible protein RF2                             66.2    2e-11
ref|XP_010906726.1|  PREDICTED: 36.4 kDa proline-rich protein-like    68.9    2e-11   
emb|CDY59805.1|  BnaA05g35360D                                        69.3    3e-11   
ref|XP_009147527.1|  PREDICTED: 36.4 kDa proline-rich protein         69.7    3e-11   
ref|XP_009144715.1|  PREDICTED: 36.4 kDa proline-rich protein-like    69.3    3e-11   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   67.8    3e-11   
emb|CDY21275.1|  BnaC03g29590D                                        67.8    3e-11   
ref|XP_009793942.1|  PREDICTED: 36.4 kDa proline-rich protein-like    70.5    3e-11   
emb|CDX90834.1|  BnaA03g25140D                                        67.8    3e-11   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   67.4    3e-11   
ref|XP_006481445.1|  PREDICTED: 36.4 kDa proline-rich protein-like    68.9    3e-11   
emb|CAA40361.1|  proline rich protein                                 69.7    4e-11   
ref|XP_002885484.1|  predicted protein                                71.6    4e-11   
emb|CAB10295.1|  cell wall protein like                               70.9    4e-11   
emb|CDY09061.1|  BnaC08g10150D                                        68.9    4e-11   
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    4e-11   
ref|NP_193252.5|  bifunctional inhibitor/lipid-transfer protein/s...  68.9    4e-11   
ref|XP_006429789.1|  hypothetical protein CICLE_v10013746mg           68.2    4e-11   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                  67.4    5e-11   
dbj|BAJ89984.1|  predicted protein                                    68.2    5e-11   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    67.0    5e-11   
emb|CDY06505.1|  BnaC06g11390D                                        68.2    5e-11   
emb|CDY61290.1|  BnaCnng37610D                                        67.0    6e-11   
ref|XP_009403208.1|  PREDICTED: 36.4 kDa proline-rich protein-like    68.6    6e-11   
sp|Q00451.1|PRF1_SOLLC  RecName: Full=36.4 kDa proline-rich protein   69.7    6e-11   
ref|XP_002324869.2|  hypothetical protein POPTR_0018s01890g           66.6    6e-11   
gb|AEO92077.1|  hybrid proline-rich protein                           69.7    6e-11   
ref|XP_011085466.1|  PREDICTED: 36.4 kDa proline-rich protein         69.3    7e-11   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                       67.0    7e-11   
ref|XP_004243657.1|  PREDICTED: 36.4 kDa proline-rich protein         69.7    7e-11   
ref|XP_003603362.1|  Proline-rich protein                             66.6    7e-11   
gb|AFB82981.1|  proline-rich protein                                  68.2    7e-11   
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           66.6    7e-11   
ref|XP_006429790.1|  hypothetical protein CICLE_v10011810mg           69.7    7e-11   
ref|XP_006425978.1|  hypothetical protein CICLE_v10027482mg           67.8    8e-11   
ref|XP_006353733.1|  PREDICTED: 36.4 kDa proline-rich protein-like    69.7    9e-11   
gb|AAB18205.1|  cold acclimation protein WCOR518                      68.9    9e-11   
ref|XP_007216673.1|  hypothetical protein PRUPE_ppb004684mg           69.7    9e-11   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           66.6    9e-11   
ref|XP_006429791.1|  hypothetical protein CICLE_v10011810mg           69.7    9e-11   
ref|NP_001078199.1|  protease inhibitor/seed storage/LTP family p...  70.5    1e-10   
gb|AEO79031.1|  PRP1 precursor                                        68.6    1e-10   
ref|XP_011469171.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    66.2    1e-10   
ref|XP_008394102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-10   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  66.2    1e-10   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           65.9    1e-10   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    1e-10   
ref|XP_006414560.1|  hypothetical protein EUTSA_v10025987mg           67.4    1e-10   
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   65.9    1e-10   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-10   
gb|AEO79030.1|  PRP1 precursor                                        68.9    2e-10   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-10   
gb|AEW08695.1|  hypothetical protein CL1225Contig1_03                 64.3    2e-10   
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    2e-10   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-10   
gb|KDO38754.1|  hypothetical protein CISIN_1g040356mg                 66.6    2e-10   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-10   
gb|AFG60376.1|  hypothetical protein CL1225Contig1_03                 63.9    2e-10   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    3e-10   
emb|CDX82944.1|  BnaC01g13940D                                        65.1    3e-10   
gb|EMS56167.1|  36.4 kDa proline-rich protein                         68.2    3e-10   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    3e-10   
gb|AFB33865.1|  hypothetical protein CL1225Contig1_03                 63.5    3e-10   
gb|AEW08694.1|  hypothetical protein CL1225Contig1_03                 63.5    3e-10   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    3e-10   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        65.1    3e-10   
gb|AAC60566.1|  proline-rich SAC51                                    65.1    3e-10   
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           65.1    4e-10   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           64.7    4e-10   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg           64.7    4e-10   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       64.3    4e-10   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              64.7    4e-10   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           64.7    4e-10   
dbj|BAJ90863.1|  predicted protein                                    68.2    5e-10   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   64.3    5e-10   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           64.7    5e-10   
ref|XP_004235150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    5e-10   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  64.3    5e-10   
ref|XP_002515493.1|  14 kDa proline-rich protein DC2.15 precursor...  64.3    5e-10   
gb|AAA33132.1|  hybrid proline-rich protein;cytokinin-induced;hau...  66.6    5e-10   
gb|EMT20314.1|  Cortical cell-delineating protein                     64.3    5e-10   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  64.3    5e-10   
gb|EMT20315.1|  Cortical cell-delineating protein                     64.3    6e-10   
ref|XP_010048953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    6e-10   
ref|XP_006429788.1|  hypothetical protein CICLE_v10011766mg           67.0    6e-10   
ref|XP_010490023.1|  PREDICTED: proline-rich extensin-like protei...  68.2    6e-10   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    63.9    6e-10   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              63.9    6e-10   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    7e-10   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           64.3    7e-10   
emb|CDY31241.1|  BnaC08g15360D                                        63.9    7e-10   
dbj|BAA05471.1|  tumor-related protein                                62.8    8e-10   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    8e-10   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           63.5    8e-10   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    63.5    8e-10   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        63.5    8e-10   
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    63.5    9e-10   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    9e-10   
ref|XP_010088890.1|  hypothetical protein L484_020878                 63.5    9e-10   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        63.5    9e-10   
gb|AFK43955.1|  unknown                                               63.5    9e-10   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.5    9e-10   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    9e-10   
emb|CDY21034.1|  BnaA08g24910D                                        63.5    9e-10   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    9e-10   
ref|XP_003559026.1|  PREDICTED: putative lipid-binding protein AIR1   63.9    9e-10   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    9e-10   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    9e-10   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        63.5    1e-09   
gb|EMS63332.1|  Cortical cell-delineating protein                     63.5    1e-09   
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    1e-09   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    1e-09   
emb|CBI31906.3|  unnamed protein product                              63.2    1e-09   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.9    1e-09   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 63.2    1e-09   
emb|CDY21274.1|  BnaC03g29580D                                        63.9    1e-09   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-09   
emb|CDY32208.1|  BnaA03g54590D                                        63.5    1e-09   
ref|NP_001152394.1|  36.4 kDa proline-rich protein precursor          63.9    1e-09   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           63.2    1e-09   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          63.5    1e-09   
emb|CDY08680.1|  BnaC04g19890D                                        63.5    1e-09   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-09   
gb|AFK37174.1|  unknown                                               63.2    1e-09   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.9    1e-09   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        63.5    1e-09   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-09   
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-09   
gb|EMS63331.1|  Cortical cell-delineating protein                     63.2    1e-09   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  63.5    1e-09   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-09   
ref|XP_010433403.1|  PREDICTED: pEARLI1-like lipid transfer prote...  63.5    1e-09   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-09   
ref|XP_004235149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    1e-09   
ref|XP_008445235.1|  PREDICTED: pEARLI1-like lipid transfer prote...  63.2    1e-09   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.5    1e-09   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.5    1e-09   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-09   
emb|CDX90833.1|  BnaA03g25130D                                        63.5    1e-09   
ref|XP_004235416.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-09   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   63.2    2e-09   
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-09   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-09   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-09   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-09   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           62.8    2e-09   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-09   
ref|XP_006396751.1|  hypothetical protein EUTSA_v10029036mg           63.2    2e-09   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  62.8    2e-09   
ref|XP_006413657.1|  hypothetical protein EUTSA_v10026536mg           62.8    2e-09   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-09   
ref|XP_002309638.1|  hypothetical protein POPTR_0006s27220g           62.4    2e-09   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-09   
dbj|BAA13155.1|  glycine-rich polypeptide                             61.6    2e-09   
ref|NP_001140565.1|  uncharacterized protein LOC100272630 precursor   62.4    2e-09   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-09   
ref|NP_001053513.2|  Os04g0554800                                     62.4    3e-09   
gb|EAY95111.1|  hypothetical protein OsI_16928                        62.4    3e-09   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    3e-09   
dbj|BAA13150.1|  NT16 polypeptide                                     62.8    3e-09   
ref|NP_001288371.1|  36.4 kDa proline-rich protein-like precursor     62.4    3e-09   
ref|XP_003588785.1|  14 kDa proline-rich protein DC2.15               62.4    3e-09   
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    3e-09   
gb|AFK47889.1|  unknown                                               61.6    3e-09   
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    3e-09   
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               62.4    3e-09   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    3e-09   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    3e-09   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    62.0    3e-09   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    62.0    3e-09   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           62.0    3e-09   
ref|XP_004235151.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    3e-09   
gb|EAY95514.1|  hypothetical protein OsI_17360                        62.8    3e-09   
ref|XP_010458633.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    3e-09   
ref|XP_009134272.1|  PREDICTED: lipid transfer protein EARLI 1-like   62.4    3e-09   
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           62.0    3e-09   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    3e-09   
ref|XP_002466035.1|  hypothetical protein SORBIDRAFT_01g050360        62.4    3e-09   
ref|XP_003603363.1|  14 kDa proline-rich protein DC2.15               62.0    3e-09   
ref|XP_011081223.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    3e-09   
dbj|BAK03206.1|  predicted protein                                    62.0    3e-09   
ref|XP_010250206.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    3e-09   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    3e-09   
emb|CDY31240.1|  BnaC08g15350D                                        62.0    3e-09   
gb|KHN08148.1|  Putative lipid-binding protein                        62.4    4e-09   
ref|XP_009114618.1|  PREDICTED: lipid transfer protein EARLI 1        62.4    4e-09   
ref|NP_192984.1|  azelaic acid induced 1                              62.4    4e-09   
gb|AEX33654.1|  lipid transfer protein                                62.0    4e-09   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    61.6    4e-09   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           62.0    4e-09   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    4e-09   
dbj|BAF46299.1|  extensin like protein                                61.6    4e-09   



>ref|XP_011078375.1| PREDICTED: 36.4 kDa proline-rich protein-like [Sesamum indicum]
Length=208

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDPAVNECCP+L GLVELEAAACLCTTLKIKALNL+IYVP
Sbjct  128  DTLKLGACVDLLGGLVHIGLGDPAVNECCPMLSGLVELEAAACLCTTLKIKALNLNIYVP  187

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  188  LALQLLVTCGKTPPPGYTCSL  208



>ref|XP_011017834.1| PREDICTED: 36.4 kDa proline-rich protein-like [Populus euphratica]
Length=219

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVHVGLGDP VN+CCP+LKGLVELEAA CLCTTLKIKALNL+IYVP
Sbjct  139  DTLKLGACVDLLGGLVHVGLGDPVVNQCCPVLKGLVELEAAVCLCTTLKIKALNLNIYVP  198

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  199  LALQLLVTCGKTPPPGYTCSL  219



>ref|XP_011020188.1| PREDICTED: 36.4 kDa proline-rich protein-like [Populus euphratica]
Length=193

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+LKGLVELEAA CLCTTLKIKALNL+IYVP
Sbjct  113  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLKGLVELEAAVCLCTTLKIKALNLNIYVP  172

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  173  LALQLLVTCGKTPPPGYTCSL  193



>gb|AAT42190.1| putative proline-rich protein [Nicotiana tabacum]
Length=195

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+GDPAVNECCPIL GLVELEAAACLCTTLK+K LNL I+VP
Sbjct  115  DTLKLGACVDLLGGLVHIGIGDPAVNECCPILHGLVELEAAACLCTTLKVKLLNLKIFVP  174

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  175  LALQLLVTCGKTPPPGYTCSL  195



>ref|XP_009613824.1| PREDICTED: repetitive proline-rich cell wall protein 1 [Nicotiana 
tomentosiformis]
Length=289

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+GDPAVNECCPIL+GLVELEAAACLCTTLK+K LNL IYVP
Sbjct  209  DTLKLGACVDLLGGLVHIGIGDPAVNECCPILQGLVELEAAACLCTTLKVKLLNLKIYVP  268

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  269  LALQLLVTCGKTPPPGYTCSL  289



>ref|XP_002308060.1| hypothetical protein POPTR_0006s06430g [Populus trichocarpa]
 gb|ABK95081.1| unknown [Populus trichocarpa]
 gb|EEE91583.1| hypothetical protein POPTR_0006s06430g [Populus trichocarpa]
Length=198

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L GLVELEAA CLCTTLKIKALNL+IYVP
Sbjct  118  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLTGLVELEAAVCLCTTLKIKALNLNIYVP  177

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  178  LALQLLVTCGKTPPPGYTCSL  198



>ref|XP_004251730.1| PREDICTED: 36.4 kDa proline-rich protein [Solanum lycopersicum]
Length=262

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDPAVNECCPIL GLVELEAAACLCTTLK+K LNL IYVP
Sbjct  182  DTLKLGACVDLLGGLVHIGLGDPAVNECCPILSGLVELEAAACLCTTLKVKLLNLKIYVP  241

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPGYTC++
Sbjct  242  LALQLLVTCGKSPPPGYTCSI  262



>ref|XP_009793400.1| PREDICTED: repetitive proline-rich cell wall protein 1 [Nicotiana 
sylvestris]
Length=280

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+GDPAVNECCPIL GLVELEAAACLCTTLK+K LNL I+VP
Sbjct  200  DTLKLGACVDLLGGLVHIGIGDPAVNECCPILHGLVELEAAACLCTTLKVKLLNLKIFVP  259

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  260  LALQLLVTCGKTPPPGYTCSL  280



>ref|XP_006345219.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum tuberosum]
Length=241

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDPAVNECCPIL GLVELEAAACLCTTLK+K LNL IYVP
Sbjct  161  DTLKLGACVDLLGGLVHIGLGDPAVNECCPILSGLVELEAAACLCTTLKVKLLNLKIYVP  220

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPGYTC++
Sbjct  221  LALQLLVTCGKSPPPGYTCSI  241



>ref|XP_010090189.1| hypothetical protein L484_011178 [Morus notabilis]
 gb|EXB39018.1| hypothetical protein L484_011178 [Morus notabilis]
Length=248

