BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN005I01

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587203.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     264   1e-82   Nicotiana tomentosiformis
ref|XP_009770088.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     262   9e-82   Nicotiana sylvestris
ref|XP_006357690.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    246   2e-75   Solanum tuberosum [potatoes]
gb|ADZ24701.1|  4-hydroxyphenylpyruvate dioxygenase 2                   244   4e-75   Solanum pennellii
ref|XP_006354418.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    244   6e-75   Solanum tuberosum [potatoes]
ref|XP_004240171.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    244   6e-75   Solanum lycopersicum
ref|XP_011100559.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    228   1e-68   
gb|EYU42802.1|  hypothetical protein MIMGU_mgv1a005210mg                228   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_011100558.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    228   4e-68   Sesamum indicum [beniseed]
ref|XP_002520369.1|  4-hydroxyphenylpyruvate dioxygenase, putative      224   4e-67   Ricinus communis
gb|ACN78586.1|  4-hydroxyphenylpyruvate dioxygenase                     224   6e-67   Lactuca sativa [cultivated lettuce]
ref|XP_004491317.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    218   6e-65   Cicer arietinum [garbanzo]
sp|O23920.1|HPPD_DAUCA  RecName: Full=4-hydroxyphenylpyruvate dio...    218   1e-64   Daucus carota [carrots]
ref|XP_010087866.1|  4-hydroxyphenylpyruvate dioxygenase                216   3e-64   Morus notabilis
gb|AGO59892.1|  hydroxyphenylpyruvate dioxygenase                       216   7e-64   Perilla frutescens [beefsteak-mint]
gb|ADZ24700.1|  4-hydroxyphenylpyruvate dioxygenase 1                   214   1e-63   Solanum pennellii
ref|XP_010688905.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    214   2e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011026229.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    213   5e-63   Populus euphratica
gb|AGG10562.1|  4-hydroxyphenylpyruvate dioxygenase                     213   7e-63   Amaranthus tuberculatus
gb|KDP45435.1|  hypothetical protein JCGZ_09684                         213   7e-63   Jatropha curcas
gb|KDO51876.1|  hypothetical protein CISIN_1g013898mg                   211   7e-63   Citrus sinensis [apfelsine]
ref|XP_004243609.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     213   7e-63   Solanum lycopersicum
ref|XP_009119049.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     213   9e-63   Brassica rapa
dbj|BAH10638.1|  4-hydroxyphenylpyruvate dioxygenase                    212   1e-62   Hevea brasiliensis [jebe]
ref|XP_006437130.1|  hypothetical protein CICLE_v10031587mg             212   1e-62   Citrus clementina [clementine]
ref|NP_001154311.1|  4-hydroxyphenylpyruvate dioxygenase                211   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AID81984.1|  hydroxyphenylpyruvate dioxygenase                       212   2e-62   Capsella bursa-pastoris
pdb|1SQD|A  Chain A, Structural Basis For Inhibitor Selectivity R...    211   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307507.1|  hypothetical protein CARUB_v10009131mg             211   3e-62   Capsella rubella
sp|P93836.2|HPPD_ARATH  RecName: Full=4-hydroxyphenylpyruvate dio...    211   3e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDY06652.1|  BnaA10g04310D                                          211   3e-62   
gb|AAC62457.1|  p-hydroxyphenylpyruvate dioxygenase                     210   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172144.2|  4-hydroxyphenylpyruvate dioxygenase                   212   4e-62   
gb|AAM96960.1|  4-hydroxyphenylpyruvate dioxygenase HPD                 212   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300867.2|  4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family p...    210   1e-61   
ref|XP_009377128.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    209   1e-61   
ref|XP_009351285.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    209   1e-61   
gb|AFB74208.1|  4-hydroxyphenylpyruvate dioxygenase                     209   1e-61   Brassica napus [oilseed rape]
ref|XP_008353631.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    209   2e-61   
ref|XP_002892349.1|  4-hydroxyphenylpyruvate dioxygenase                209   2e-61   Arabidopsis lyrata subsp. lyrata
gb|KFK42972.1|  hypothetical protein AALP_AA1G063200                    209   2e-61   Arabis alpina [alpine rockcress]
ref|XP_010486350.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     208   6e-61   Camelina sativa [gold-of-pleasure]
emb|CDY09969.1|  BnaC08g44820D                                          207   7e-61   Brassica napus [oilseed rape]
ref|XP_004303888.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     207   7e-61   Fragaria vesca subsp. vesca
gb|AFB74207.1|  4-hydroxyphenylpyruvate dioxygenase                     207   8e-61   Brassica napus [oilseed rape]
gb|AFB74218.1|  4-hydroxyphenylpyruvate dioxygenase                     207   1e-60   Brassica napus [oilseed rape]
ref|XP_009118533.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     206   3e-60   Brassica rapa
ref|XP_006417901.1|  hypothetical protein EUTSA_v10007634mg             206   3e-60   Eutrema salsugineum [saltwater cress]
gb|ADO62712.1|  p-hydroxyphenylpyruvate dioxygenase                     206   4e-60   Mangifera indica
ref|XP_007048963.1|  Phytoene desaturation 1 isoform 3                  204   6e-60   
ref|XP_007048964.1|  Phytoene desaturation 1 isoform 4                  204   6e-60   
ref|XP_007048961.1|  Phytoene desaturation 1 isoform 1                  205   8e-60   
ref|XP_008466793.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     205   8e-60   Cucumis melo [Oriental melon]
emb|CDY10210.1|  BnaC05g04530D                                          204   1e-59   Brassica napus [oilseed rape]
ref|XP_007048962.1|  Phytoene desaturation 1 isoform 2                  204   1e-59   
ref|XP_010457787.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    204   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_003617391.1|  4-hydroxyphenylpyruvate dioxygenase                204   2e-59   
ref|XP_010053900.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    203   3e-59   Eucalyptus grandis [rose gum]
ref|XP_008380188.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    203   5e-59   
ref|XP_004162282.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    203   6e-59   
ref|XP_010274102.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     204   6e-59   Nelumbo nucifera [Indian lotus]
ref|XP_004144629.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    203   6e-59   Cucumis sativus [cucumbers]
ref|XP_010542713.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     202   7e-59   Tarenaya hassleriana [spider flower]
ref|XP_010053920.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    202   8e-59   Eucalyptus grandis [rose gum]
gb|KJB08583.1|  hypothetical protein B456_001G092000                    201   1e-58   Gossypium raimondii
gb|KJB08582.1|  hypothetical protein B456_001G092000                    201   1e-58   Gossypium raimondii
gb|KJB08581.1|  hypothetical protein B456_001G092000                    201   3e-58   Gossypium raimondii
emb|CAN71143.1|  hypothetical protein VITISV_033518                     200   5e-58   Vitis vinifera
ref|NP_001235148.1|  4-hydroxyphenylpyruvate dioxygenase                200   5e-58   
gb|AIN39549.1|  4-hydroxyphenylpyruvate dioxygenase short isoform       200   5e-58   Glycine max [soybeans]
sp|Q9ARF9.1|HPPD_PLESU  RecName: Full=4-hydroxyphenylpyruvate dio...    199   9e-58   Plectranthus scutellarioides
gb|AIN39550.1|  chloroplast 4-hydroxyphenylpyruvate dioxygenase l...    200   1e-57   Glycine max [soybeans]
ref|XP_002283275.2|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     200   1e-57   Vitis vinifera
gb|EPS60251.1|  hydroxyphenylpyruvate dioxygenase                       192   2e-55   Genlisea aurea
dbj|BAF74636.1|  hydroxyphenylpyruvate dioxygenase                      192   7e-55   Coptis japonica var. dissecta
ref|XP_003617384.1|  4-hydroxyphenylpyruvate dioxygenase                191   1e-54   Medicago truncatula
gb|KEH40154.1|  4-hydroxyphenylpyruvate dioxygenase                     190   2e-54   Medicago truncatula
ref|XP_007141424.1|  hypothetical protein PHAVU_008G194300g             191   3e-54   Phaseolus vulgaris [French bean]
ref|XP_010053910.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    188   3e-53   Eucalyptus grandis [rose gum]
gb|ABO69440.1|  hydroxyphenylpyruvate dioxygenase                       187   6e-53   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007215393.1|  hypothetical protein PRUPE_ppa005851mg             184   5e-52   
ref|XP_008229571.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    185   9e-52   Prunus mume [ume]
ref|XP_010688906.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    182   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007048965.1|  Phytoene desaturation 1                            181   3e-51   
ref|XP_002453359.1|  hypothetical protein SORBIDRAFT_04g004560          174   4e-48   Sorghum bicolor [broomcorn]
ref|XP_004951787.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    172   2e-47   Setaria italica
dbj|BAD26248.1|  putative 4-hydroxyphenylpyruvate dioxygenase           166   7e-45   Oryza sativa Japonica Group [Japonica rice]
emb|CAR47957.1|  p-hydroxyphenylpyruvate dioxygenase                    162   9e-44   Chlamydomonas reinhardtii
ref|XP_001694723.1|  4-hydroxyphenylpyruvate dioxygenase                162   9e-44   Chlamydomonas reinhardtii
ref|XP_003570001.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     159   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_001756086.1|  predicted protein                                  155   3e-41   
ref|XP_001757940.1|  predicted protein                                  155   3e-41   
gb|AAZ67144.1|  4-hydroxyphenylpyruvate dioxygenase                     155   3e-41   Triticum aestivum [Canadian hard winter wheat]
sp|O48604.1|HPPD_HORVU  RecName: Full=4-hydroxyphenylpyruvate dio...    155   5e-41   Hordeum vulgare [barley]
dbj|BAJ86732.1|  predicted protein                                      153   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAJ29893.1|  4-hydroxyphenylpyruvate dioxygenase                    152   2e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002952694.1|  4-hydroxyphenylpyruvate dioxygenase                153   3e-40   Volvox carteri f. nagariensis
dbj|BAK02084.1|  predicted protein                                      153   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009419542.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     153   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008620054.1|  4-hydroxyphenylpyruvate dioxygenase                151   1e-39   Saprolegnia diclina VS20
dbj|BAJ95714.1|  predicted protein                                      151   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003617383.1|  4-hydroxyphenylpyruvate dioxygenase                149   4e-39   
pdb|1SP8|A  Chain A, 4-hydroxyphenylpyruvate Dioxygenase                149   8e-39   Zea mays [maize]
ref|XP_008863477.1|  4-hydroxyphenylpyruvate dioxygenase                148   2e-38   Aphanomyces invadans
ref|XP_005650422.1|  p-hydroxyphenylpyruvate dioxigenase                147   2e-38   Coccomyxa subellipsoidea C-169
ref|XP_009825673.1|  4-hydroxyphenylpyruvate dioxygenase                147   4e-38   Aphanomyces astaci
ref|XP_002974762.1|  hypothetical protein SELMODRAFT_174278             147   7e-38   
ref|XP_002963674.1|  hypothetical protein SELMODRAFT_165961             147   1e-37   
gb|AFW70252.1|  4-hydroxyphenylpyruvate dioxygenase 1                   146   1e-37   
ref|XP_008811120.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     145   2e-37   Phoenix dactylifera
ref|NP_001105782.1|  4-hydroxyphenylpyruvate dioxygenase 1              144   4e-37   
ref|XP_002461838.1|  hypothetical protein SORBIDRAFT_02g008990          144   9e-37   
gb|KDO16411.1|  4-hydroxyphenylpyruvate dioxygenase                     142   1e-36   Saprolegnia parasitica CBS 223.65
ref|XP_010480368.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010480369.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009825674.1|  4-hydroxyphenylpyruvate dioxygenase                142   2e-36   Aphanomyces astaci
ref|XP_002461829.1|  hypothetical protein SORBIDRAFT_02g008850          143   2e-36   Sorghum bicolor [broomcorn]
gb|ETL47152.1|  hypothetical protein L916_03076                         138   3e-36   Phytophthora parasitica
ref|XP_008863478.1|  4-hydroxyphenylpyruvate dioxygenase                142   3e-36   Aphanomyces invadans
gb|ETM53414.1|  4-hydroxyphenylpyruvate dioxygenase                     137   5e-36   Phytophthora parasitica
gb|ETM00249.1|  4-hydroxyphenylpyruvate dioxygenase                     136   7e-36   Phytophthora parasitica
ref|XP_002968708.1|  hypothetical protein SELMODRAFT_91092              141   8e-36   Selaginella moellendorffii
ref|XP_002901240.1|  4-hydroxyphenylpyruvate dioxygenase                140   2e-35   Phytophthora infestans T30-4
ref|XP_008653702.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    139   5e-35   Zea mays [maize]
ref|XP_008900422.1|  4-hydroxyphenylpyruvate dioxygenase                139   7e-35   Phytophthora parasitica INRA-310
gb|KDO32258.1|  hypothetical protein SPRG_02737                         138   9e-35   Saprolegnia parasitica CBS 223.65
gb|ETI53876.1|  4-hydroxyphenylpyruvate dioxygenase                     137   2e-34   Phytophthora parasitica P1569
ref|XP_003055822.1|  predicted protein                                  137   3e-34   Micromonas pusilla CCMP1545
ref|XP_008900424.1|  4-hydroxyphenylpyruvate dioxygenase                136   3e-34   Phytophthora parasitica INRA-310
ref|XP_008881551.1|  4-hydroxyphenylpyruvate dioxygenase                133   8e-34   Aphanomyces invadans
ref|XP_005854172.1|  4-hydroxyphenylpyruvate dioxygenase                134   3e-33   Nannochloropsis gaditana CCMP526
gb|EWM23898.1|  4-hydroxyphenylpyruvate dioxygenase                     134   5e-33   Nannochloropsis gaditana
ref|XP_009520219.1|  hypothetical protein PHYSODRAFT_539872             132   7e-33   Phytophthora sojae
ref|XP_011402112.1|  4-hydroxyphenylpyruvate dioxygenase                135   1e-32   Auxenochlorella protothecoides
ref|XP_001416712.1|  predicted protein                                  131   3e-32   Ostreococcus lucimarinus CCE9901
ref|XP_002499380.1|  predicted protein                                  131   3e-32   Micromonas commoda
ref|XP_009825872.1|  4-hydroxyphenylpyruvate dioxygenase                130   9e-32   Aphanomyces astaci
ref|XP_003078281.1|  p-hydroxyphenylpyruvate dioxigenase (ISS)          129   1e-31   Ostreococcus tauri
gb|AAN28922.1|  4-hydroxyphenylpyruvate dioxygenase                     128   2e-31   Abutilon theophrasti [butterprint]
ref|XP_002990594.1|  hypothetical protein SELMODRAFT_161008             127   5e-31   
ref|XP_004368015.1|  4hydroxyphenylpyruvate dioxygenase                 124   6e-30   Acanthamoeba castellanii str. Neff
gb|EWM22210.1|  4-hydroxyphenylpyruvate dioxygenase                     124   1e-29   Nannochloropsis gaditana
gb|EWM22209.1|  4-hydroxyphenylpyruvate dioxygenase                     123   2e-29   Nannochloropsis gaditana
ref|XP_010475412.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    119   2e-29   
gb|ACN36372.1|  unknown                                                 122   5e-29   Zea mays [maize]
ref|XP_002902379.1|  4-hydroxyphenylpyruvate dioxygenase                119   1e-28   Phytophthora infestans T30-4