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCPIL+GLVE+EAA CLCTTLKIKALNL+IYVP
Sbjct  168  DTLKLGACVDLLGGLVHIGLGDPVVNKCCPILQGLVEVEAAVCLCTTLKIKALNLNIYVP  227

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  228  LALQLLVTCGKTPPPGYTCSL  248



>ref|XP_002324631.2| hypothetical protein POPTR_0018s12630g [Populus trichocarpa]
 gb|EEF03196.2| hypothetical protein POPTR_0018s12630g [Populus trichocarpa]
Length=309

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG CVDLLGGLVHVGLGDP VN+CCP+LKGLVELEAA CLCTTLKIKALNL+IYVP
Sbjct  229  DTLKLGNCVDLLGGLVHVGLGDPVVNQCCPVLKGLVELEAAVCLCTTLKIKALNLNIYVP  288

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  289  LALQLLVTCGKTPPPGYTCSL  309



>ref|XP_009340667.1| PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri]
Length=209

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDPAVNECCP+L+GL ELEAA CLCTTLKIK LNL+I+VP
Sbjct  129  DTLKLGACVDLLGGLVHIGLGDPAVNECCPVLQGLAELEAAVCLCTTLKIKLLNLNIFVP  188

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPGYTC+L
Sbjct  189  LALQLLVTCGKSPPPGYTCSL  209



>ref|XP_008336989.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=193

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDPAVNECCP+L+GL ELEAA CLCTTLKIK LNL+I+VP
Sbjct  113  DTLKLGACVDLLGGLVHIGLGDPAVNECCPVLQGLAELEAAVCLCTTLKIKLLNLNIFVP  172

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK PPPGYTC+L
Sbjct  173  LALQLLVTCGKNPPPGYTCSL  193



>ref|XP_008354364.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Malus 
domestica]
Length=253

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVHVG GDP VNECCP+L+GLVELEAA CLCTTLKIK LNL+I+VP
Sbjct  173  DTLKLGACVDLLGGLVHVGQGDPVVNECCPVLQGLVELEAAVCLCTTLKIKLLNLNIFVP  232

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPG+TC+L
Sbjct  233  LALQLLVTCGKSPPPGFTCSL  253



>ref|XP_008354363.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Malus 
domestica]
Length=287

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVHVG GDP VNECCP+L+GLVELEAA CLCTTLKIK LNL+I+VP
Sbjct  207  DTLKLGACVDLLGGLVHVGQGDPVVNECCPVLQGLVELEAAVCLCTTLKIKLLNLNIFVP  266

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPG+TC+L
Sbjct  267  LALQLLVTCGKSPPPGFTCSL  287



>gb|KJB23625.1| hypothetical protein B456_004G107700 [Gossypium raimondii]
Length=172

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN CCP+L GLVELEAA CLCTTLK+K LNL+IYVP
Sbjct  92   DTLKLGACVDLLGGLVHIGLGDPLVNACCPVLAGLVELEAAVCLCTTLKLKVLNLNIYVP  151

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  152  LALQLLITCGKTPPPGYTCSL  172



>ref|XP_008242820.1| PREDICTED: repetitive proline-rich cell wall protein 1 [Prunus 
mume]
Length=315

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G GDP VNECCP+L+GLVELEAA CLCTTLKIK LNL+I+VP
Sbjct  235  DTLKLGACVDLLGGLVHIGQGDPVVNECCPVLQGLVELEAAVCLCTTLKIKLLNLNIFVP  294

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLVTCGK+PPPGYTC+L
Sbjct  295  IALQLLVTCGKSPPPGYTCSL  315



>ref|XP_009363973.1| PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri]
 ref|XP_009363974.1| PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri]
Length=287

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G GDP VNECCP+L+GLVELEAA CLCTTLKIK LNL+I+VP
Sbjct  207  DTLKLGACVDLLGGLVHIGQGDPVVNECCPVLQGLVELEAAVCLCTTLKIKLLNLNIFVP  266

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPG+TC+L
Sbjct  267  LALQLLVTCGKSPPPGFTCSL  287



>ref|XP_007202524.1| hypothetical protein PRUPE_ppa010958mg [Prunus persica]
 gb|EMJ03723.1| hypothetical protein PRUPE_ppa010958mg [Prunus persica]
Length=229

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DT+KLGACVDLLGGLVH+G GDP VNECCP+L+GLVELEAA CLCTTLK+K LNL+I+VP
Sbjct  149  DTMKLGACVDLLGGLVHIGQGDPVVNECCPVLQGLVELEAAMCLCTTLKMKLLNLNIFVP  208

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLVTCGK+PPPGYTC+L
Sbjct  209  IALQLLVTCGKSPPPGYTCSL  229



>gb|EYU18244.1| hypothetical protein MIMGU_mgv1a011967mg [Erythranthe guttata]
Length=265

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDPAVNECCPI+ GLVE EAAACLCTTLK+KALNL +YVP
Sbjct  185  DTLKLGACVDLLGGLVHIGLGDPAVNECCPIISGLVEAEAAACLCTTLKVKALNLKLYVP  244

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLV+CGKTPPPGY C++
Sbjct  245  IALQLLVSCGKTPPPGYECSI  265



>ref|XP_010656474.1| PREDICTED: 36.4 kDa proline-rich protein [Vitis vinifera]
Length=266

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP  NECCP+L GLVELEAA CLCTTLKIK LNL+IYVP
Sbjct  186  DTLKLGACVDLLGGLVHIGLGDPVANECCPVLSGLVELEAAVCLCTTLKIKLLNLNIYVP  245

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  246  LALQLLITCGKTPPPGYTCTV  266



>ref|XP_010241580.1| PREDICTED: 36.4 kDa proline-rich protein [Nelumbo nucifera]
Length=194

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LN++IY+P
Sbjct  114  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPLLEGLVELEAAVCLCTTLKVKLLNINIYLP  173

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC L
Sbjct  174  LALQLLVTCGKTPPPGYTCTL  194



>dbj|BAJ34930.1| hypothetical protein [Vitis hybrid cultivar]
Length=244

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP  NECCP+L GLVELEAA CLCTTLKIK LNL+IYVP
Sbjct  164  DTLKLGACVDLLGGLVHIGLGDPVANECCPVLSGLVELEAAVCLCTTLKIKLLNLNIYVP  223

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  224  LALQLLITCGKTPPPGYTCTV  244



>ref|XP_008443950.1| PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Cucumis 
melo]
Length=199

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG CVDLLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKALNL IYVP
Sbjct  119  DTLKLGGCVDLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALNLKIYVP  178

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGKTPPPGYTC+L
Sbjct  179  IALQLLITCGKTPPPGYTCSL  199



>gb|EYU18245.1| hypothetical protein MIMGU_mgv11b010660mg [Erythranthe guttata]
Length=240

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDPAVNECCPI+ GLVE EAA CLCTTLKIKALNL +YVP
Sbjct  160  DTLKLGACVDLLGGLVHIGLGDPAVNECCPIISGLVEAEAAVCLCTTLKIKALNLKLYVP  219

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLVTCGK+PPPGY C++
Sbjct  220  IALQLLVTCGKSPPPGYECSI  240



>ref|XP_010250205.1| PREDICTED: 36.4 kDa proline-rich protein-like [Nelumbo nucifera]
Length=225

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLKIK LNL+IY+P
Sbjct  145  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPLLQGLVELEAAVCLCTTLKIKLLNLNIYLP  204

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC L
Sbjct  205  LALQLLVTCGKTPPPGYTCTL  225



>ref|XP_008443949.1| PREDICTED: 36.4 kDa proline-rich protein isoform X1 [Cucumis 
melo]
Length=215

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG CVDLLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKALNL IYVP
Sbjct  135  DTLKLGGCVDLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALNLKIYVP  194

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGKTPPPGYTC+L
Sbjct  195  IALQLLITCGKTPPPGYTCSL  215



>gb|KJB53996.1| hypothetical protein B456_009G015500 [Gossypium raimondii]
Length=194

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP +N+CCP+L GL ELEAA CLCTTLK+K LNL IYVP
Sbjct  114  DTLKLGACVDLLGGLVHIGLGDPVLNQCCPVLSGLAELEAAVCLCTTLKLKVLNLKIYVP  173

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC+L
Sbjct  174  LALQLLVTCGKTPPPGYTCSL  194



>ref|XP_011084187.1| PREDICTED: 36.4 kDa proline-rich protein-like [Sesamum indicum]
Length=305

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDPAVN+CCP++ GL E+EAA CLCTTLKIKALNL IYVP
Sbjct  225  DTLKLGACVDLLGGLVHIGLGDPAVNKCCPVISGLAEVEAAVCLCTTLKIKALNLKIYVP  284

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLVTCGKTPPPG+TC+L
Sbjct  285  IALQLLVTCGKTPPPGFTCSL  305



>gb|KGN65120.1| hypothetical protein Csa_1G228960 [Cucumis sativus]
Length=204

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG CV+LLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKAL+L+IYVP
Sbjct  124  DTLKLGGCVNLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALDLNIYVP  183

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGKTPPPGYTC+L
Sbjct  184  IALQLLITCGKTPPPGYTCSL  204



>ref|XP_004150208.1| PREDICTED: uncharacterized protein LOC101204493, partial [Cucumis 
sativus]
 ref|XP_004173104.1| PREDICTED: uncharacterized LOC101204493, partial [Cucumis sativus]
Length=235

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG CV+LLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKAL+L+IYVP
Sbjct  155  DTLKLGGCVNLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALDLNIYVP  214

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGKTPPPGYTC+L
Sbjct  215  IALQLLITCGKTPPPGYTCSL  235



>emb|CDP10452.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLK+GAC D+LGG++H+G GDP VNECCPIL GLV++EAA CLCTTLK+KALNL ++VP
Sbjct  157  DTLKMGACADVLGGVMHIGFGDPVVNECCPILSGLVDVEAAVCLCTTLKLKALNLEMFVP  216

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +AL+LLV CGKTPPPGYTC+L
Sbjct  217  IALELLVYCGKTPPPGYTCSL  237



>gb|AAL35979.1|AF104392_1 extensin-like protein, partial [Cucumis sativus]
Length=219

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG CV+LLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKAL+L+IYVP
Sbjct  139  DTLKLGGCVNLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALDLNIYVP  198

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGKTPPPGYTC+L
Sbjct  199  IALQLLITCGKTPPPGYTCSL  219



>ref|NP_565348.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_849949.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAD26911.1| expressed protein [Arabidopsis thaliana]
 gb|AAL38354.1| unknown protein [Arabidopsis thaliana]
 gb|AAM83238.1| At2g10940/F15K19.1 [Arabidopsis thaliana]
 gb|AAN18126.1| At2g10940/F15K19.1 [Arabidopsis thaliana]
 gb|AEC06157.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEC06158.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=291

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP
Sbjct  211  DTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVP  270

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  271  VALQLLLTCGKNPPPGYTCSI  291



>ref|XP_004287279.1| PREDICTED: 36.4 kDa proline-rich protein [Fragaria vesca subsp. 
vesca]
Length=251

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VNECCP+L GLVELEAA CLCT LKIK LNL+I+VP
Sbjct  171  DTLKLGACVDLLGGLVHIGLGDPVVNECCPVLSGLVELEAAVCLCTALKIKLLNLNIFVP  230

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLVTCGK+PPPG+TC++
Sbjct  231  IALQLLVTCGKSPPPGFTCSI  251



>ref|XP_002885841.1| hypothetical protein ARALYDRAFT_480276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62100.1| hypothetical protein ARALYDRAFT_480276 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP
Sbjct  207  DTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVP  266

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  267  VALQLLLTCGKNPPPGYTCSI  287



>gb|EPS72315.1| hypothetical protein M569_02443, partial [Genlisea aurea]
Length=213

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGL+H+G+GDPAVN CCP+L GLVE+EAA CLCT++KIKALNL+IY+P
Sbjct  133  DTLKLGACVDLLGGLIHIGIGDPAVNTCCPVLAGLVEIEAAVCLCTSIKIKALNLNIYLP  192

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +AL+LL+TCGKTPPPG+TC L
Sbjct  193  IALELLLTCGKTPPPGFTCTL  213



>ref|XP_006298325.1| hypothetical protein CARUB_v10014389mg [Capsella rubella]
 gb|EOA31223.1| hypothetical protein CARUB_v10014389mg [Capsella rubella]
Length=269

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            +TLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGL E+EAAACLCTTLKIKAL+L +YVP
Sbjct  189  NTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLAEIEAAACLCTTLKIKALDLKLYVP  248

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  249  VALQLLLTCGKNPPPGYTCSI  269



>gb|ABS79455.1| At2g10940-like protein, partial [Arabidopsis halleri subsp. halleri]
Length=76

 Score =   100 bits (249),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +3

Query  18   GACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQL  197
            GACVDLLGGLV +G+GDPAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQL
Sbjct  1    GACVDLLGGLVKIGIGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQL  60

Query  198  LVTCGKTPPPGYTCAL  245
            L+TCGK PPPGYTC++
Sbjct  61   LLTCGKNPPPGYTCSI  76



>gb|ABS79456.1| At2g10940-like protein, partial [Arabidopsis halleri subsp. halleri]
 gb|ABS79483.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79489.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79490.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79491.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79494.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79495.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=76

 Score =   100 bits (248),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +3

Query  18   GACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQL  197
            GACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQL
Sbjct  1    GACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQL  60

Query  198  LVTCGKTPPPGYTCAL  245
            L+TCGK PPPGYTC++
Sbjct  61   LLTCGKNPPPGYTCSI  76



>ref|XP_009392131.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLK+GACVDLLGGLVH+G GDPA N+CCP+L+GLVE+EAA CLCTT+K+K L++++YVP
Sbjct  194  DTLKIGACVDLLGGLVHIGAGDPAANQCCPLLQGLVEIEAAVCLCTTIKLKVLDMNVYVP  253

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  254  LALQLLLTCGKTPPPGYTCTV  274



>gb|ABS79484.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=74

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  69   PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  245
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  15   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  73



>gb|ABS79476.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79477.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79492.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=72

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  69   PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  245
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  14   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  72



>gb|ABS79457.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79458.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=73

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  69   PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  245
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  15   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  73



>gb|ABS79461.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79462.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79463.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79464.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79465.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79466.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79467.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79468.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79469.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79470.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79471.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79472.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79473.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79478.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79479.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79480.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79481.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79482.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79485.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79486.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79487.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79488.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79493.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79496.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79497.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=70

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  69   PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  245
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  12   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  70



>ref|XP_010488821.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=306

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            +TLKLGACV+LLGGLV +GLGDP VN+CCP+LKGLVE+EAAACLCTTLKI AL+L +YVP
Sbjct  226  NTLKLGACVELLGGLVKIGLGDPTVNKCCPLLKGLVEVEAAACLCTTLKINALDLKLYVP  285

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  286  VALQLLLTCGKNPPPGYTCSI  306



>gb|ABS79459.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79460.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79474.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79475.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=74

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  69   PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  245
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  16   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  74