ref|XP_005850767.1|  hypothetical protein CHLNCDRAFT_20078              120   2e-28   Chlorella variabilis
gb|ETK93728.1|  hypothetical protein L915_03107                         115   2e-28   Phytophthora parasitica
gb|KDD74142.1|  hypothetical protein H632_c1538p1                       119   3e-28   Helicosporidium sp. ATCC 50920
ref|XP_008881550.1|  hypothetical protein H310_15345                    116   7e-28   Aphanomyces invadans
gb|EAZ21880.1|  hypothetical protein OsJ_05532                          117   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575746.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    113   9e-26   Brachypodium distachyon [annual false brome]
ref|XP_006853409.1|  hypothetical protein AMTR_s00032p00156270          107   1e-25   
ref|XP_007511204.1|  4-hydroxyphenylpyruvate dioxygenase                110   1e-24   Bathycoccus prasinos
ref|XP_002307562.2|  hypothetical protein POPTR_0005s22680g             104   2e-23   
ref|XP_007048969.1|  Phytoene desaturation 1, putative                  102   1e-22   
ref|XP_002895668.1|  4-hydroxyphenylpyruvate dioxygenase, putative      100   1e-22   Phytophthora infestans T30-4
gb|AET00342.2|  4-hydroxyphenylpyruvate dioxygenase                   99.0    4e-21   Medicago truncatula
emb|CBJ28697.1|  4-hydroxyphenylpyruvate dioxygenase, plastid pre...  99.4    1e-20   Ectocarpus siliculosus
dbj|BAJ93624.1|  predicted protein                                    92.8    3e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ETP51665.1|  hypothetical protein F442_03207                       90.5    6e-20   Phytophthora parasitica P10297
ref|XP_005852430.1|  4-hydroxyphenylpyruvate dioxygenase              92.4    2e-19   Nannochloropsis gaditana CCMP526
gb|EEC72567.1|  hypothetical protein OsI_06005                        94.4    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_008360256.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...  91.3    2e-18   
ref|XP_002287272.1|  4-hydroxyphenylpyruvate dioxygenase              91.3    4e-18   Thalassiosira pseudonana CCMP1335
ref|XP_008390582.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...  87.4    6e-17   
gb|EJK75816.1|  hypothetical protein THAOC_02448                      87.0    3e-16   Thalassiosira oceanica
gb|ETM53453.1|  hypothetical protein L914_03077                       80.5    3e-16   Phytophthora parasitica
ref|XP_001694722.1|  4-hydroxyphenylpyruvate dioxygenase              79.0    5e-14   Chlamydomonas reinhardtii
gb|EDL65287.1|  4-hydroxyphenylpyruvate dioxygenase                   78.6    9e-14   Bacillus sp. SG-1
ref|WP_044022537.1|  4-hydroxyphenylpyruvate dioxygenase              78.2    1e-13   Bacillus sp. SG-1
gb|KIZ04447.1|  4-hydroxyphenylpyruvate dioxygenase                   77.8    1e-13   Monoraphidium neglectum
gb|AIF24945.1|  4-hydroxyphenylpyruvate dioxygenase (HPD, hppD)       77.0    2e-13   uncultured marine group II/III euryarchaeote SAT1000_41_C12
ref|WP_035350816.1|  4-hydroxyphenylpyruvate dioxygenase              75.9    7e-13   Edaphobacter aggregans
ref|WP_027987430.1|  4-hydroxyphenylpyruvate dioxygenase              75.5    8e-13   
ref|WP_020060738.1|  4-hydroxyphenylpyruvate dioxygenase              73.9    3e-12   Bacillus sp. 123MFChir2
gb|AJD92913.1|  4-hydroxyphenylpyruvate dioxygenase                   73.2    7e-12   Jeotgalibacillus malaysiensis
ref|WP_035432465.1|  4-hydroxyphenylpyruvate dioxygenase              72.8    9e-12   Bacillus
ref|WP_039814073.1|  4-hydroxyphenylpyruvate dioxygenase              72.8    9e-12   
gb|ABI53728.2|  4-hydroxyphenylpyruvate dioxygenase                   72.8    9e-12   uncultured bacterium
ref|WP_019122205.1|  4-hydroxyphenylpyruvate dioxygenase              72.4    1e-11   Brevibacillus massiliensis
gb|KIW05916.1|  4-hydroxyphenylpyruvate dioxygenase                   72.0    2e-11   Verruconis gallopava
gb|AIM09594.1|  4-hydroxyphenylpyruvate dioxygenase                   68.9    2e-11   Bacillus anthracis [anthrax]
ref|WP_009334741.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  71.2    3e-11   Bacillus
ref|WP_002115481.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    3e-11   Bacillus cereus
ref|WP_011522806.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    4e-11   Candidatus Koribacter versatilis
ref|WP_033694710.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    4e-11   
ref|WP_000810915.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  70.9    5e-11   Bacillus
gb|EEK86219.1|  4-hydroxyphenylpyruvate dioxygenase                   70.9    5e-11   Bacillus cereus ATCC 4342
ref|WP_026963420.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    5e-11   Alicyclobacillus pomorum
ref|WP_016089597.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    5e-11   Bacillus
ref|WP_000810916.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    5e-11   Bacillus
gb|EEK69629.1|  4-hydroxyphenylpyruvate dioxygenase                   70.5    6e-11   Bacillus wiedmannii
ref|WP_001975475.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    6e-11   Bacillus
ref|WP_000810914.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  70.5    6e-11   Bacillus cereus group
ref|WP_000810913.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  70.5    6e-11   Bacillus
gb|AIM04210.1|  4-hydroxyphenylpyruvate dioxygenase                   70.1    7e-11   Bacillus anthracis [anthrax]
gb|EEL19135.1|  4-hydroxyphenylpyruvate dioxygenase                   70.1    7e-11   Bacillus cereus 95/8201
gb|EEK46877.1|  4-hydroxyphenylpyruvate dioxygenase                   70.1    8e-11   Bacillus cereus m1293
ref|WP_038414892.1|  4-hydroxyphenylpyruvate dioxygenase              70.1    8e-11   
gb|ABK83632.1|  4-hydroxyphenylpyruvate dioxygenase                   70.1    8e-11   Bacillus thuringiensis str. Al Hakam
gb|AFH81613.1|  4-hydroxyphenylpyruvate dioxygenase                   70.1    8e-11   Bacillus anthracis str. H9401
ref|WP_041488236.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    9e-11   Bacillus pseudomycoides
ref|WP_003205593.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  69.7    1e-10   Bacillus
ref|WP_016117024.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    1e-10   Bacillus cereus group
ref|WP_040930444.1|  hypothetical protein                             69.7    1e-10   
ref|WP_025606603.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    1e-10   Pontibacter actiniarum
ref|WP_028785141.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    1e-10   Thalassobacillus devorans
gb|KIY94741.1|  hypothetical protein MNEG_13223                       64.7    1e-10   Monoraphidium neglectum
ref|WP_034641974.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    1e-10   Bacillus manliponensis
ref|WP_018479076.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    1e-10   Pontibacter roseus
ref|WP_000810921.1|  hypothetical protein                             67.8    1e-10   Bacillus cereus
ref|WP_041057061.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    1e-10   Jeotgalibacillus campisalis
ref|WP_026581629.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    2e-10   Bacillus sp. J33
ref|WP_000810925.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    2e-10   Bacillus thuringiensis
gb|EEM61947.1|  4-hydroxyphenylpyruvate dioxygenase                   69.3    2e-10   Bacillus thuringiensis serovar monterrey BGSC 4AJ1
ref|WP_025151089.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    2e-10   Bacillus
ref|WP_011983355.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    2e-10   Bacillus cytotoxicus
ref|WP_002113414.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    2e-10   Bacillus cereus group
ref|WP_026951577.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    2e-10   Algoriphagus mannitolivorans
ref|WP_043930760.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    2e-10   Bacillus sp. EB01