>ref|XP_010413891.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=272

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            +TLKLGACV+LLGGLV +GLGDP VN+CCP+LKGLVE+EAAACLCTTLKI AL+L +YVP
Sbjct  192  NTLKLGACVELLGGLVKIGLGDPTVNKCCPLLKGLVEVEAAACLCTTLKINALDLKLYVP  251

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQ+L+TCGK PPPGYTC++
Sbjct  252  VALQILLTCGKNPPPGYTCSI  272



>ref|XP_010467159.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=298

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGD  VN+CCP+LKGLVE+EAAACLCTTLKIKAL+L +YVP
Sbjct  218  DTLKLGACVDLLGGLVKIGLGDATVNKCCPLLKGLVEVEAAACLCTTLKIKALDLKLYVP  277

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +A QLL+TCGK PPPGYTC++
Sbjct  278  VAFQLLLTCGKNPPPGYTCSI  298



>ref|XP_006855688.1| hypothetical protein AMTR_s00044p00134830 [Amborella trichopoda]
 gb|ERN17155.1| hypothetical protein AMTR_s00044p00134830 [Amborella trichopoda]
Length=275

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVDLLGGLVHVGLGDPAVNECCP+L GLVELEAA CLCTT+K+K LNL+I++P
Sbjct  194  DALKLGACVDLLGGLVHVGLGDPAVNECCPVLAGLVELEAALCLCTTIKLKLLNLNIFLP  253

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK+PPPG+TC
Sbjct  254  IALELLITCGKSPPPGFTC  272



>ref|XP_009390999.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=196

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DT+++GACVDLLGGLV V +GDP VN+CCP+L+GL+ELEAA CLCT+++++ LN++IY+P
Sbjct  115  DTIRIGACVDLLGGLVRVVIGDPVVNQCCPLLQGLLELEAAVCLCTSIRLRLLNINIYLP  174

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCG TPPPG+TC +
Sbjct  175  LALQLLITCGITPPPGFTCTV  195



>gb|EYU25259.1| hypothetical protein MIMGU_mgv1a020004mg, partial [Erythranthe 
guttata]
Length=144

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVH+GLGDPA NECCPI+ GLVE+EAA CLCTTLKIKALNL+IY+P
Sbjct  64   DSLKLGACVDLLGGLVHIGLGDPAANECCPIISGLVEIEAAVCLCTTLKIKALNLNIYLP  123

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGK PPPGYTC++
Sbjct  124  LALQLLLTCGKAPPPGYTCSI  144



>dbj|BAK07129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GL ELEAAACLCTT+++K LN+++ +P
Sbjct  272  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPLLEGLAELEAAACLCTTIRLKLLNINLVLP  331

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LA+QLL+TCGKTPP GYTC++
Sbjct  332  LAVQLLLTCGKTPPRGYTCSI  352



>ref|XP_004169261.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis 
sativus]
Length=136

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTTL+IK LNL+I++P
Sbjct  55   DALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAVCLCTTLRIKLLNLNIFIP  114

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGK PPPG+ C
Sbjct  115  LALQALITCGKNPPPGFVC  133



>dbj|BAA19128.1| unnamed protein product [Daucus carota]
Length=347

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGLVHVGLGDP VN+CCP+L GLVELEAA CLCTT+K+  LN++I +P
Sbjct  267  DALKLGACVDVLGGLVHVGLGDPNVNKCCPVLAGLVELEAAVCLCTTIKLSLLNINIALP  326

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQLL+TCGKTPPPG+TC
Sbjct  327  VALQLLITCGKTPPPGFTC  345



>ref|XP_006409710.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
 gb|ESQ51163.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
Length=209

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KALNL +YVP
Sbjct  129  DTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYVP  188

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  189  VALQLLLTCGKNPPPGYTCSI  209



>ref|XP_006385727.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa]
 gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa]
Length=234

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGLVHVGLG+P  N CCP+LKGL+ELEAA CLCT++++K LNL+I++P
Sbjct  153  NALKLGACVDVLGGLVHVGLGNPVENVCCPVLKGLLELEAAICLCTSIRLKLLNLTIFIP  212

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+TCG+TPPPG+ C
Sbjct  213  LALQVLITCGQTPPPGFVC  231



>ref|XP_011033954.1| PREDICTED: 36.4 kDa proline-rich protein [Populus euphratica]
Length=249

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGLVHVGLG+P  N CCP+LKGL+ELEAA CLCT++++K LNL+I++P
Sbjct  168  NALKLGACVDVLGGLVHVGLGNPVENVCCPVLKGLLELEAAICLCTSIRLKLLNLTIFIP  227

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+TCG+TPPPG+ C
Sbjct  228  LALQVLITCGQTPPPGFVC  246



>ref|XP_010533777.1| PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein 
[Tarenaya hassleriana]
Length=270

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  188  DALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  247

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG TPPPG+ C
Sbjct  248  LALQALITCGMTPPPGFVC  266



>ref|XP_006409711.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
 ref|XP_006409712.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
 dbj|BAJ33620.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51164.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
 gb|ESQ51165.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
Length=266

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KALNL +YVP
Sbjct  186  DTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYVP  245

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  246  VALQLLLTCGKNPPPGYTCSI  266



>ref|XP_004151037.1| PREDICTED: uncharacterized protein LOC101220939 [Cucumis sativus]
Length=253

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTTL+IK LNL+I++P
Sbjct  172  DALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAVCLCTTLRIKLLNLNIFIP  231

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGK PPPG+ C
Sbjct  232  LALQALITCGKNPPPGFVC  250



>gb|KGN55879.1| hypothetical protein Csa_3G026150 [Cucumis sativus]
Length=262

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTTL+IK LNL+I++P
Sbjct  181  DALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAVCLCTTLRIKLLNLNIFIP  240

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGK PPPG+ C
Sbjct  241  LALQALITCGKNPPPGFVC  259



>gb|KDP25646.1| hypothetical protein JCGZ_20802 [Jatropha curcas]
Length=235

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGLVHVGLG+P  N CCP++KGL+ELEAA CLCTT+++K LN++I++P
Sbjct  154  NALKLGACVDVLGGLVHVGLGNPVENVCCPVIKGLLELEAAVCLCTTIRLKLLNINIFIP  213

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+TCGK PPPG+ C
Sbjct  214  LALQVLITCGKNPPPGFVC  232



>ref|XP_008238563.1| PREDICTED: 36.4 kDa proline-rich protein [Prunus mume]
Length=268

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCPIL GL+ELEAA CLCTT+K+K LNL+I++P
Sbjct  187  DALKLGLCVDVLGGLVHIGLGNPVENACCPILGGLLELEAAICLCTTIKLKLLNLNIFIP  246

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGKTPPPG+ C
Sbjct  247  LALQALITCGKTPPPGFVC  265



>ref|XP_010533129.1| PREDICTED: 36.4 kDa proline-rich protein [Tarenaya hassleriana]
Length=251

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGDPAVN+CCP++KGL E+EAAACLCTTLK+KALNL +YVP
Sbjct  171  DTLKLGACVDLLGGLVKIGLGDPAVNKCCPLVKGLAEVEAAACLCTTLKLKALNLKLYVP  230

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLV+CGKTPPPG+TC+L
Sbjct  231  VALQLLVSCGKTPPPGFTCSL  251



>ref|XP_010093707.1| hypothetical protein L484_019048 [Morus notabilis]
 gb|EXB54487.1| hypothetical protein L484_019048 [Morus notabilis]
Length=258

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVH+GLGDP  N CCP+L GL+ELEAA CLCT ++IK LNL+I++P
Sbjct  177  DALKLGLCLDVLGGLVHIGLGDPVQNTCCPVLGGLLELEAAVCLCTAIRIKLLNLNIFIP  236

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+TCGKTPPPG+ C
Sbjct  237  LALQVLITCGKTPPPGFVC  255



>ref|XP_003608742.1| Proline rich protein [Medicago truncatula]
 gb|AES90939.1| protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
Length=189

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGG+VHV +G+P  N CCP+++GLV+LEAA CLCT ++ K LNL+I++P
Sbjct  108  DALKLGLCLDVLGGVVHVVIGNPLKNVCCPVIQGLVDLEAAICLCTAIRAKVLNLNIFLP  167

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+TCGKTPPPG+ C
Sbjct  168  LALQVLITCGKTPPPGFVC  186



>ref|XP_010933687.1| PREDICTED: 36.4 kDa proline-rich protein-like [Elaeis guineensis]
Length=154

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVH+GLG P  N CCP+L+GL+ELEAA CLCT +K++ LNL IY+P
Sbjct  73   DILKLGLCLDVLGGLVHLGLGKPVENVCCPVLQGLLELEAAVCLCTAIKLRVLNLDIYIP  132

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQ+L+TCGK PP GY C L
Sbjct  133  LALQVLITCGKDPPRGYACPL  153



>ref|XP_006477233.1| PREDICTED: 36.4 kDa proline-rich protein-like [Citrus sinensis]
Length=240

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG CVD+LGGLVH+GLG+P  N CCP+LKGL+ELEAA CLCTT+++K LNL+I++P
Sbjct  159  NALKLGLCVDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFIP  218

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGKTPPPG+ C
Sbjct  219  LALQALITCGKTPPPGFVC  237



>emb|CDX81428.1| BnaC09g08390D [Brassica napus]
Length=256

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGDPA N+CCP+LKGLVE+EAAACLCTTLK+KALNL +YVP
Sbjct  176  DTLKLGACVDLLGGLVKIGLGDPAANKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYVP  235

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  236  VALQLLLTCGKNPPPGYTCSI  256



>gb|KDO61487.1| hypothetical protein CISIN_1g026333mg [Citrus sinensis]
Length=240

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG C+D+LGGLVH+GLG+P  N CCP+LKGL+ELEAA CLCTT+++K LNL+I++P
Sbjct  159  NALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFIP  218

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGKTPPPG+ C
Sbjct  219  LALQALITCGKTPPPGFVC  237



>ref|XP_008448869.1| PREDICTED: 36.4 kDa proline-rich protein [Cucumis melo]
Length=229

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTTL+IK LNL+I++P
Sbjct  148  DALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAICLCTTLRIKLLNLNIFIP  207

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGK PPPG+ C
Sbjct  208  LALQALITCGKNPPPGFVC  226



>ref|XP_007211118.1| hypothetical protein PRUPE_ppa025269mg [Prunus persica]
 gb|EMJ12317.1| hypothetical protein PRUPE_ppa025269mg [Prunus persica]
Length=262

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCPIL GL+ELEAA CLCTT+K+K LNL+I++P
Sbjct  181  DALKLGLCVDVLGGLVHIGLGNPVENACCPILGGLLELEAAICLCTTIKLKLLNLNIFIP  240

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGKTPPPG+ C
Sbjct  241  LALQALITCGKTPPPGFVC  259



>ref|XP_006440348.1| hypothetical protein CICLE_v10021835mg [Citrus clementina]
 gb|ESR53588.1| hypothetical protein CICLE_v10021835mg [Citrus clementina]
Length=252

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG C+D+LGGLVH+GLG+P  N CCP+LKGL+ELEAA CLCTT+++K LNL+I++P
Sbjct  171  NALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFIP  230

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGKTPPPG+ C
Sbjct  231  LALQALITCGKTPPPGFVC  249



>ref|XP_009112260.1| PREDICTED: 36.4 kDa proline-rich protein [Brassica rapa]
Length=254

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGDPA N+CCP+LKGLVE+EAAACLCTTLK+KALNL +YVP
Sbjct  174  DTLKLGACVDLLGGLVKIGLGDPAANKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYVP  233

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  234  VALQLLLTCGKNPPPGYTCSI  254



>ref|XP_008376234.1| PREDICTED: 36.4 kDa proline-rich protein [Malus domestica]
Length=259

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  178  DALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAICLCTTIRLKLLNLNIFIP  237

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGKTPPPG+ C
Sbjct  238  LALQALITCGKTPPPGFVC  256



>ref|XP_008796818.1| PREDICTED: 36.4 kDa proline-rich protein-like [Phoenix dactylifera]
Length=152

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVHVGLG P  N CCP+L+GL+ELEAA CLCT +K++ LNL IY+P
Sbjct  71   DILKLGLCLDVLGGLVHVGLGKPVENVCCPVLQGLLELEAAVCLCTAIKLRVLNLDIYIP  130

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQ+L+TCGK PP G+ C L
Sbjct  131  LALQVLITCGKDPPQGHVCPL  151



>ref|XP_009333634.1| PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri]
Length=255

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  174  DALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAICLCTTIRLKLLNLNIFIP  233

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGKTPPPG+ C
Sbjct  234  LALQALITCGKTPPPGFVC  252



>emb|CDY18576.1| BnaA09g08190D [Brassica napus]
Length=280

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLV +GLGDPA N+CCP+LKGLVE+EAAACLCTTLK+KALNL +YVP
Sbjct  200  DTLKLGACVDLLGGLVKIGLGDPAANKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYVP  259

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGK PPPGYTC++
Sbjct  260  VALQLLLTCGKNPPPGYTCSI  280



>ref|XP_009397643.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=156

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVHVGLG PA N CCP+L+GL+ELEAA CLCT +K++ L+L IY+P
Sbjct  75   DILKLGLCLDVLGGLVHVGLGKPAENVCCPVLQGLLELEAATCLCTAIKLRLLDLDIYIP  134

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQ+L+TCGK P PGY C L
Sbjct  135  LALQVLITCGKDPAPGYLCPL  155



>ref|XP_009397885.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=171

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVH+G G+PA N CCP+L GL+ELEAA CLCT +K++ LNL IY+P
Sbjct  90   DHLKLGLCLDVLGGLVHLGAGNPAENVCCPVLHGLLELEAAVCLCTAIKLRILNLDIYIP  149

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGK PP G  C L
Sbjct  150  LALQLLITCGKNPPSGSLCPL  170



>ref|XP_010913319.1| PREDICTED: 36.4 kDa proline-rich protein [Elaeis guineensis]
Length=215

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVH+G+GDP VN+CCP+L+GLVE+EAA CLCTT+K+K LN++IY+P
Sbjct  135  DSLKLGACVDLLGGLVHIGIGDPVVNQCCPLLQGLVEIEAAVCLCTTIKLKLLNINIYLP  194

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  195  LALQLLLTCGKTPPPGYTCTI  215



>ref|XP_004298649.1| PREDICTED: 36.4 kDa proline-rich protein [Fragaria vesca subsp. 
vesca]
Length=226

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVD+LGGLVH+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  145  DALKLGLCVDVLGGLVHIGLGNPVENACCPVLQGLLELEAAICLCTTIRLKLLNLNIFIP  204

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG TPPPG+ C
Sbjct  205  LALQALITCGITPPPGFVC  223



>ref|XP_003525816.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
 gb|KHN04349.1| 36.4 kDa proline-rich protein [Glycine soja]
Length=179

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVHVG+G+P  N CCP+++GL++LEAA CLCT ++ K LNLSI++P
Sbjct  97   DALKLGLCLDVLGGLVHVGIGNPVENVCCPVIQGLLDLEAAICLCTVIRAKLLNLSIFLP  156

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LVTCGKTPPPG+ C
Sbjct  157  IALQVLVTCGKTPPPGFVC  175