ref|WP_009194781.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    3e-10   Cesiribacter andamanensis
ref|WP_014798570.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    3e-10   Bernardetia litoralis
ref|WP_004428063.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    3e-10   Bacillus alcalophilus
ref|WP_044202951.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    3e-10   Flammeovirga sp. OC4
ref|WP_037994498.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    3e-10   Thermoactinomyces
ref|WP_002151375.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    3e-10   Bacillus cereus
ref|WP_002091386.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    3e-10   Bacillus cereus
ref|WP_002140158.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  68.2    3e-10   Bacillus
ref|WP_007657880.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    3e-10   Pontibacter sp. BAB1700
gb|EEL89883.1|  4-hydroxyphenylpyruvate dioxygenase                   68.2    3e-10   Bacillus cereus AH1272
gb|EEM01328.1|  4-hydroxyphenylpyruvate dioxygenase                   68.2    4e-10   Bacillus mycoides DSM 2048
gb|EEL08156.1|  4-hydroxyphenylpyruvate dioxygenase                   68.2    4e-10   Bacillus cereus BDRD-ST196
ref|WP_000810911.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    4e-10   Bacillus cereus
ref|WP_002175349.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    4e-10   Bacillus cereus
ref|WP_000810917.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  68.2    4e-10   Bacillus
ref|WP_012930763.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    4e-10   
ref|WP_007921180.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    4e-10   Ktedonobacter racemifer
ref|WP_017154241.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    4e-10   Bacillus bingmayongensis
ref|WP_002124802.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  68.2    4e-10   Bacillus
ref|WP_000810924.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    4e-10   Bacillus cereus
ref|WP_026576504.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    4e-10   Bacillus sp. UNC438CL73TsuS30
ref|WP_012793017.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    4e-10   Chitinophaga pinensis
ref|WP_000810912.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    4e-10   Bacillus cereus
ref|WP_000810910.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  67.8    4e-10   Bacillus
gb|EEK80866.1|  4-hydroxyphenylpyruvate dioxygenase                   67.8    4e-10   Bacillus cereus R309803
ref|WP_042981475.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    4e-10   Bacillus
ref|XP_004039245.1|  hypothetical protein IMG5_030220                 68.2    4e-10   Ichthyophthirius multifiliis
gb|EEL36476.1|  4-hydroxyphenylpyruvate dioxygenase                   67.8    5e-10   Bacillus cereus Rock3-28
gb|EEL24963.1|  4-hydroxyphenylpyruvate dioxygenase                   67.8    5e-10   Bacillus cereus Rock1-3
ref|WP_000810922.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  67.8    5e-10   Bacillus
gb|AIE95284.1|  4-hydroxyphenylpyruvate dioxygenase (HPD, hppD)       67.8    5e-10   uncultured marine group II/III euryarchaeote AD1000_61_A07
ref|WP_000810919.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    5e-10   Bacillus thuringiensis
ref|WP_000810923.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  67.8    5e-10   Bacillus
gb|AHA08869.1|  4-hydroxyphenylpyruvate dioxygenase                   67.8    5e-10   Bacillus toyonensis BCT-7112
ref|WP_000810920.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  67.8    5e-10   Bacillus
ref|WP_029566295.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    5e-10   Bacillus indicus
ref|WP_034761020.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    5e-10   Bacillus vietnamensis
gb|KEZ79714.1|  4-hydroxyphenylpyruvate dioxygenase                   67.4    5e-10   Bacillus mycoides
ref|WP_026445133.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    6e-10   
gb|EEM85743.1|  4-hydroxyphenylpyruvate dioxygenase                   67.4    6e-10   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
gb|EEK52737.1|  4-hydroxyphenylpyruvate dioxygenase                   67.4    6e-10   Bacillus cereus ATCC 10876
emb|CDN39245.1|  unnamed protein product                              67.4    6e-10   Bacillus thuringiensis DB27
ref|WP_003269237.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    6e-10   
gb|EEM98379.1|  4-hydroxyphenylpyruvate dioxygenase                   67.4    6e-10   Bacillus thuringiensis IBL 200
ref|WP_003256814.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    6e-10   
ref|WP_029286431.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    7e-10   Bacillus indicus
ref|WP_020722836.1|  hypothetical protein                             67.4    7e-10   Acidobacteriaceae bacterium KBS 96
ref|WP_009054081.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    7e-10   Nitritalea halalkaliphila
ref|WP_043968892.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    9e-10   Micromonospora carbonacea
ref|WP_027000962.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    1e-09   Eisenibacter elegans
ref|WP_035332546.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    1e-09   Bacillus firmus
ref|WP_016103358.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    1e-09   Bacillus cereus
ref|WP_024028907.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    1e-09   Bacillus vireti
ref|WP_043323634.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    1e-09   Micromonospora
ref|WP_017733680.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    1e-09   Nafulsella turpanensis
ref|WP_029098599.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    1e-09   Brevibacillus thermoruber
ref|WP_035306290.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    1e-09   Actinokineospora inagensis
ref|WP_035299765.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    1e-09   Brevibacillus thermoruber
ref|WP_024983858.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    1e-09   
ref|WP_002139868.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    2e-09   
ref|WP_004987506.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  66.2    2e-09   
ref|WP_003389034.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    2e-09   
ref|WP_033715568.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    2e-09   
ref|WP_044339125.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    2e-09   
ref|WP_026592762.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    2e-09   
ref|WP_044516999.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    2e-09   
gb|EEK75276.1|  4-hydroxyphenylpyruvate dioxygenase                   65.9    2e-09   
gb|EMT08063.1|  4-hydroxyphenylpyruvate dioxygenase                   65.9    2e-09   
ref|WP_019037466.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    2e-09   
ref|WP_021624803.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    2e-09   
gb|AIF03427.1|  4-hydroxyphenylpyruvate dioxygenase (HPD, hppD)       65.9    2e-09   
ref|WP_000810926.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    2e-09   
ref|WP_010180748.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    2e-09   
gb|AIF09510.1|  4-hydroxyphenylpyruvate dioxygenase (HPD, hppD)       65.5    2e-09   
ref|WP_027319537.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    2e-09   
ref|WP_033677573.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    2e-09   
ref|WP_043066209.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    3e-09   
emb|CEG27351.1|  4-hydroxyphenylpyruvate dioxygenase                  65.5    3e-09   
ref|WP_035404066.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    3e-09   
ref|WP_002694277.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    3e-09   
gb|KER09254.1|  4-hydroxyphenylpyruvate dioxygenase                   65.5    3e-09   
ref|WP_034756925.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    3e-09   
ref|WP_000810918.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  65.5    3e-09   
ref|WP_015244644.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    3e-09   
ref|WP_013286633.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    3e-09   
gb|EEM49828.1|  4-hydroxyphenylpyruvate dioxygenase                   65.1    4e-09   
ref|WP_018784091.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    4e-09   
ref|WP_030268682.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    4e-09   
ref|WP_016743081.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    4e-09   
ref|WP_030504441.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    4e-09   
ref|WP_013476571.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    5e-09   
ref|WP_015892585.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    5e-09   
ref|XP_007783461.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    5e-09   
ref|WP_027318784.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    6e-09   
ref|WP_007086689.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    6e-09   
ref|WP_014263863.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    6e-09   
ref|WP_044219112.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    6e-09   
ref|WP_034088495.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    6e-09   
ref|WP_026443267.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    6e-09   
ref|WP_032085540.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    7e-09   
ref|WP_002657552.1|  4-hydroxyphenylpyruvate dioxygenase              63.9    9e-09   
ref|WP_015691557.1|  4-hydroxyphenylpyruvate dioxygenase              63.9    9e-09   
ref|WP_042173289.1|  4-hydroxyphenylpyruvate dioxygenase              63.9    1e-08   
ref|WP_026565302.1|  4-hydroxyphenylpyruvate dioxygenase              63.9    1e-08   
ref|WP_017250633.1|  4-hydroxyphenylpyruvate dioxygenase              63.5    1e-08   
ref|WP_010602368.1|  4-hydroxyphenylpyruvate dioxygenase              63.9    1e-08   
ref|WP_044004859.1|  4-hydroxyphenylpyruvate dioxygenase              63.9    1e-08   
ref|XP_004990068.1|  4-hydroxyphenylpyruvate dioxygenase              63.9    1e-08   
gb|EMD87247.1|  hypothetical protein COCHEDRAFT_1184059               63.9    1e-08   
ref|XP_007709357.1|  hypothetical protein COCCADRAFT_2606             63.9    1e-08   
gb|AHJ98466.1|  4-hydroxyphenylpyruvate dioxygenase                   63.5    1e-08   
ref|WP_007722926.1|  4-hydroxyphenylpyruvate dioxygenase              63.5    1e-08   
ref|WP_015155318.1|  4-hydroxyphenylpyruvate dioxygenase              63.5    1e-08   
ref|WP_036714699.1|  4-hydroxyphenylpyruvate dioxygenase              63.5    1e-08   
ref|XP_007689338.1|  hypothetical protein COCMIDRAFT_98981            63.5    1e-08   
ref|WP_026880529.1|  4-hydroxyphenylpyruvate dioxygenase              63.5    1e-08   
ref|WP_043097519.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    1e-08   
ref|WP_016200324.1|  4-hydroxyphenylpyruvate dioxygenase              63.5    1e-08   
ref|WP_044017090.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    1e-08   
ref|XP_008023962.1|  hypothetical protein SETTUDRAFT_149259           63.5    2e-08   
ref|WP_030825453.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    2e-08   
ref|WP_018620037.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    2e-08   
dbj|BAH39165.1|  4-hydroxyphenylpyruvate dioxygenase                  63.2    2e-08   
ref|WP_034741798.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    2e-08   
ref|WP_029288834.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    2e-08   
ref|WP_020714812.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    2e-08   
ref|WP_015142185.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    2e-08   
ref|WP_030569129.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    2e-08   
ref|WP_026754189.1|  4-hydroxyphenylpyruvate dioxygenase              63.2    2e-08   
ref|WP_025742459.1|  4-hydroxyphenylpyruvate dioxygenase              62.8    2e-08   
ref|WP_027388528.1|  4-hydroxyphenylpyruvate dioxygenase              62.8    2e-08   
ref|WP_042722980.1|  4-hydroxyphenylpyruvate dioxygenase              62.8    2e-08   
ref|XP_007875856.1|  hypothetical protein PFL1_00168                  62.8    2e-08   
ref|WP_041266432.1|  4-hydroxyphenylpyruvate dioxygenase              62.8    2e-08   
ref|WP_027001905.1|  4-hydroxyphenylpyruvate dioxygenase              62.8    2e-08   
ref|WP_003443627.1|  4-hydroxyphenylpyruvate dioxygenase              62.8    2e-08   
ref|WP_039793533.1|  4-hydroxyphenylpyruvate dioxygenase              62.8    3e-08   
ref|WP_037328791.1|  4-hydroxyphenylpyruvate dioxygenase              62.8    3e-08   
ref|WP_038030064.1|  4-hydroxyphenylpyruvate dioxygenase              62.4    3e-08   
ref|WP_018676561.1|  4-hydroxyphenylpyruvate dioxygenase              62.4    3e-08   
ref|WP_013767878.1|  4-hydroxyphenylpyruvate dioxygenase              62.4    3e-08   
ref|WP_030954355.1|  4-hydroxyphenylpyruvate dioxygenase              62.4    3e-08   
ref|WP_021592443.1|  4-hydroxyphenylpyruvate dioxygenase              62.4    3e-08   
ref|WP_034703907.1|  4-hydroxyphenylpyruvate dioxygenase              62.4    3e-08   
ref|WP_008991906.1|  4-hydroxyphenylpyruvate dioxygenase              62.4    3e-08   
ref|WP_039717180.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    4e-08   
ref|WP_020602511.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    4e-08   
ref|WP_005835220.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    4e-08   
ref|WP_007778924.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  62.0    4e-08   
ref|WP_015024438.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    4e-08   
ref|WP_035423065.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    4e-08   
ref|WP_009778508.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    4e-08   
dbj|BAP30242.1|  4-hydroxyphenylpyruvate dioxygenase                  62.0    4e-08   
ref|WP_040626239.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    4e-08   
ref|WP_030414525.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    5e-08   
ref|WP_030983605.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  62.0    5e-08   
ref|WP_030657433.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  62.0    5e-08   
ref|WP_023557903.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    5e-08   
gb|AHF14960.1|  4-hydroxyphenylpyruvate dioxygenase                   62.0    5e-08   
ref|WP_014673006.1|  4-hydroxyphenylpyruvate dioxygenase              62.0    5e-08   
ref|WP_044046500.1|  4-hydroxyphenylpyruvate dioxygenase              61.6    5e-08   
ref|WP_041252425.1|  4-hydroxyphenylpyruvate dioxygenase              61.6    5e-08   
ref|WP_018565553.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  61.6    5e-08   
ref|WP_036689884.1|  4-hydroxyphenylpyruvate dioxygenase              61.6    5e-08   
ref|WP_027373845.1|  4-hydroxyphenylpyruvate dioxygenase              61.6    5e-08   
ref|WP_042242230.1|  4-hydroxyphenylpyruvate dioxygenase              61.6    6e-08   
ref|WP_018383926.1|  4-hydroxyphenylpyruvate dioxygenase              61.6    6e-08   
gb|EHQ28394.1|  4-hydroxyphenylpyruvate dioxygenase                   61.6    6e-08   
dbj|GAA84011.1|  4-hydroxyphenylpyruvate dioxygenase                  61.6    6e-08   
ref|WP_034697426.1|  4-hydroxyphenylpyruvate dioxygenase              61.6    6e-08   
gb|AFZ13031.1|  4-hydroxyphenylpyruvate dioxygenase                   61.6    6e-08   
ref|WP_014678732.1|  4-hydroxyphenylpyruvate dioxygenase              61.6    6e-08   
ref|WP_023614753.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  61.6    6e-08   
ref|WP_029298941.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    6e-08   
ref|WP_034710537.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    7e-08   