>emb|CBI31905.3| unnamed protein product [Vitis vinifera]
Length=163

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + +KLGACVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+I++P
Sbjct  75   NAIKLGACVDVLGGLVHIGLGNPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFIP  134

Query  183  LALQLLVTCGKTPPPGYTCAL*TTLPL  263
            +AL+ L+TCGKTPPPG+ C     +PL
Sbjct  135  IALEALITCGKTPPPGFVCPPLYMIPL  161



>ref|XP_006841160.1| hypothetical protein AMTR_s00086p00153720 [Amborella trichopoda]
 gb|ERN02835.1| hypothetical protein AMTR_s00086p00153720 [Amborella trichopoda]
Length=196

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGLVHVGLGDP  N CCP+L+GL+ELEAA CLC  +++K LNLSI++P
Sbjct  115  DALKLGACVDVLGGLVHVGLGDPVANTCCPVLQGLLELEAAVCLCMNIRLKVLNLSIFIP  174

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+LVTCG  PP G+ C
Sbjct  175  LALQVLVTCGMKPPEGFVC  193



>emb|CBI34143.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+G  A + CCP+L+GLV+L+AA CLCT +K+K LN++I +P
Sbjct  55   DTLKLGACVDLLGGLVHIGIGSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLNVNIIIP  114

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LV CGKTPP G+ C
Sbjct  115  IALQVLVGCGKTPPSGFQC  133



>ref|XP_007013549.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 3, partial [Theobroma cacao]
 ref|XP_007013550.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY31168.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY31169.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 3, partial [Theobroma cacao]
Length=259

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+ +GDP VNECCP+L GLVELEAA CLCTTLK+K LNL+IYVP
Sbjct  179  DTLKLGACVDLLGGLVHIVIGDPVVNECCPVLSGLVELEAAVCLCTTLKLKLLNLNIYVP  238

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  239  LALQLLITCGKTPPPGYTCSL  259



>gb|AAL02329.1| proline-rich protein 1 [Vitis vinifera]
Length=189

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+G  A + CCP+L+GLV+L+AA CLCT +K+K LN++I +P
Sbjct  109  DTLKLGACVDLLGGLVHIGIGSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLNVNIIIP  168

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LV CGKTPP G+ C
Sbjct  169  IALQVLVGCGKTPPSGFQC  187



>ref|XP_004516835.1| PREDICTED: 36.4 kDa proline-rich protein-like [Cicer arietinum]
Length=155

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGG+VHVG+G+P  + CCP+++GLV+LEAA CLCT ++ K LNL+I++P
Sbjct  74   DALKLGVCLDVLGGVVHVGIGNPVESVCCPVIEGLVDLEAAICLCTVIRAKLLNLNIFLP  133

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQLL+TCGK PPPG+ C
Sbjct  134  LALQLLITCGKNPPPGFLC  152



>emb|CDY12951.1| BnaA09g13230D [Brassica napus]
Length=276

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  194  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  253

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG  PPPG+ C
Sbjct  254  LALQALITCGINPPPGFIC  272



>ref|XP_011002407.1| PREDICTED: 36.4 kDa proline-rich protein isoform X3 [Populus 
euphratica]
Length=180

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            +TLKLGACVD+LGGLVH+G+G  A NECCP+L+GLV+L+AA+CLCT +K K LN+++ +P
Sbjct  100  NTLKLGACVDVLGGLVHIGIGRSAKNECCPVLEGLVDLDAASCLCTVIKAKLLNINLIIP  159

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L  CGKTPPPG+ C
Sbjct  160  IALEVLADCGKTPPPGFKC  178



>emb|CDY70376.1| BnaCnng68070D [Brassica napus]
Length=286

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  204  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  263

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG  PPPG+ C
Sbjct  264  LALQALITCGINPPPGFIC  282



>ref|XP_011081226.1| PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein 
[Sesamum indicum]
Length=260

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVHVG+G+P  N CCP+++GL+ELEAA CLCTT+++K LNL++++P
Sbjct  179  DALKLGLCLDVLGGLVHVGIGNPIENICCPVIQGLLELEAAICLCTTIRLKLLNLNVFLP  238

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L TCG TPPPG+ C
Sbjct  239  LALQVLATCGLTPPPGFVC  257



>ref|XP_004965761.1| PREDICTED: 36.4 kDa proline-rich protein-like [Setaria italica]
Length=298

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVHVGLGDP VN+CCP+L+GLVELEAA CLCTT+K+K LN++IY+P
Sbjct  218  DSLKLGACVDLLGGLVHVGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLKLLNINIYLP  277

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  278  LALQLLLTCGKTPPPGYTCTV  298



>ref|XP_007013548.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31167.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 1 [Theobroma cacao]
Length=213

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+ +GDP VNECCP+L GLVELEAA CLCTTLK+K LNL+IYVP
Sbjct  133  DTLKLGACVDLLGGLVHIVIGDPVVNECCPVLSGLVELEAAVCLCTTLKLKLLNLNIYVP  192

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  193  LALQLLITCGKTPPPGYTCSL  213



>ref|XP_009113073.1| PREDICTED: 36.4 kDa proline-rich protein [Brassica rapa]
Length=306

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  224  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  283

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG  PPPG+ C
Sbjct  284  LALQALITCGINPPPGFIC  302



>ref|XP_011002403.1| PREDICTED: 36.4 kDa proline-rich protein isoform X1 [Populus 
euphratica]
Length=193

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            +TLKLGACVD+LGGLVH+G+G  A NECCP+L+GLV+L+AA+CLCT +K K LN+++ +P
Sbjct  113  NTLKLGACVDVLGGLVHIGIGRSAKNECCPVLEGLVDLDAASCLCTVIKAKLLNINLIIP  172

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L  CGKTPPPG+ C
Sbjct  173  IALEVLADCGKTPPPGFKC  191



>ref|XP_010430304.1| PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein 
[Camelina sativa]
Length=299

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  217  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  276

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG  PPPG+ C
Sbjct  277  LALQALITCGINPPPGFVC  295



>ref|XP_002271658.2| PREDICTED: 36.4 kDa proline-rich protein-like [Vitis vinifera]
Length=236

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + +KLGACVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+I++P
Sbjct  155  NAIKLGACVDVLGGLVHIGLGNPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFIP  214

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+ L+TCGKTPPPG+ C
Sbjct  215  IALEALITCGKTPPPGFVC  233



>ref|XP_009418218.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=235

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLK+GACVDLLGGLVH+G+GDP VN CCP+L+GLVE+EAA CLCT++K+K LN++IY+P
Sbjct  155  DTLKVGACVDLLGGLVHIGIGDPVVNRCCPLLQGLVEIEAAVCLCTSIKLKLLNINIYLP  214

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  215  LALQLLLTCGKTPPPGYTCTI  235



>ref|XP_010418242.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=300

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  218  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  277

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG  PPPG+ C
Sbjct  278  LALQALITCGINPPPGFVC  296



>ref|XP_006391857.1| hypothetical protein EUTSA_v10023531mg [Eutrema salsugineum]
 gb|ESQ29143.1| hypothetical protein EUTSA_v10023531mg [Eutrema salsugineum]
Length=373

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  291  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAICLCTTIRLKLLNLNIFIP  350

Query  183  LALQLLVTCGKTPPPGYTCA  242
            LALQ L+TCG TPPPG+ C 
Sbjct  351  LALQALITCGLTPPPGFVCP  370



>ref|XP_008795904.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Phoenix 
dactylifera]
Length=200

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVH+G+GDP  N+CCP+L+GLVE+EAA CLCTT+K+K LN++IY+P
Sbjct  120  DSLKLGACVDLLGGLVHIGIGDPVANQCCPLLQGLVEIEAAVCLCTTIKLKLLNINIYLP  179

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  180  LALQLLLTCGKTPPPGYTCTI  200



>emb|CAN80711.1| hypothetical protein VITISV_033378 [Vitis vinifera]
Length=261

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + +KLGACVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+I++P
Sbjct  155  NAIKLGACVDVLGGLVHIGLGNPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFIP  214

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+ L+TCGKTPPPG+ C
Sbjct  215  IALEALITCGKTPPPGFVC  233



>ref|XP_006657183.1| PREDICTED: 36.4 kDa proline-rich protein-like [Oryza brachyantha]
Length=197

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LK+GACVDLLGGLVHVG+GDP VN+CCP+L+GLVELEAA CLCTT+K+K LN++IY+P
Sbjct  117  DSLKIGACVDLLGGLVHVGIGDPVVNKCCPLLEGLVELEAAVCLCTTIKLKLLNINIYLP  176

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGK PPPGYTCA+
Sbjct  177  LALQLLLTCGKNPPPGYTCAI  197



>gb|KJB51915.1| hypothetical protein B456_008G237700 [Gossypium raimondii]
Length=224

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG CVD+LGGLVH+GLGDP  N CCP+L GL+ELEAA CLCT +++K LNL+I++P
Sbjct  143  NALKLGLCVDVLGGLVHIGLGDPVENACCPVLGGLLELEAAVCLCTAIRLKLLNLNIFIP  202

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGK PPPG+ C
Sbjct  203  LALQALITCGKNPPPGFIC  221



>gb|KFK25908.1| hypothetical protein AALP_AA8G178300 [Arabis alpina]
Length=333

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L GL+ELEAA CLCTT+++K LN++I++P
Sbjct  251  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLGGLLELEAAVCLCTTIRLKLLNINIFIP  310

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG TPPPG+ C
Sbjct  311  LALQALITCGITPPPGFVC  329



>ref|XP_003549908.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
 gb|KHN09803.1| 36.4 kDa proline-rich protein [Glycine soja]
Length=178

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVHVG+G+P  N CCP+++GL++LEAA CLCT ++ K LNL+I++P
Sbjct  96   DALKLGLCLDVLGGLVHVGIGNPVENVCCPVIQGLLDLEAAICLCTVIRAKLLNLNIFLP  155

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQLLVTCGKT PPG+ C
Sbjct  156  LALQLLVTCGKTAPPGFVC  174



>gb|EYU30299.1| hypothetical protein MIMGU_mgv11b015559mg, partial [Erythranthe 
guttata]
Length=226

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG C+D+LGGL+H+G+GDP  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  67   NALKLGLCLDVLGGLIHIGIGDPIENICCPVLQGLLELEAAICLCTTIRLKLLNLNIFLP  126

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L TCG TPPPG+ C
Sbjct  127  LALQVLATCGLTPPPGFVC  145



>ref|XP_002531954.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF30436.1| lipid binding protein, putative [Ricinus communis]
Length=246

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LNL+IYVP
Sbjct  166  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYVP  225

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC L
Sbjct  226  LALQLLVTCGKTPPPGYTCTL  246



>ref|XP_009346908.1| PREDICTED: uncharacterized protein LOC103938610 [Pyrus x bretschneideri]
Length=662

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  69   PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGY  233
            P  N CCP+L GL+ELEAA CLCTT+ +K LN++I++PLA+Q L+TCGKTPPP +
Sbjct  55   PVENTCCPVLGGLLELEAAICLCTTIGLKLLNINIFIPLAVQALITCGKTPPPSF  109



>ref|XP_011002408.1| PREDICTED: 36.4 kDa proline-rich protein isoform X4 [Populus 
euphratica]
Length=167

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+HVG+G  A +ECCP+L+GLV+L+AA CLCT +K K LN+++ +P
Sbjct  87   DTLKLGACVDVLGGLIHVGIGSSAKDECCPLLEGLVDLDAALCLCTAIKAKLLNINLIIP  146

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LLV CGKTPP G+ C
Sbjct  147  IALELLVDCGKTPPEGFKC  165



>ref|XP_002264442.1| PREDICTED: 36.4 kDa proline-rich protein-like [Vitis vinifera]
Length=184

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVHVG+G  A + CCP+L+GLV+ ++A CLCTT+K K LN++I +P
Sbjct  104  DTLKLGACVDLLGGLVHVGIGSSAKDTCCPVLQGLVDSDSALCLCTTIKAKLLNVNIIIP  163

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LV CGKTPPPG+ C
Sbjct  164  IALQVLVDCGKTPPPGFQC  182



>emb|CDP09933.1| unnamed protein product [Coffea canephora]
Length=283

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG C+D+LGGL+HVG+G+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  201  NALKLGLCLDVLGGLIHVGIGNPVENVCCPVLQGLLELEAAICLCTTIRLKLLNLNIFLP  260

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+TCG TPPPG+ C
Sbjct  261  LALQVLITCGLTPPPGFVC  279



>ref|XP_004242756.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum lycopersicum]
Length=138

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DT+KLGACVDLLGGLVH+GLG+P VNECCPI++GLVE+EAA CLCTTLK+K LNL++YVP
Sbjct  58   DTIKLGACVDLLGGLVHIGLGNPVVNECCPIIEGLVEIEAAVCLCTTLKLKLLNLNLYVP  117

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  118  LALQLLLTCGKTPPPGYTCSL  138



>ref|XP_006380877.1| hypothetical protein POPTR_0006s01020g [Populus trichocarpa]
 gb|ERP58674.1| hypothetical protein POPTR_0006s01020g [Populus trichocarpa]
Length=184

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A +ECCP+L+GLV+L+AA CLCT +K K LN+++ +P
Sbjct  104  DTLKLGACVDVLGGLIHIGIGSSAKDECCPLLEGLVDLDAAVCLCTVIKAKLLNINLILP  163

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LLV CGKTPP G+ C
Sbjct  164  IALELLVDCGKTPPEGFKC  182



>ref|XP_006358307.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum tuberosum]
Length=137

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DT+KLGACVDLLGGLVH+GLG+P VNECCPI++GLVE+EAA CLCTTLK+K LNL++YVP
Sbjct  57   DTIKLGACVDLLGGLVHIGLGNPVVNECCPIIEGLVEIEAAVCLCTTLKLKLLNLNLYVP  116

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  117  LALQLLLTCGKTPPPGYTCSL  137



>ref|XP_010258986.1| PREDICTED: 36.4 kDa proline-rich protein-like [Nelumbo nucifera]
Length=225

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG C+D+LGGLVHVGLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+IY+P
Sbjct  144  NALKLGLCLDVLGGLVHVGLGNPVENTCCPVLGGLLELEAAVCLCTGIRLKLLNLNIYIP  203

Query  183  LALQLLVTCGKTPPPGYTC  239
            LA++ L+TCGK PPPGY C
Sbjct  204  LAIKALITCGKNPPPGYVC  222



>ref|XP_007039885.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24386.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=239

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+I++P
Sbjct  158  NALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAVCLCTAIRLKLLNLTIFIP  217

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCGK PPPG+ C
Sbjct  218  LALQALITCGKNPPPGFVC  236



>ref|XP_007155642.1| hypothetical protein PHAVU_003G219000g [Phaseolus vulgaris]
 gb|ESW27636.1| hypothetical protein PHAVU_003G219000g [Phaseolus vulgaris]
Length=171

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVHVG+G P  N CCP ++GL++LEAA CLCT ++ K L L+I++P
Sbjct  89   DALKLGLCLDVLGGLVHVGIGKPVENVCCPFIQGLLDLEAAICLCTVIRAKVLKLNIFLP  148

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+TCGKTPPPG+ C
Sbjct  149  IALQVLITCGKTPPPGFVC  167



>ref|XP_002520567.1| Repetitive proline-rich cell wall protein 2 precursor, putative 
[Ricinus communis]
 gb|EEF41800.1| Repetitive proline-rich cell wall protein 2 precursor, putative 
[Ricinus communis]
Length=299

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LNL+I +P
Sbjct  219  DTLKLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAALCLCTTIKAKLLNLNIIIP  278

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++LV CGK PPPG+ C
Sbjct  279  IALEVLVDCGKNPPPGFQC  297



>ref|XP_003631735.1| PREDICTED: 36.4 kDa proline-rich protein [Vitis vinifera]
Length=310

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+G  A + CCP+L+GLV+L+AA CLCT +K+K LN++I +P
Sbjct  230  DTLKLGACVDLLGGLVHIGIGSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLNVNIIIP  289

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LV CGKTPP G+ C
Sbjct  290  IALQVLVGCGKTPPSGFQC  308



>ref|XP_008380324.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=252

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  172  DTLKLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNINLIIP  231

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+ CGKTPP G+ C
Sbjct  232  IALQVLIDCGKTPPSGFQC  250



>gb|EPS72593.1| hypothetical protein M569_02163, partial [Genlisea aurea]
Length=152

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVHVG+G+P  N CCP++ GL+E+EAA CLCTT++++ LN+++++P
Sbjct  71   DALKLGLCLDVLGGLVHVGIGNPVENMCCPVIGGLLEVEAAICLCTTIRLRLLNVNVFLP  130

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+LVTCG  PPPG+ C
Sbjct  131  LALQVLVTCGLNPPPGFVC  149



>gb|ABK95045.1| unknown [Populus trichocarpa]
Length=179

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A +ECCP+L+GLV+L+AA CLCT +K K LN+++ +P
Sbjct  99   DTLKLGACVDVLGGLIHIGIGSSAKDECCPLLEGLVDLDAAVCLCTVIKAKLLNINLILP  158

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LLV CGKTPP G+ C
Sbjct  159  IALELLVDCGKTPPEGFKC  177



>ref|XP_010047989.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Eucalyptus 
grandis]
Length=256

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LNL+IYVP
Sbjct  176  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYVP  235

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC L
Sbjct  236  LALQLLVTCGKTPPPGYTCTL  256



>ref|XP_011002404.1| PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Populus 
euphratica]
 ref|XP_011002405.1| PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Populus 
euphratica]
Length=182

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+HVG+G  A +ECCP+L+GLV+L+AA CLCT +K K LN+++ +P
Sbjct  102  DTLKLGACVDVLGGLIHVGIGSSAKDECCPLLEGLVDLDAALCLCTAIKAKLLNINLIIP  161

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LLV CGKTPP G+ C
Sbjct  162  IALELLVDCGKTPPEGFKC  180



>ref|XP_009607969.1| PREDICTED: 36.4 kDa proline-rich protein-like [Nicotiana tomentosiformis]
Length=141

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+G+P +NECCPI++GLVE+EAA CLCTTLK+K LNL++YVP
Sbjct  61   DTLKLGACVDLLGGLVHIGIGNPVINECCPIIQGLVEIEAAVCLCTTLKLKLLNLNLYVP  120

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  121  LALQLLLTCGKTPPPGYTCSL  141



>ref|NP_001058178.1| Os06g0643500 [Oryza sativa Japonica Group]
 dbj|BAD37369.1| putative cell wall protein [Oryza sativa Japonica Group]
 dbj|BAF20092.1| Os06g0643500 [Oryza sativa Japonica Group]
 gb|EAZ37794.1| hypothetical protein OsJ_22130 [Oryza sativa Japonica Group]
 dbj|BAG96223.1| unnamed protein product [Oryza sativa Japonica Group]
Length=255

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LK+GACVDLLGGLVHVG+GDP VN+CCP+L+GLVELEAA CLCTT+++K LN++IY+P
Sbjct  175  DSLKIGACVDLLGGLVHVGIGDPVVNKCCPLLEGLVELEAAVCLCTTIRLKLLNINIYLP  234

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGK PPPGYTC++
Sbjct  235  LALQLLLTCGKNPPPGYTCSI  255



>ref|XP_010047988.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW80060.1| hypothetical protein EUGRSUZ_C01388 [Eucalyptus grandis]
 gb|KCW80061.1| hypothetical protein EUGRSUZ_C01388 [Eucalyptus grandis]
Length=266

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LNL+IYVP
Sbjct  186  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYVP  245

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPPPGYTC L
Sbjct  246  LALQLLVTCGKTPPPGYTCTL  266



>ref|XP_010473466.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=291

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + L LGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  209  NALNLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  268

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG  PPPG+ C
Sbjct  269  LALQALITCGINPPPGFVC  287



>ref|XP_009365676.1| PREDICTED: 36.4 kDa proline-rich protein [Pyrus x bretschneideri]
Length=184

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+HVG+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  104  DTLKLGACVDVLGGLIHVGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNVNLIIP  163

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+ CGKTPP G+ C
Sbjct  164  IALQVLIACGKTPPSGFQC  182



>emb|CAN77497.1| hypothetical protein VITISV_040680 [Vitis vinifera]
Length=182

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVHVG+G  A + CCP+L+GLV+ ++A CLCTT+K K LN++I +P
Sbjct  102  DTLKLGACVDLLGGLVHVGIGSSAKDTCCPVLQGLVDSDSALCLCTTIKAKLLNVNIIIP  161

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LV CGKTPPPG+ C
Sbjct  162  IALQVLVDCGKTPPPGFQC  180



>ref|XP_009785634.1| PREDICTED: 36.4 kDa proline-rich protein-like [Nicotiana sylvestris]
Length=141

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+G+P +NECCPI++GLVE+EAA CLCTTLK+K LNL++YVP
Sbjct  61   DTLKLGACVDLLGGLVHIGIGNPVINECCPIIQGLVEIEAAVCLCTTLKLKLLNLNLYVP  120

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  121  LALQLLLTCGKTPPPGYTCSL  141



>gb|AFK39919.1| unknown [Lotus japonicus]
Length=228

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG+CVDLLGGL+H+GLGDPAVN+CCP+L+GLVE+EAAACLCTTLK+K LNL+IYVP
Sbjct  148  DTLKLGSCVDLLGGLIHIGLGDPAVNKCCPVLQGLVEVEAAACLCTTLKLKLLNLNIYVP  207

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLV CGKTPPPGYTC+L
Sbjct  208  LALQLLVACGKTPPPGYTCSL  228



>ref|XP_002888023.1| hypothetical protein ARALYDRAFT_475096 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64282.1| hypothetical protein ARALYDRAFT_475096 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  212  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  271

Query  183  LALQLLVTCGKTPPPGY  233
            LALQ L+TCG  PPPG+
Sbjct  272  LALQALITCGINPPPGF  288



>ref|XP_007155053.1| hypothetical protein PHAVU_003G169100g [Phaseolus vulgaris]
 gb|ESW27047.1| hypothetical protein PHAVU_003G169100g [Phaseolus vulgaris]
Length=210

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVHVG+GDPA N+CCP+L+GLVELEAAACLCTTLK+K LNL+IYVP
Sbjct  130  DTLKLGACVDLLGGLVHVGVGDPAANQCCPVLQGLVELEAAACLCTTLKLKLLNLNIYVP  189

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLV CGK+PPPGYTC+L
Sbjct  190  IALQLLVACGKSPPPGYTCSL  210



>ref|XP_008368547.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=188

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  108  DTLKLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNVNLIIP  167

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+ CGKTPP G+ C
Sbjct  168  IALQVLIACGKTPPSGFQC  186



>gb|AFK49537.1| unknown [Medicago truncatula]
 gb|AES91603.2| Lipid transfer protein [Medicago truncatula]
Length=234

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GL E+EAAACLCTTLK+K LNL+IYVP
Sbjct  154  DTLKLGACVDLLGGLVHIGLGDPVVNKCCPVLQGLAEIEAAACLCTTLKLKLLNLNIYVP  213

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  214  LALQLLLTCGKTPPPGYTCSL  234



>ref|XP_008342310.1| PREDICTED: 36.4 kDa proline-rich protein [Malus domestica]
 ref|XP_008353628.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=213

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  133  DTLKLGACVDVLGGLIHIGIGSSAKDXCCPVLQGLVDLDAAICLCTTIKAKLLNVNLIIP  192

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+ CGKTPP G+ C
Sbjct  193  IALQVLIACGKTPPSGFQC  211



>ref|NP_176439.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAD43607.1|AC005698_6 T3P18.6 [Arabidopsis thaliana]
 gb|AAK76636.1| putative proline-rich cell wall protein [Arabidopsis thaliana]
 gb|AAL85077.1| putative proline-rich cell wall protein [Arabidopsis thaliana]
 gb|AAM65121.1| putative proline-rich cell wall protein [Arabidopsis thaliana]
 gb|AEE33972.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=297

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  215  NALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIP  274

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG  PP G+ C
Sbjct  275  LALQALITCGINPPSGFVC  293



>gb|ACJ84260.1| unknown [Medicago truncatula]
Length=234

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GL E+EAAACLCTTLK+K LNL+IYVP
Sbjct  154  DTLKLGACVDLLGGLVHIGLGDPVVNKCCPVLQGLAEIEAAACLCTTLKLKLLNLNIYVP  213

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC+L
Sbjct  214  LALQLLLTCGKTPPPGYTCSL  234



>gb|KJB27067.1| hypothetical protein B456_004G2756001, partial [Gossypium raimondii]
Length=152

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGG VHVG+GDP VN CCP+LKGLVELEAA CLCTTLK+K LNL IY P
Sbjct  72   DTLKLGACVDLLGGAVHVGVGDPVVNACCPVLKGLVELEAAVCLCTTLKLKLLNLKIYAP  131

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL++CGKTPPPGYTC+L
Sbjct  132  IALQLLISCGKTPPPGYTCSL  152



>ref|XP_010687917.1| PREDICTED: 36.4 kDa proline-rich protein [Beta vulgaris subsp. 
vulgaris]
Length=274

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVDLLGGLVH+GLGDPAVN+CCPIL+GL   EA  CLCT+LK+K LNL++YVP
Sbjct  194  DILKLGACVDLLGGLVHIGLGDPAVNKCCPILQGLASAEAGVCLCTSLKLKLLNLNLYVP  253

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+TCGKTPPPG+TC++
Sbjct  254  IALQLLLTCGKTPPPGFTCSV  274



>ref|XP_010093116.1| hypothetical protein L484_009307 [Morus notabilis]
 gb|EXB53568.1| hypothetical protein L484_009307 [Morus notabilis]
Length=279

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV L+AA CLCTT+K K LN++I +P
Sbjct  199  DTLKLGACVDVLGGLIHIGIGSSAKDTCCPVLQGLVGLDAALCLCTTIKAKLLNINIILP  258

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQL+V CGKT PPG+ C
Sbjct  259  IALQLIVDCGKTAPPGFQC  277



>ref|XP_010055512.1| PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Eucalyptus 
grandis]
Length=265

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG C+D+LGGLVH+G+G+P  N CCP+L+GL+ELEAA CLCT +++K LNL+I++P
Sbjct  184  NALKLGLCLDVLGGLVHIGIGNPVENVCCPVLQGLLELEAAICLCTAIRLKLLNLNIFIP  243

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L TCG TPPPG+ C
Sbjct  244  LALQVLATCGITPPPGFVC  262



>ref|XP_009595816.1| PREDICTED: 36.4 kDa proline-rich protein [Nicotiana tomentosiformis]
Length=260

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVH+G+G+P  + CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  178  DALKLGLCLDVLGGLVHIGIGNPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFLP  237

Query  183  LALQLLVTCGKTPPPGYTC  239
            LAL +L TCG TPPPG+ C
Sbjct  238  LALSVLATCGLTPPPGFIC  256



>ref|XP_011100461.1| PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein-like 
[Sesamum indicum]
Length=268

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGLVH+G+G  A   CCP+L+GLV+L+AA CLCTT+K K LN++I +P
Sbjct  188  DTLKLGACVDVLGGLVHIGIGSSAKATCCPVLQGLVDLDAAICLCTTIKAKLLNINIILP  247

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++LV CGKTPP G+ C
Sbjct  248  IALEVLVDCGKTPPSGFQC  266



>gb|KJB37623.1| hypothetical protein B456_006G213000 [Gossypium raimondii]
Length=203

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG CVD+LGGL H+GLG+P  N CCP+L GL+ELEAA CLCT +++K LN++I++P
Sbjct  122  NALKLGLCVDVLGGLGHIGLGNPVENACCPVLGGLLELEAAVCLCTAIRLKLLNINIFIP  181

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQ L+TCGK PP G+ C L
Sbjct  182  LALQALITCGKNPPTGFICPL  202



>ref|XP_010055511.1| PREDICTED: 36.4 kDa proline-rich protein isoform X1 [Eucalyptus 
grandis]
 gb|KCW71993.1| hypothetical protein EUGRSUZ_E00446 [Eucalyptus grandis]
Length=276

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLG C+D+LGGLVH+G+G+P  N CCP+L+GL+ELEAA CLCT +++K LNL+I++P
Sbjct  195  NALKLGLCLDVLGGLVHIGIGNPVENVCCPVLQGLLELEAAICLCTAIRLKLLNLNIFIP  254

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L TCG TPPPG+ C
Sbjct  255  LALQVLATCGITPPPGFVC  273



>emb|CAA75594.1| MtN4 [Medicago truncatula]
Length=249

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGL+H+G+G  A   CCP+L+GLV+L+AA CLCTT+++K LN+++ +P
Sbjct  168  DALKLGACVDVLGGLIHIGIGGSAKQTCCPLLQGLVDLDAAICLCTTIRLKLLNINLVIP  227

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+ CGKTPP G+ C
Sbjct  228  LALQVLIDCGKTPPEGFKC  246



>ref|XP_010532493.1| PREDICTED: 36.4 kDa proline-rich protein-like [Tarenaya hassleriana]
Length=262

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNE-CCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GLG     E CCP+L GLV+L+AA CLCTT+K K LN+++ +
Sbjct  181  DTLKLGACVDILGGLIHIGLGKSHAKEACCPVLGGLVDLDAAVCLCTTIKAKLLNINLII  240

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LLV CGKTPPPG+ C
Sbjct  241  PIALELLVDCGKTPPPGFQC  260



>gb|KHN15055.1| 36.4 kDa proline-rich protein, partial [Glycine soja]
Length=153

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVE+EAA CLCTTLK+K LNL+IYVP
Sbjct  73   DTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVEVEAAVCLCTTLKLKLLNLNIYVP  132

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPGYTC+L
Sbjct  133  LALQLLVTCGKSPPPGYTCSL  153



>emb|CAA49341.1| ADR11 [Glycine max]
Length=151

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVE+EAA CLCTTLK+K LNL+IYVP
Sbjct  71   DTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVEVEAAVCLCTTLKLKLLNLNIYVP  130