ref|WP_034737515.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    7e-08   
ref|WP_026582853.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    7e-08   
ref|WP_030167310.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    7e-08   
ref|XP_007704185.1|  hypothetical protein COCSADRAFT_246536           61.2    7e-08   
ref|WP_011404122.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    7e-08   
ref|WP_030696453.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    8e-08   
ref|XP_005819544.1|  hypothetical protein GUITHDRAFT_158976           61.2    8e-08   
ref|WP_002984319.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    8e-08   
ref|WP_039751226.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    8e-08   
ref|WP_002663260.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    8e-08   
ref|WP_044642395.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    8e-08   
ref|WP_034681211.1|  4-hydroxyphenylpyruvate dioxygenase              61.2    9e-08   
ref|WP_028401266.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    9e-08   
ref|WP_016873294.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    9e-08   
ref|WP_007504284.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_015030461.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_039476607.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_024761702.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_016867737.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_043679435.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_034719571.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_026575026.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_027379233.1|  4-hydroxyphenylpyruvate dioxygenase              60.8    1e-07   
ref|WP_040996642.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_034728580.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_026769855.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_037862499.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_013452919.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|XP_001458228.1|  hypothetical protein                             60.5    1e-07   
ref|WP_028376924.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_020132439.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_034871028.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_021346495.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  60.5    1e-07   
gb|ELU14199.1|  hypothetical protein CAPTEDRAFT_191669                60.5    1e-07   
ref|WP_026774795.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_018549678.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    1e-07   
ref|WP_023573098.1|  hppD protein                                     60.5    1e-07   
ref|WP_015349166.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_009188861.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  60.5    2e-07   
ref|WP_033286028.1|  4-hydroxyphenylpyruvate dioxygenase              60.5    2e-07   
ref|WP_015753552.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|XP_001346967.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_035557185.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_006509601.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_023571103.1|  hppD protein                                     60.1    2e-07   
ref|WP_030805833.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_030780283.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_023578784.1|  hppD protein                                     60.1    2e-07   
ref|WP_025143212.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_033101813.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_026715284.1|  4-hydroxyphenylpyruvate dioxygenase              60.1    2e-07   
ref|WP_025025477.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    2e-07   
ref|WP_007841123.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  59.7    2e-07   
ref|WP_034976657.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    2e-07   
ref|WP_034673352.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    2e-07   
gb|AEV98905.1|  4-hydroxyphenylpyruvate dioxygenase                   59.7    2e-07   
ref|WP_015811582.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    2e-07   
ref|WP_035848813.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    2e-07   
ref|WP_015898344.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    2e-07   
ref|WP_041346698.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    2e-07   
ref|WP_031426681.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    2e-07   
ref|WP_020600511.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|WP_034970195.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|WP_020392568.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|XP_001819422.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|WP_044400665.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|WP_039364671.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|WP_037651439.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|XP_002375121.1|  4-hydroxyphenylpyruvate dioxygenase, putative    59.7    3e-07   
ref|WP_016860225.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|WP_030868621.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|WP_004930892.1|  4-hydroxyphenylpyruvate dioxygenase              59.7    3e-07   
ref|WP_033277505.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  59.3    3e-07   
ref|XP_001027802.1|  4-hydroxyphenylpyruvate dioxygenase family p...  59.3    3e-07   
ref|WP_006134417.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  59.3    3e-07   
ref|WP_028813712.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    3e-07   
ref|XP_002775900.1|  4-hydroxyphenylpyruvate dioxygenase, putative    59.3    3e-07   
ref|WP_026166657.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    3e-07   
ref|WP_030666935.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    3e-07   
ref|WP_041966606.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    4e-07   
ref|WP_014082837.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    4e-07   
ref|XP_005536252.1|  4-hydroxyphenylpyruvate dioxygenase, 4HPPD       59.3    4e-07   
ref|WP_009085370.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    4e-07   
ref|WP_028786248.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    4e-07   
ref|WP_010194005.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    4e-07   
ref|WP_026989882.1|  4-hydroxyphenylpyruvate dioxygenase              59.3    4e-07   
ref|WP_016483925.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    4e-07   
ref|WP_019065938.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    4e-07   
gb|KIZ01637.1|  4-hydroxyphenylpyruvate dioxygenase                   58.9    4e-07   
ref|WP_013061884.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    4e-07   
ref|WP_026849707.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    4e-07   
ref|WP_039139230.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    4e-07   
gb|ETZ23271.1|  4-hydroxyphenylpyruvate dioxygenase                   58.9    5e-07   
ref|WP_034042033.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|WP_024885374.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|WP_004951047.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|WP_031413053.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|WP_031140052.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|WP_004918456.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|XP_008331004.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...  58.9    5e-07   
ref|WP_038330954.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|WP_038267139.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|XP_010763814.1|  4-hydroxyphenylpyruvate dioxygenase              58.9    5e-07   
ref|WP_016438077.1|  4-hydroxyphenylpyruvate dioxygenase              58.5    5e-07   