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPGYTC+L
Sbjct  131  LALQLLVTCGKSPPPGYTCSL  151



>ref|XP_004508457.1| PREDICTED: 36.4 kDa proline-rich protein-like [Cicer arietinum]
Length=257

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            +TLKLGACVDLLGGLVH+G+GDP VN+CCP+L+GLVELEAAACLCTTLK+K LNL+IYVP
Sbjct  177  NTLKLGACVDLLGGLVHIGVGDPVVNQCCPVLQGLVELEAAACLCTTLKLKLLNLNIYVP  236

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+ CGKTPPPGYTC+L
Sbjct  237  LALQLLLACGKTPPPGYTCSL  257



>ref|XP_004245751.1| PREDICTED: 36.4 kDa proline-rich protein [Solanum lycopersicum]
Length=292

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVH+G+G+P  + CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  210  DALKLGLCLDVLGGLVHIGIGNPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFLP  269

Query  183  LALQLLVTCGKTPPPGYTC  239
            LAL +L TCG TPPPG+ C
Sbjct  270  LALSVLATCGLTPPPGFVC  288



>ref|XP_008362354.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Malus 
domestica]
Length=78

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  12   KLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLAL  191
            KLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P+AL
Sbjct  1    KLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNVNLIIPIAL  60

Query  192  QLLVTCGKTPPPGYTC  239
            Q+L+ CGKTPP G+ C
Sbjct  61   QVLIACGKTPPSGFQC  76



>ref|XP_006355521.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Solanum 
tuberosum]
Length=231

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVH+G+G+P  + CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  149  DALKLGLCLDVLGGLVHIGIGNPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFLP  208

Query  183  LALQLLVTCGKTPPPGYTC  239
            LAL +L TCG TPPPG+ C
Sbjct  209  LALSVLATCGLTPPPGFVC  227



>ref|XP_006301895.1| hypothetical protein CARUB_v10022370mg [Capsella rubella]
 gb|EOA34793.1| hypothetical protein CARUB_v10022370mg [Capsella rubella]
Length=307

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+GLG P  N CCP+L+GL+E+EAA CLCTT+++K LNL+I++P
Sbjct  225  NALKLGACVDVLGGLIHIGLGKPVENVCCPVLQGLLEIEAAVCLCTTIRLKLLNLNIFIP  284

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ L+TCG  PP G+ C
Sbjct  285  LALQALITCGINPPSGFVC  303



>ref|XP_003549740.1| PREDICTED: 36.4 kDa proline-rich protein [Glycine max]
Length=190

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVE+EAA CLCTTLK+K LNL+IYVP
Sbjct  110  DTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVEVEAAVCLCTTLKLKLLNLNIYVP  169

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGK+PPPGYTC+L
Sbjct  170  LALQLLVTCGKSPPPGYTCSL  190



>ref|XP_009759781.1| PREDICTED: 36.4 kDa proline-rich protein [Nicotiana sylvestris]
Length=323

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG C+D+LGGLVH+G+G+P  + CCP+L+GL+ELEAA CLCTT+++K LNL+I++P
Sbjct  241  DALKLGLCLDVLGGLVHIGIGNPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFLP  300

Query  183  LALQLLVTCGKTPPPGYTC  239
            LAL +L TCG TPPPG+ C
Sbjct  301  LALSVLATCGLTPPPGFIC  319



>gb|KCW47606.1| hypothetical protein EUGRSUZ_K01352, partial [Eucalyptus grandis]
Length=93

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  72   AVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCA  242
            A + CCP+L+GL++L+AA CLCTT+K K LN+SI +P+ALQ+L+ CGKTPP G+ CA
Sbjct  36   AKDTCCPVLQGLLDLDAAVCLCTTIKAKLLNISIVIPIALQVLIDCGKTPPSGFQCA  92



>ref|XP_003609406.1| proline-rich protein [Medicago truncatula]
Length=271

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GL E+EAAACLCTTLK+K LNL+IYVP
Sbjct  154  DTLKLGACVDLLGGLVHIGLGDPVVNKCCPVLQGLAEIEAAACLCTTLKLKLLNLNIYVP  213

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQLL+TCGKTPPPGYTC
Sbjct  214  LALQLLLTCGKTPPPGYTC  232



>ref|NP_001150138.1| 36.4 kDa proline-rich protein precursor [Zea mays]
 gb|ACG37997.1| 36.4 kDa proline-rich protein [Zea mays]
Length=263

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVHVGLGDP VN+CCP+L+GLVELEAA CLCTT+K++ LN+++Y+P
Sbjct  183  DSLKLGACVDLLGGLVHVGLGDPVVNQCCPVLEGLVELEAAVCLCTTIKLRLLNVNLYLP  242

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  243  LALQLLLTCGKTPPPGYTCTV  263



>ref|XP_008788893.1| PREDICTED: 36.4 kDa proline-rich protein-like [Phoenix dactylifera]
Length=190

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+GDP VN+CCP+L+GLVE+EAA CLCTT+++K LN+++Y+P
Sbjct  110  DTLKLGACVDLLGGLVHIGIGDPVVNKCCPLLEGLVEIEAAVCLCTTIRLKLLNINLYLP  169

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPG+TC +
Sbjct  170  LALQLLLTCGKTPPPGFTCTI  190



>gb|ACF88427.1| unknown [Zea mays]
 gb|AFW87301.1| hypothetical protein ZEAMMB73_062722 [Zea mays]
 gb|AFW87302.1| hypothetical protein ZEAMMB73_062722 [Zea mays]
Length=304

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTT+K++ LN+++Y+P
Sbjct  224  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLRLLNINLYLP  283

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  284  LALQLLLTCGKTPPPGYTCTV  304



>ref|XP_004166254.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis 
sativus]
Length=143

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGL+H+G+GD     CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  62   DTLKLGACVDLLGGLIHIGIGDRTKQTCCPVLEGLVDLDAAVCLCTTIKAKLLNINLIIP  121

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LV CGK PP G+ C
Sbjct  122  IALQVLVDCGKHPPSGFQC  140



>ref|XP_002437338.1| hypothetical protein SORBIDRAFT_10g025210 [Sorghum bicolor]
 gb|EER88705.1| hypothetical protein SORBIDRAFT_10g025210 [Sorghum bicolor]
Length=309

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTT+K+K LN+++Y+P
Sbjct  229  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLKLLNINLYLP  288

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  289  LALQLLLTCGKTPPPGYTCTI  309



>gb|KFK25004.1| hypothetical protein AALP_AA8G053900 [Arabis alpina]
Length=352

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GL    A  ECCP+L GLV+L+AA CLCTT+K K LNL + +
Sbjct  271  DTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLVDLDAAVCLCTTIKAKLLNLDLII  330

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPPPG+ C
Sbjct  331  PIALELLLDCGKTPPPGFKC  350



>gb|EYU42870.1| hypothetical protein MIMGU_mgv1a011120mg [Erythranthe guttata]
Length=292

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGLVH+G+G    N CCP+L+GLV+L+AA CLCT +K K LN++I +P
Sbjct  212  DTLKLGACVDVLGGLVHIGIGQSPKNACCPVLEGLVDLDAALCLCTAIKAKLLNINILIP  271

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LV CGKTPP G+ C
Sbjct  272  IALQVLVDCGKTPPYGFQC  290



>gb|EMS66044.1| 36.4 kDa proline-rich protein [Triticum urartu]
Length=122

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVD+L GLVH+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  38   DALKLNACVDVLSGLVHLVIGREARSKCCPLVQGVADLDAALCLCTTIRARVLNINIYLP  97

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK PP G+ C
Sbjct  98   VALRLLITCGKHPPNGFQC  116



>gb|EMT06542.1| 36.4 kDa proline-rich protein [Aegilops tauschii]
Length=114

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVD+L GLVH+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  30   DALKLNACVDVLSGLVHLVIGREARSKCCPLVQGVADLDAALCLCTTIRARVLNINIYLP  89

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK PP G+ C
Sbjct  90   VALRLLITCGKHPPNGFQC  108



>gb|AGT16397.1| hypothetical protein SHCRBa_181_K17_R_210 [Saccharum hybrid cultivar 
R570]
Length=318

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTT+K+K LN+++Y+P
Sbjct  238  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLKLLNINLYLP  297

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  298  LALQLLLTCGKTPPPGYTCTV  318



>ref|XP_009135778.1| PREDICTED: 36.4 kDa proline-rich protein-like [Brassica rapa]
Length=261

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNE-CCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GLG     E CCP+L GLV+L+AA CLCTT+K K LN+ + +
Sbjct  180  DTLKLGACVDVLGGLIHIGLGKTHAKEKCCPVLGGLVDLDAAVCLCTTIKAKLLNIDLII  239

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL++LV CGKTPPPG+ C
Sbjct  240  PIALEVLVACGKTPPPGFKC  259



>ref|XP_003542640.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
Length=227

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVELEAA CLCTTLK+K LNL+IYVP
Sbjct  147  DTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYVP  206

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLV CGK+PPPGYTC+L
Sbjct  207  LALQLLVACGKSPPPGYTCSL  227



>ref|XP_011001017.1| PREDICTED: 36.4 kDa proline-rich protein [Populus euphratica]
Length=359

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGLVH+G+G  A + CCP+L+GL++L+AA CLCTT+K K LN+SI +P
Sbjct  279  DTLKLGACVDVLGGLVHIGIGSSAKDACCPVLQGLLDLDAAICLCTTIKAKLLNISIIIP  338

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++LV CGKTPP G+ C
Sbjct  339  IALEVLVDCGKTPPEGFKC  357



>ref|NP_001144590.1| uncharacterized protein LOC100277605 precursor [Zea mays]
 gb|ACG41576.1| hypothetical protein [Zea mays]
Length=304

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTT+K++ LN+++Y+P
Sbjct  224  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLRLLNINLYLP  283

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  284  LALQLLLTCGKTPPPGYTCTV  304



>dbj|BAJ34557.1| unnamed protein product [Thellungiella halophila]
Length=335

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GL    A  ECCP+L GLV+L+AA CLCTT+K K LN+++ +
Sbjct  254  DTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLVDLDAAVCLCTTIKAKLLNINLIL  313

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPPPG+ C
Sbjct  314  PIALELLLDCGKTPPPGFKC  333



>ref|XP_002323166.2| hypothetical protein POPTR_0016s01720g [Populus trichocarpa]
 gb|EEF04927.2| hypothetical protein POPTR_0016s01720g [Populus trichocarpa]
Length=438

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGLVH+G+G  A + CCP+L+GL++L+AA CLCTT+K K LN+SI +P
Sbjct  358  DTLKLGACVDVLGGLVHIGIGSSAKDACCPVLQGLLDLDAAICLCTTIKAKLLNISIIIP  417

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++LV CGKTPP G+ C
Sbjct  418  IALEVLVDCGKTPPEGFKC  436



>ref|XP_004304516.1| PREDICTED: 36.4 kDa proline-rich protein [Fragaria vesca subsp. 
vesca]
Length=315

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGL+HVG+G  A + CCP+L+GL++L+AA CLCTT+++K LN++I +P
Sbjct  235  DALKLGACVDVLGGLIHVGIGGNAKDACCPVLQGLLDLDAAICLCTTIRLKLLNINIIIP  294

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+ CGKTPP G+ C
Sbjct  295  LALQVLIDCGKTPPDGFKC  313



>emb|CDP06245.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+G+G    + CCP+L+GLV+L+AA CLCTT+K K LN++I +P
Sbjct  318  DTLKLGACVDLLGGLVHIGIGSNVKSTCCPVLEGLVDLDAAVCLCTTIKAKLLNINILIP  377

Query  183  LALQLLVTCGKTPPPGYTCA  242
            +AL++LV CGKT PPG+ C+
Sbjct  378  IALEVLVDCGKTAPPGFQCS  397



>emb|CAA57810.1| proline-rich-like protein [Asparagus officinalis]
Length=184

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVDLLGGLVH+GLGDP VN+CCP+++GLVE+EAA CLCTT+++K LN+++Y+P
Sbjct  104  DALKLGACVDLLGGLVHIGLGDPVVNQCCPLIEGLVEIEAAVCLCTTIRLKLLNINLYLP  163

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC +
Sbjct  164  LALQLLLTCGKTPPPGYTCTI  184



>ref|XP_008464631.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis 
melo]
Length=216

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGL+H+G+GD     CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  135  DTLKLGACVDLLGGLIHIGIGDRTKQTCCPVLEGLVDLDAAVCLCTTIKAKLLNINLIIP  194

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+ CGK PP G+ C
Sbjct  195  IALQVLIDCGKHPPSGFQC  213



>ref|XP_004146070.1| PREDICTED: uncharacterized protein LOC101218239 [Cucumis sativus]
Length=254

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGL+H+G+GD     CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  173  DTLKLGACVDLLGGLIHIGIGDRTKQTCCPVLEGLVDLDAAVCLCTTIKAKLLNINLIIP  232

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+LV CGK PP G+ C
Sbjct  233  IALQVLVDCGKHPPSGFQC  251



>ref|XP_010490020.1| PREDICTED: 36.4 kDa proline-rich protein [Camelina sativa]
Length=202

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K K LN+++ +
Sbjct  121  DTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLLDLDAAVCLCTTIKAKLLNINLIL  180

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPPPG+ C
Sbjct  181  PIALELLLDCGKTPPPGFKC  200



>gb|AFH57274.1| proline-rich protein [Gossypium hirsutum]
Length=443

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGG VHVG+GDP VN CCP+LKGLVELEAA CLCTTLK+K LNL IY P
Sbjct  363  DTLKLGACVDLLGGAVHVGVGDPVVNACCPVLKGLVELEAAVCLCTTLKLKLLNLKIYAP  422

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLL+ CGKTPPPGYTC+L
Sbjct  423  IALQLLIPCGKTPPPGYTCSL  443



>ref|XP_003601475.1| Proline rich protein [Medicago truncatula]
 gb|AES71726.1| Lipid transfer protein [Medicago truncatula]
Length=338

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGL+H+G+G  A   CCP+L+GLV+L+AA CLCTT+++K LN+++ +P
Sbjct  257  DALKLGACVDVLGGLIHIGIGGSAKQTCCPLLQGLVDLDAAICLCTTIRLKLLNINLVIP  316

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+ CGKTPP G+ C
Sbjct  317  LALQVLIDCGKTPPEGFKC  335



>ref|XP_008342311.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=311

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  231  DTLKLGACVDVLGGLIHIGIGSXAKDXCCPVLQGLVDLDAAICLCTTIKAKLLNVNLIIP  290

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+ CGKTP  G+ C
Sbjct  291  IALQVLIDCGKTPLSGFQC  309



>ref|XP_003560341.1| PREDICTED: 36.4 kDa proline-rich protein-like [Brachypodium distachyon]
Length=274

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LK+GACVDLLGGLVHVGLGDPAVN CCP+L GLVELEAA CLCTT+++K LN+++Y+P
Sbjct  194  DSLKIGACVDLLGGLVHVGLGDPAVNTCCPLLAGLVELEAAVCLCTTIRLKLLNINLYLP  253

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPPGYTC++
Sbjct  254  LALQLLLTCGKTPPPGYTCSV  274



>emb|CAA47812.1| ptxA [Pisum sativum]
Length=352

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGL+H+G+G  A   CCP+L+GLV+L+AA CLCTT+++K LN+++ +P
Sbjct  271  DALKLGACVDVLGGLIHIGIGGSAKQTCCPLLQGLVDLDAAVCLCTTIRLKLLNINLVIP  330

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+ CGKTPP G+ C
Sbjct  331  LALQVLIDCGKTPPEGFKC  349



>ref|XP_006453085.1| hypothetical protein CICLE_v10009567mg [Citrus clementina]
 ref|XP_006474415.1| PREDICTED: 36.4 kDa proline-rich protein-like [Citrus sinensis]
 gb|ESR66325.1| hypothetical protein CICLE_v10009567mg [Citrus clementina]
 gb|KDO73488.1| hypothetical protein CISIN_1g029294mg [Citrus sinensis]
 gb|KDO73489.1| hypothetical protein CISIN_1g029294mg [Citrus sinensis]
Length=195

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LNL+IY+P
Sbjct  115  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYLP  174

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLLVTCGKTPP G+TC L
Sbjct  175  LALQLLVTCGKTPPAGFTCTL  195



>dbj|BAE71274.1| hypothetical protein [Trifolium pratense]
Length=240

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP  N+CCPIL+GL E+EAAACLCTTLK+K LNL+IYVP
Sbjct  160  DTLKLGACVDLLGGLVHIGLGDPTANKCCPILQGLAEIEAAACLCTTLKLKLLNLNIYVP  219

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+ CGKTPPPGYTC+L
Sbjct  220  LALQLLLACGKTPPPGYTCSL  240



>gb|EEC84097.1| hypothetical protein OsI_30410 [Oryza sativa Indica Group]
Length=246

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVD+LGGL+H+ +G  A  +CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  162  DALKLNACVDVLGGLIHLVIGQKARAKCCPLVQGVADLDAALCLCTTIRARLLNINIYLP  221

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK PPPG+ C
Sbjct  222  VALELLITCGKHPPPGFKC  240



>ref|NP_001056927.1| Os06g0168700 [Oryza sativa Japonica Group]
 dbj|BAD67619.1| putative prolin rich protein [Oryza sativa Japonica Group]
 dbj|BAD67971.1| putative prolin rich protein [Oryza sativa Japonica Group]
 dbj|BAF18841.1| Os06g0168700 [Oryza sativa Japonica Group]
 dbj|BAG95000.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96181.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVD+LGGL+H+ +G  A  +CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  162  DALKLNACVDVLGGLIHLVIGQKARAKCCPLVQGVADLDAALCLCTTIRARLLNINIYLP  221

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK PPPG+ C
Sbjct  222  VALELLITCGKHPPPGFKC  240



>gb|EAZ35967.1| hypothetical protein OsJ_20271 [Oryza sativa Japonica Group]
Length=258

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVD+LGGL+H+ +G  A  +CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  174  DALKLNACVDVLGGLIHLVIGQKARAKCCPLVQGVADLDAALCLCTTIRARLLNINIYLP  233

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK PPPG+ C
Sbjct  234  VALELLITCGKHPPPGFKC  252



>gb|KDP30246.1| hypothetical protein JCGZ_17028 [Jatropha curcas]
Length=218

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVH+GLGDP VN+CCP+++GL  LEAA CLCTTLK+K LNL++YVP
Sbjct  138  DTLKLGACVDLLGGLVHIGLGDPVVNQCCPVIEGLAGLEAAVCLCTTLKLKLLNLNVYVP  197

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            +ALQLLVTCGKTPPPGYTC+L
Sbjct  198  IALQLLVTCGKTPPPGYTCSL  218



>ref|XP_002437917.1| hypothetical protein SORBIDRAFT_10g004790 [Sorghum bicolor]
 gb|EER89284.1| hypothetical protein SORBIDRAFT_10g004790 [Sorghum bicolor]
Length=324

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++++ LN++IY+P
Sbjct  241  DTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGIADLDAALCLCTTIRLRLLNINIYLP  300

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL LL+TCGK PP G+ C
Sbjct  301  IALNLLITCGKHPPSGFQC  319



>gb|AAD03487.1| proline-rich cell wall protein [Medicago sativa]
Length=381

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGL+H+G+G  A   CCP+L+GLV+L+AA CLCTT+++K LN+++ +P
Sbjct  300  DALKLGACVDVLGGLIHIGIGGSAKQTCCPLLQGLVDLDAAICLCTTIRLKLLNINLVIP  359

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L+ CGKTPP G+ C
Sbjct  360  LALQVLIDCGKTPPEGFKC  378



>gb|AAF32353.1|AF220197_1 proline rich protein 2, partial [Vitis riparia]
Length=56

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  78   NECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTC  239
            + CCP+L+GLV+L+AA CLCT +K+K LN++I +P+ALQ+LV CGKTPP G+ C
Sbjct  1    DTCCPVLQGLVDLDAAVCLCTGIKVKLLNVNIIIPIALQVLVGCGKTPPSGFQC  54



>ref|XP_006853546.1| hypothetical protein AMTR_s00032p00233360 [Amborella trichopoda]
 gb|ERN15013.1| hypothetical protein AMTR_s00032p00233360 [Amborella trichopoda]
Length=171

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVDLLGGLVH+ +G+     CCP+++G+ +L+AA C CTT+K+KALNL++ +P
Sbjct  92   DALKLGACVDLLGGLVHLVIGEQVNKNCCPLVQGVADLDAALCFCTTIKVKALNLNVVLP  151

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+LV CGK+ PPG+ C
Sbjct  152  LALQVLVGCGKSVPPGFNC  170



>dbj|BAJ89958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVD+L GLVH+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  181  DALKLNACVDVLSGLVHLVIGREARSKCCPLVQGVADLDAALCLCTTIRARVLNINIYLP  240

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK PP G+ C
Sbjct  241  VALRLLITCGKHPPNGFQC  259



>dbj|BAJ88732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=267

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LK+GACVDLLGGLVHVGLGDP VN+CCP+L+GLVELEAA CLCTT+++K LN+++ +P
Sbjct  187  DSLKIGACVDLLGGLVHVGLGDPVVNKCCPLLQGLVELEAAVCLCTTIRLKLLNINLVLP  246

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPPP YTC++
Sbjct  247  LALQLLLTCGKTPPPSYTCSI  267



>gb|AGT16919.1| proline-rich protein [Saccharum hybrid cultivar R570]
Length=344

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  261  DTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGVADLDAALCLCTTIRARVLNINIYLP  320

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL LL+TCGK PP G+ C
Sbjct  321  IALNLLITCGKHPPSGFQC  339



>ref|XP_010038743.1| PREDICTED: 36.4 kDa proline-rich protein-like [Eucalyptus grandis]
Length=225

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  72   AVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCA  242
            A + CCP+L+GL++L+AA CLCTT+K K LN+SI +P+ALQ+L+ CGKTPP G+ CA
Sbjct  168  AKDTCCPVLQGLLDLDAAVCLCTTIKAKLLNISIVIPIALQVLIDCGKTPPSGFQCA  224



>ref|XP_008785888.1| PREDICTED: 36.4 kDa proline-rich protein-like [Phoenix dactylifera]
Length=208

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVDLLGGLVHVG+G  A   CCP+L+GL +L+AA CLCTT++ K LN++I +P
Sbjct  126  DTLKLGACVDLLGGLVHVGIGKKAKATCCPLLEGLADLDAALCLCTTIRAKLLNINIVLP  185

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+L++ CGK PP GY C
Sbjct  186  IALELMIGCGKHPPSGYQC  204



>ref|XP_010420896.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=429

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGLVH+G+G  A  +CCP+L+GLV+L+AAACLCTT+K K LN+ +  P
Sbjct  47   DTLKLGACVDVLGGLVHIGIGKSAKEKCCPLLEGLVDLDAAACLCTTIKAKLLNIELVFP  106

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L+ CGK PPPG+ C
Sbjct  107  IALEVLLGCGKKPPPGFQC  125


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGLVH+G+G  A  +CCP+L+GLV+L+AAACLCTT+K K LN+ +  P
Sbjct  193  DTLKLGACVDVLGGLVHIGIGKSAKEKCCPLLEGLVDLDAAACLCTTIKAKLLNIELVFP  252

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L+ CGK PPPG+ C
Sbjct  253  IALEVLLGCGKKPPPGFQC  271


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+G+G+ A  +CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  349  NPLKLGACVDVLGGLIHIGIGNNAKEKCCPVLEGLVDLDAAVCLCTTIKAKLLNINLILP  408

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L+ CGK PP G+ C
Sbjct  409  IALEVLLDCGKKPPSGFKC  427



>ref|XP_003564254.1| PREDICTED: 36.4 kDa proline-rich protein-like [Brachypodium distachyon]
Length=239

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVDLLGGLVH  +G  A ++CCP+++G+ +L+AA CLCTT++ + L ++IY+P
Sbjct  155  DALKLNACVDLLGGLVHAVIGKEARSKCCPLVQGVADLDAALCLCTTIRARLLGINIYLP  214

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK PP G+TC
Sbjct  215  VALRLLITCGKHPPNGFTC  233



>ref|XP_009145429.1| PREDICTED: 36.4 kDa proline-rich protein-like [Brassica rapa]
Length=340

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglg-dPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GLG   A  ECCP+L GLV+L+AA CLCTT+K K L + + +
Sbjct  259  DTLKLGACVDVLGGLIHIGLGGSSAKKECCPVLGGLVDLDAAVCLCTTIKAKLLIVDLII  318

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPPPG+ C
Sbjct  319  PIALELLIDCGKTPPPGFKC  338



>gb|EMT21385.1| 36.4 kDa proline-rich protein [Aegilops tauschii]
Length=232

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LK+GACVDLLGGLVHVGLGDP VN+CCP+L+GLVELEAA CLCTT+++K LN+++ +P
Sbjct  152  DSLKIGACVDLLGGLVHVGLGDPVVNKCCPLLEGLVELEAAVCLCTTIRLKLLNINLVLP  211

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LALQLL+TCGKTPP GYTC++
Sbjct  212  LALQLLLTCGKTPPTGYTCSI  232



>ref|XP_010466481.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=246

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG+CVD+LGGLVH+G+G  A  +CCPI++GLV+L+AA CLCTT+K K LN+ +  P
Sbjct  10   DTLKLGSCVDVLGGLVHIGIGKSAKEKCCPIIEGLVDLDAAVCLCTTIKAKLLNVELVFP  69

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L+ CGK PPPG+ C
Sbjct  70   IALEVLLGCGKKPPPGFQC  88


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+G+G+ A  +CCP+L+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  166  NPLKLGACVDVLGGLIHIGIGNNAKEKCCPVLEGLVDLDAAVCLCTTIKAKLLNINLILP  225

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L+ CGK PP G+ C
Sbjct  226  IALEVLLDCGKKPPSGFKC  244



>ref|XP_004966695.1| PREDICTED: 36.4 kDa proline-rich protein-like [Setaria italica]
Length=296

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  213  DALKLNACVDVLSGLIHLVIGQEARSKCCPLVQGIADLDAALCLCTTIRARLLNINIYLP  272

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK  PPG+ C
Sbjct  273  VALELLITCGKHAPPGFKC  291



>gb|AAC06386.1| proline rich protein, partial [Malus domestica]
Length=75

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  72   AVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTC  239
            A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P+ LQ+L+ CGKTPP G+ C
Sbjct  18   AKDACCPVLQGLVDLDAAICLCTTIKAKLLNINLIIPIVLQVLIDCGKTPPSGFQC  73



>emb|CAA64425.1| cell wall-plasma membrane linker protein [Brassica napus]
Length=376

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglg-dPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GLG   A  ECCP+L GLV+L+AA CLCTT+K K L + + +
Sbjct  295  DTLKLGACVDVLGGLIHIGLGGSSAKKECCPVLGGLVDLDAAVCLCTTIKAKLLIVDLII  354

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPPPG+ C
Sbjct  355  PIALELLIDCGKTPPPGFKC  374



>gb|AAS20977.1| protease inhibitor/seed storage/lipid transfer protein [Hyacinthus 
orientalis]
Length=113

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            +TLKLG C+D+LGG++H G   PAV +CCP++ GL  ++AAACLCT +K+KA  +++YVP
Sbjct  37   NTLKLGTCLDVLGGIIHAGD--PAV-DCCPLIAGLTSVQAAACLCTAIKLKAGGVNLYVP  93

Query  183  LALQLLVTCGKTPPPGYTC  239
            +A++LLVTCGK PPPGY C
Sbjct  94   IAVELLVTCGKKPPPGYKC  112



>ref|XP_010466478.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Camelina 
sativa]
 ref|XP_010466479.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Camelina 
sativa]
Length=371

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K K LN+++ +
Sbjct  290  DTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLLDLDAAVCLCTTIKAKLLNINLIL  349

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPPPG+ C
Sbjct  350  PIALELLLDCGKTPPPGFKC  369



>ref|XP_010510955.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=358

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvg-lgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+G     A  ECCP+L GL++L+AA CLCTT+K K LN+++ +
Sbjct  277  DTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLLDLDAAVCLCTTIKAKLLNINLIL  336

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPPPG+ C
Sbjct  337  PIALELLLDCGKTPPPGFKC  356



>ref|XP_006856527.1| hypothetical protein AMTR_s00046p00138910 [Amborella trichopoda]
 gb|ERN17994.1| hypothetical protein AMTR_s00046p00138910 [Amborella trichopoda]
Length=240

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGLVHVGLG    +ECCP+++GL +++A  CLC ++++K LNL I+VP
Sbjct  159  DALKLGACVDMLGGLVHVGLGVHVADECCPLIQGLADIQATLCLCNSIRMKLLNLKIFVP  218

Query  183  LALQLLVTCGKTPPPGYTCAL  245
            LAL+LLVTCG  PPP + C +
Sbjct  219  LALKLLVTCGMNPPPDFACPM  239



>ref|XP_004502092.1| PREDICTED: repetitive proline-rich cell wall protein 2-like [Cicer 
arietinum]
Length=419

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNE-CCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            D LKLGACVD+LGGL+H+G+G  +  + CCP+L+GLV+L+AA CLCT++K+K LN+++ +
Sbjct  338  DVLKLGACVDVLGGLIHIGIGGSSAKQTCCPLLQGLVDLDAALCLCTSIKLKLLNINLVI  397

Query  180  PLALQLLVTCGKTPPPGYTCA  242
            P+ALQLL+ CGK PP G+ CA
Sbjct  398  PIALQLLIDCGKNPPEGFKCA  418



>ref|XP_002307866.2| hypothetical protein POPTR_0006s01030g [Populus trichocarpa]
 gb|EEE91389.2| hypothetical protein POPTR_0006s01030g [Populus trichocarpa]
Length=216

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGLVH+  G    +ECCP+L+G ++L+ A+CL   +K K LN+++ +P
Sbjct  136  DTLKLGACVDVLGGLVHIRTGSSVNDECCPVLEGFIDLDVASCLDIVIKAKLLNINLIIP  195