>ref|XP_009587203.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nicotiana tomentosiformis]
Length=447

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGFK+F+R+NP+SD FSVKRFHH+EFWCGDATNT RRFSW+LGMPIAAKSDLSTGNS
Sbjct  25   FKLVGFKNFIRINPRSDFFSVKRFHHIEFWCGDATNTVRRFSWSLGMPIAAKSDLSTGNS  84

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
             HASYLLR   G LQFLFTAPY+ SIS P+SAAIPSFS S HRSF ATHGLGVRAVAL V
Sbjct  85   VHASYLLRPVSGSLQFLFTAPYSPSISTPSSAAIPSFSTSVHRSFTATHGLGVRAVALEV  144

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
            E+   AFSASVSRGAKP+ EPVT++ +V +AEVHLYGDVVLRF+SYL D  ++  FL GF
Sbjct  145  ENAYTAFSASVSRGAKPMFEPVTIDERVAVAEVHLYGDVVLRFVSYLKDADSL-VFLPGF  203

Query  597  EPMDGTASY  623
            E MD TASY
Sbjct  204  EAMDETASY  212



>ref|XP_009770088.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nicotiana sylvestris]
Length=447

 Score =   262 bits (669),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGFK+F+R NP+SD FSVKRFHH+EFWCGDATNTARRFSW+LGMPIAAKSDLSTGNS
Sbjct  25   FKLVGFKNFIRTNPRSDFFSVKRFHHIEFWCGDATNTARRFSWSLGMPIAAKSDLSTGNS  84

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
             HASYLLR   G LQFLFTA Y+ SIS P+SAAIPSFS S HRSF  THGLGVRAVAL V
Sbjct  85   VHASYLLRPVSGSLQFLFTATYSPSISTPSSAAIPSFSTSTHRSFTTTHGLGVRAVALEV  144

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
            E+   AFSAS+SRGAKP+ EPVT++ +V +AEVHLYGDVVLRF+SYL D  ++  FL GF
Sbjct  145  ENAYTAFSASISRGAKPMFEPVTIDERVAVAEVHLYGDVVLRFVSYLKDADSL-VFLPGF  203

Query  597  EPMDGTASY  623
            E M+ TASY
Sbjct  204  EAMEETASY  212



>ref|XP_006357690.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
tuberosum]
Length=447

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            +KLVGF +FVR NP+SD F+VKRFHH+EFWCGDATNTARRFSW LG+PIAAKSDLSTGNS
Sbjct  29   YKLVGFNNFVRTNPRSDLFNVKRFHHIEFWCGDATNTARRFSWGLGLPIAAKSDLSTGNS  88

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
             HASYLLR+S  +LQFLFTAPY+ +IS P+S++IP+FS S+HRSF  THGLGVRA+AL V
Sbjct  89   VHASYLLRSSSSQLQFLFTAPYSPAISTPSSSSIPTFSVSSHRSFTETHGLGVRAIALEV  148

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
            E+++ AFS  VS GAKPVSEPV LN++VV++EVHLYGDVVLRF+S+L D S    FL GF
Sbjct  149  ENSRLAFSTCVSHGAKPVSEPVILNDEVVISEVHLYGDVVLRFVSFLKD-SNRFVFLPGF  207

Query  597  EPMDG  611
            E ++G
Sbjct  208  ELVEG  212



>gb|ADZ24701.1| 4-hydroxyphenylpyruvate dioxygenase 2 [Solanum pennellii]
Length=441

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 162/207 (78%), Gaps = 5/207 (2%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKET S+ +         FKLVGF +F+R NP+SD FSVKRFHH+EFWCGDATNT+RRFS
Sbjct  4    GKETLSTTD----TTGATFKLVGFNNFIRANPRSDFFSVKRFHHIEFWCGDATNTSRRFS  59

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH  362
            W+LGMPI AKSDLSTGNS HASYLLR+  GELQF+FTAPY+ SIS P++A IPSFS   H
Sbjct  60   WSLGMPITAKSDLSTGNSVHASYLLRSVSGELQFVFTAPYSPSISVPSTAGIPSFSTPTH  119

Query  363  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLR  542
            R F A HGLGVRAVAL VE+   AFSASV+RGAKP  EPVT++  V +AEVHLYGDVVLR
Sbjct  120  RDFTAKHGLGVRAVALEVENAYLAFSASVARGAKPRFEPVTIDEHVAVAEVHLYGDVVLR  179

Query  543  FISYLSDPSAVTTFLQGFEPMDGTASY  623
            F+S + D  ++  FL GFE M+ T+S+
Sbjct  180  FVSLVKDADSL-IFLPGFEAMNETSSF  205



>ref|XP_006354418.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
tuberosum]
Length=442

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF +F+R NP+SD FSVKRFHH+EFWCGDATNT+RRFSW+LGMPI AKSDLSTGNS
Sbjct  20   FKLVGFNNFIRANPRSDFFSVKRFHHIEFWCGDATNTSRRFSWSLGMPITAKSDLSTGNS  79

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
             HASYLLR+  GELQF+FTAPY+ SIS P++A IPSFS S HR F A HGLGV AVAL V
Sbjct  80   VHASYLLRSVSGELQFVFTAPYSPSISVPSTAGIPSFSTSTHRDFTAKHGLGVCAVALEV  139