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L  CGKTPPPG+ C
Sbjct  196  IALKVLAECGKTPPPGFKC  214



>ref|XP_006652908.1| PREDICTED: 36.4 kDa proline-rich protein-like [Oryza brachyantha]
Length=251

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLG CVDLLG  VH+G    A  +CCP++KG+  L AAACLCT +K K L+LSIYVP
Sbjct  175  DALKLGVCVDLLGNEVHIG---DAHVQCCPLVKGIAGLSAAACLCTAIKAKVLDLSIYVP  231

Query  183  LALQLLVTCGKTPPPGYTCA  242
            +AL LLV CG   PPGYTCA
Sbjct  232  IALSLLVNCGCDVPPGYTCA  251



>gb|ABK26093.1| unknown [Picea sitchensis]
Length=220

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGLVHV LGD AVN+CCP+L+G++ LEAA CLCTT+K K LNL+I +P
Sbjct  138  DALKLGACVDVLGGLVHVSLGDSAVNQCCPLLQGVLSLEAALCLCTTIKAKLLNLNIILP  197

Query  183  LALQLLVTCGKTPPPGYTC  239
            LAL+LLV CG +PPPG+TC
Sbjct  198  LALELLVFCGNSPPPGFTC  216



>gb|ACN36521.1| unknown [Zea mays]
Length=284

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  201  DTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGVADLDAALCLCTTIRARLLNINIYLP  260

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL LL+TCGK  P G+ C
Sbjct  261  IALNLLITCGKHAPSGFQC  279



>gb|ACG39902.1| 36.4 kDa proline-rich protein [Zea mays]
Length=284

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  201  DTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGVADLDAALCLCTTIRARLLNINIYLP  260

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL LL+TCGK  P G+ C
Sbjct  261  IALNLLITCGKHAPSGFQC  279



>ref|NP_001149720.1| hybrid proline-rich protein1 precursor [Zea mays]
 emb|CAA42959.1| proline rich protein [Zea mays]
 gb|ACG36519.1| 36.4 kDa proline-rich protein [Zea mays]
 gb|ACL52767.1| unknown [Zea mays]
 gb|AFW85655.1| hybrid proline-rich protein1 [Zea mays]
Length=301

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  218  DTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGVADLDAALCLCTTIRARLLNINIYLP  277

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL LL+TCGK  P G+ C
Sbjct  278  IALNLLITCGKHAPSGFQC  296



>ref|XP_006655834.1| PREDICTED: 36.4 kDa proline-rich protein-like [Oryza brachyantha]
Length=218

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKL ACVD+LGGL+H+ +G  A  +CCP+++G+ +L+AA CLCTT++ + LN++IY+P
Sbjct  135  DALKLNACVDVLGGLIHLVIGQKAKAKCCPLVQGVADLDAALCLCTTIRARLLNINIYLP  194

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LL+TCGK PP G+ C
Sbjct  195  VALELLITCGKHPPEGFKC  213



>ref|XP_006853490.1| hypothetical protein AMTR_s00032p00211090 [Amborella trichopoda]
 gb|ERN14957.1| hypothetical protein AMTR_s00032p00211090 [Amborella trichopoda]
Length=172

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVDLLGG+ H  +G+     CCP+++G+ +L+AA CLCTT++ KALNL++ +P
Sbjct  93   DTLKLAACVDLLGGVAHAVIGEEVKKGCCPLVQGVADLDAALCLCTTIRAKALNLNVVLP  152

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+ CGK+ PPG+ C
Sbjct  153  IALQVLIGCGKSVPPGFQC  171



>gb|ABK24042.1| unknown [Picea sitchensis]
 gb|ABK26117.1| unknown [Picea sitchensis]
Length=197

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGLVHV LGD AVN+CCP+L+G++ LEAA CLCTT+K K LNL+I +P
Sbjct  115  DALKLGACVDVLGGLVHVSLGDSAVNQCCPLLQGVLSLEAALCLCTTIKAKLLNLNIILP  174

Query  183  LALQLLVTCGKTPPPGYTC  239
            LAL+LLV CG +PPPG+TC
Sbjct  175  LALELLVFCGNSPPPGFTC  193



>gb|ADW66157.1| proline-rich protein [Solanum nigrum]
Length=89

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D LKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCTT+K+K LN++I +P
Sbjct  8    DALKLGACVDVLGGLIHIGIGGSAKQTCCPLLHGLVDLDAAICLCTTIKLKLLNINIILP  67

Query  183  LALQLLV-TCGKTPPPGYTC  239
            +ALQ+LV  CGK PP  + C
Sbjct  68   IALQVLVDDCGKYPPKDFKC  87



>ref|XP_009380947.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=155

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVDLLGGLVH  +G    ++CCP+++GL +L+AA CLCTT+K KAL++++ +P
Sbjct  75   DTLKLDACVDLLGGLVHAVIGQDTQDKCCPVIQGLADLDAALCLCTTIKAKALDINVLLP  134

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LLV CGK  P  Y C
Sbjct  135  IALELLVDCGKHVPSDYQC  153



>gb|ABR13301.1| putative proline-rich cell wall protein [Prunus dulcis]
Length=130

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN++I +P
Sbjct  50   DTLKLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNINIIIP  109

Query  183  LALQLLVTCGKTPPPGYTC  239
            +ALQ+L+ CGKTPP G+ C
Sbjct  110  IALQVLIDCGKTPPSGFQC  128



>gb|AAD11796.1| cell wall-plasma membrane linker protein homolog [Arabidopsis 
thaliana]
Length=306

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K+K LN+ + +
Sbjct  225  DTLKLGACVDVLGGLIHIGLGKSHAKAECCPVLGGLLDLDAAVCLCTTIKLKLLNIDLVL  284

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPP  + C
Sbjct  285  PIALELLLDCGKTPPSDFKC  304



>gb|AAF75825.1|AF101789_1 proline-rich protein [Pinus taeda]
Length=139

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVDLL GLVHVGLGDP VN+CCP+++G+  LEAA CLCTT++ K L+L++ +P
Sbjct  58   NALKLGACVDLLQGLVHVGLGDPVVNQCCPLIQGVAALEAALCLCTTIRAKVLSLNVLLP  117

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL L+ +CG T PP + C
Sbjct  118  IALSLVASCGLTVPPDFKC  136



>ref|XP_009414495.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=210

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVDLLGGLVHV +G     +CCP+L+GL +L+AA CLCTT+K KAL +SI +P
Sbjct  129  DTLKLDACVDLLGGLVHVIIGGDVTYQCCPVLEGLADLDAALCLCTTIKAKALGISILLP  188

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++LV CGK  P  Y C
Sbjct  189  IALEVLVDCGKHVPSDYQC  207



>ref|XP_010680174.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=493

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVD+LGGL+H+G+G  A   CCPIL GLV L+AA CLCTT++ K LN++I +P
Sbjct  411  DTLKLNACVDVLGGLIHIGIGSGAKGACCPILGGLVGLDAAVCLCTTIRAKLLNINIILP  470

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L  CGK+PPPG+ C
Sbjct  471  LALQVLADCGKSPPPGFQC  489



>gb|EMS54619.1| 14 kDa proline-rich protein DC2.15 [Triticum urartu]
Length=113

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG C+DLLG  +H+G    A  +CCP+++G+  L AAACLCT +K K LNL++YVP
Sbjct  36   DTLKLGVCLDLLGNELHIGD---ASVKCCPLVEGIAGLTAAACLCTAIKAKVLNLALYVP  92

Query  183  LALQLLVT-CGKTPPPGYTCA  242
            LALQLLV  CG   PPGYTCA
Sbjct  93   LALQLLVNDCGCAVPPGYTCA  113



>ref|XP_010680173.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=553

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVD+LGGL+H+G+G  A   CCPIL GLV L+AA CLCTT++ K LN++I +P
Sbjct  471  DTLKLNACVDVLGGLIHIGIGSGAKGACCPILGGLVGLDAAVCLCTTIRAKLLNINIILP  530

Query  183  LALQLLVTCGKTPPPGYTC  239
            LALQ+L  CGK+PPPG+ C
Sbjct  531  LALQVLADCGKSPPPGFQC  549



>ref|XP_010490022.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=137

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            + LKLGACVD+LGGL+H+G+G+ A  +CCPIL+GLV+L+AA CLCTT+K K LN+++ +P
Sbjct  57   NPLKLGACVDVLGGLIHIGIGNNAKEKCCPILEGLVDLDAAVCLCTTIKAKLLNINLILP  116

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL++L+ CGK PP G+ C
Sbjct  117  IALEVLLDCGKKPPSGFKC  135



>gb|KHN31117.1| 36.4 kDa proline-rich protein [Glycine soja]
Length=349

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCTT++ K LN++I +P
Sbjct  268  DTLKLGACVDVLGGLIHIGIGSSAQQTCCPVLAGLVDLDAAVCLCTTIRAKILNINIIIP  327

Query  183  LALQLLVTCGKTPPPGYTCA  242
            +ALQLL+ CGKTPP G+ CA
Sbjct  328  IALQLLIDCGKTPPDGFKCA  347



>ref|NP_567391.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_567392.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB41721.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB41722.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78294.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78295.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAO23622.1| At4g12520 [Arabidopsis thaliana]
 dbj|BAE99415.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83141.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE83142.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=129

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG C ++L  L+ + LG P V  CC +L GLV+LEAAACLCT LK K L +++ VP
Sbjct  49   DTLKLGVCANVLKDLLKIQLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKVLGINLNVP  108

Query  183  LALQLLVT-CGKTPPPGYTCA  242
            ++L LL+  CGK  P G+ CA
Sbjct  109  VSLSLLLNVCGKKVPSGFVCA  129



>gb|KJB42884.1| hypothetical protein B456_007G172300 [Gossypium raimondii]
Length=283

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGLVH+G+G  A + CCP+L+GL++L+AA CLCTT+K K LN++I +P
Sbjct  203  DTLKLGACVDVLGGLVHIGIGSSAKDTCCPVLQGLLDLDAAICLCTTIKAKLLNINIIIP  262

Query  183  LALQLLVTCGKTPPPGYTC  239
            + LQ+L+ CGKTPPPG+ C
Sbjct  263  IGLQVLIDCGKTPPPGFQC  281



>ref|XP_010914263.1| PREDICTED: 36.4 kDa proline-rich protein [Elaeis guineensis]
Length=183

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKL ACVDLLGGLVHVG+G+    +CCP+L+GL +L+AA CLCTT+K K LN++I +P
Sbjct  103  DTLKLDACVDLLGGLVHVGIGEDEKEKCCPVLEGLADLDAALCLCTTIKAKVLNINIILP  162

Query  183  LALQLLVTCGKTPPPGYTC  239
            +AL+LLV CGK  P  Y C
Sbjct  163  VALELLVDCGKHLPSDYQC  181



>ref|XP_003542174.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
Length=384

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCTT++ K LN++I +P
Sbjct  303  DTLKLGACVDVLGGLIHIGIGSSAQQTCCPVLAGLVDLDAAVCLCTTIRAKILNINIIIP  362

Query  183  LALQLLVTCGKTPPPGYTCA  242
            +ALQLL+ CGKTPP G+ CA
Sbjct  363  IALQLLIDCGKTPPDGFKCA  382



>ref|XP_006396750.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
 gb|ESQ38203.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
Length=135

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLG C ++L  L+ + +G P V  CC +LKGLV+LEAAACLCT LK   L + + VP
Sbjct  55   DTLKLGVCANVLKDLLKIDVGKPPVKPCCSVLKGLVDLEAAACLCTALKANVLGIKLNVP  114

Query  183  LALQLLVT-CGKTPPPGYTCA  242
            ++L LL+  CG+  P G+ CA
Sbjct  115  ISLSLLLNVCGRKTPSGFICA  135



>ref|XP_006605589.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
 gb|KHN35493.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=328

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            D+LKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCTT++ K LN++I +P
Sbjct  247  DSLKLGACVDVLGGLIHIGIGSSAKQTCCPVLAGLVDLDAAVCLCTTIRAKILNINIIIP  306

Query  183  LALQLLVTCGKTPPPGYTCA  242
            +ALQLL+ CGKTPP G+ CA
Sbjct  307  IALQLLIDCGKTPPDGFKCA  326



>gb|AGW00930.1| PRP [Citrus trifoliata]
Length=176

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNL-SIYV  179
            D LKLGACVD+LGGL+H+GLGD A  +CCP+L+GL +L+AA CLCT +++KALNL ++ V
Sbjct  94   DALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLLV  153

Query  180  PLALQLLVT-CGKTPPPGYTC  239
            P++LQ+LV  CGK PP G+ C
Sbjct  154  PISLQVLVNDCGKYPPAGFQC  174



>ref|NP_188851.2| cell wall-plasma membrane linker protein [Arabidopsis thaliana]
 dbj|BAB03061.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABN04755.1| At3g22120 [Arabidopsis thaliana]
 gb|AEE76592.1| cell wall-plasma membrane linker protein [Arabidopsis thaliana]
Length=334

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            DTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K+K LN+ + +
Sbjct  253  DTLKLGACVDVLGGLIHIGLGKSHAKAECCPVLGGLLDLDAAVCLCTTIKLKLLNIDLVL  312

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LL+ CGKTPP  + C
Sbjct  313  PIALELLLDCGKTPPSDFKC  332



>gb|ACU22880.1| unknown [Glycine max]
Length=207

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  182
            DTLKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCT ++ K LN++I +P
Sbjct  126  DTLKLGACVDVLGGLIHIGIGSSAQQTCCPVLAGLVDLDAAVCLCTIIRAKILNINIIIP  185

Query  183  LALQLLVTCGKTPPPGYTCA  242
            +ALQLL+ CGKTPP G+ CA
Sbjct  186  IALQLLIDCGKTPPDGFKCA  205



>ref|XP_010440330.1| PREDICTED: 36.4 kDa proline-rich protein [Camelina sativa]
Length=288

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdP-AVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            D LKLGACVD+LGGL+H+GLG   A  +CCP+L GLV L+AA CLCTT++ K LN+ + +
Sbjct  198  DALKLGACVDVLGGLIHIGLGKTYAKAKCCPLLDGLVGLDAAVCLCTTIRAKLLNIDLVI  257

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LLV CGKTPP G+ C
Sbjct  258  PIALELLVDCGKTPPRGFKC  277



>ref|XP_002870258.1| hypothetical protein ARALYDRAFT_493374 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46517.1| hypothetical protein ARALYDRAFT_493374 [Arabidopsis lyrata subsp. 
lyrata]
Length=451

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    DTLKLGACvdllgglvhvglgdP-AVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  179
            D LKLGACVD+LGGL+H+GLG   A  +CCP+L+GL  ++AA CLCTT++ K LN+ + +
Sbjct  161  DALKLGACVDVLGGLIHIGLGKSYAKAKCCPLLEGLASVDAAVCLCTTIRAKLLNIDLII  220

Query  180  PLALQLLVTCGKTPPPGYTC  239
            P+AL+LLV CGKTPP G+ C
Sbjct  221  PIALELLVDCGKTPPRGFKC  240



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720