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
            E+   AFSASVSRGAKP  EPVT++  V +AEVHLYGDVVLRF+S++ D   +  FL GF
Sbjct  140  ENAYLAFSASVSRGAKPRFEPVTIDEHVAVAEVHLYGDVVLRFVSFVKDADCL-IFLPGF  198

Query  597  EPMDGTASY  623
            E MD T+S+
Sbjct  199  EAMDETSSF  207



>ref|XP_004240171.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
lycopersicum]
Length=441

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 161/207 (78%), Gaps = 5/207 (2%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKET S+ +         FKLVGF +F+R NP+SD FSVKRFHH+EFWCGDATNT+RRFS
Sbjct  4    GKETLSTTD----TTGATFKLVGFNNFIRANPRSDFFSVKRFHHIEFWCGDATNTSRRFS  59

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH  362
            W+LGMPI AKSDLSTGNS HASYLLR+  GELQF+FTAPY+ SIS P++A IPSFS   +
Sbjct  60   WSLGMPITAKSDLSTGNSVHASYLLRSVSGELQFVFTAPYSPSISVPSTAGIPSFSTPTY  119

Query  363  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLR  542
            R F A HGLGVRAVAL VE+   AFSASV+RGAKP  EPVT++  V +AEVHLYGDVVLR
Sbjct  120  RDFTAKHGLGVRAVALEVENAYLAFSASVARGAKPRFEPVTIDEHVAVAEVHLYGDVVLR  179

Query  543  FISYLSDPSAVTTFLQGFEPMDGTASY  623
            F+S + D   +  FL GFE MD T+S+
Sbjct  180  FVSLVKDADTL-IFLPGFEAMDETSSF  205



>ref|XP_011100559.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform X2 [Sesamum 
indicum]
Length=442

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 151/190 (79%), Gaps = 6/190 (3%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGFK+F+R NPKSDHF V RFHHVEFWCGDA NTA+RFSW LGMP+ AKSDLSTGNS
Sbjct  77   FKLVGFKNFIRTNPKSDHFPVHRFHHVEFWCGDAINTAKRFSWGLGMPLVAKSDLSTGNS  136

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
            AHASYLLR+  G+L F+FTAPY+ SIS  +SAAIPSFS   HRSF ++HGL VRAVA+ V
Sbjct  137  AHASYLLRS--GQLNFVFTAPYSPSISISSSAAIPSFSFPVHRSFTSSHGLAVRAVAIQV  194

Query  417  EDTQAAFSASVSRGAKPVSEPVTL-NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQG  593
            E   +A+SASVSRGAKP+S P+ L +N+  +AEVHLYGD VLRF+S   D    T FL G
Sbjct  195  ESAFSAYSASVSRGAKPISPPILLSDNKTAIAEVHLYGDSVLRFVSCGDDG---TGFLPG  251

Query  594  FEPMDGTASY  623
            FEP+D   SY
Sbjct  252  FEPVDNEMSY  261



>gb|EYU42802.1| hypothetical protein MIMGU_mgv1a005210mg [Erythranthe guttata]
Length=493

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 154/191 (81%), Gaps = 4/191 (2%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGFK+FVR NP+SDHF V RFHH+EFWCGDATNTARRFSW LGMP+ AKSDLSTGNS
Sbjct  74   FKLVGFKNFVRANPRSDHFPVHRFHHIEFWCGDATNTARRFSWGLGMPLVAKSDLSTGNS  133

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
            AHASYLLR+  G+L FLFTA Y+ SIS+P+SA+IPSFS SAHRSF ++HGL VRAVA+ V
Sbjct  134  AHASYLLRS--GQLNFLFTAAYSPSISSPSSASIPSFSLSAHRSFTSSHGLAVRAVAIQV  191

Query  417  EDTQAAFSASVSRGAKPVSEPVTL-NNQVVLAEVHLYGDVVLRFISYLSDPSAVTT-FLQ  590
            E   +A+SA+VSRGA P+S PV L +N+  +AEVHLYGD VLRF+SY    SA    FL 
Sbjct  192  ESAFSAYSAAVSRGAVPISPPVLLSDNKTSIAEVHLYGDAVLRFVSYNDIESASNGFFLP  251

Query  591  GFEPMDGTASY  623
             FEP+D   SY
Sbjct  252  DFEPLDNAISY  262



>ref|XP_011100558.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform X1 [Sesamum 
indicum]
Length=496

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 151/190 (79%), Gaps = 6/190 (3%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGFK+F+R NPKSDHF V RFHHVEFWCGDA NTA+RFSW LGMP+ AKSDLSTGNS
Sbjct  77   FKLVGFKNFIRTNPKSDHFPVHRFHHVEFWCGDAINTAKRFSWGLGMPLVAKSDLSTGNS  136

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
            AHASYLLR+  G+L F+FTAPY+ SIS  +SAAIPSFS   HRSF ++HGL VRAVA+ V
Sbjct  137  AHASYLLRS--GQLNFVFTAPYSPSISISSSAAIPSFSFPVHRSFTSSHGLAVRAVAIQV  194

Query  417  EDTQAAFSASVSRGAKPVSEPVTL-NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQG  593
            E   +A+SASVSRGAKP+S P+ L +N+  +AEVHLYGD VLRF+S   D    T FL G
Sbjct  195  ESAFSAYSASVSRGAKPISPPILLSDNKTAIAEVHLYGDSVLRFVSCGDDG---TGFLPG  251

Query  594  FEPMDGTASY  623
            FEP+D   SY
Sbjct  252  FEPVDNEMSY  261



>ref|XP_002520369.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Ricinus communis]
 gb|EEF41985.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Ricinus communis]
Length=441

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 10/202 (5%)
 Frame = +3

Query  36   STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  215
            STPE G FKLVGF +FVR NPKSD F VKRFHHVEFWC DATNTARRFSW LGMPI AKS
Sbjct  10   STPEQG-FKLVGFSNFVRANPKSDRFKVKRFHHVEFWCTDATNTARRFSWGLGMPIVAKS  68

Query  216  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saHRSFNA  377
            DLSTGN  HASYLLR+  G+L FLFTAPY+ SI+   + +  + ++         R F+A
Sbjct  69   DLSTGNVTHASYLLRS--GDLNFLFTAPYSPSIAAMENLSHTATASIPTFSHETCRYFSA  126

Query  378  THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL  557
             HGL VRA+A+ VED + AF  S S GAKP +EP+ L+N+ V+AEVHLYGDVVLR+ISY 
Sbjct  127  KHGLAVRAIAIEVEDAEIAFRTSASHGAKPSAEPILLDNRAVIAEVHLYGDVVLRYISYK  186

Query  558  SDPSAVTTFLQGFEPMDGTASY  623
            ++ S    FL  FEP+D   S+
Sbjct  187  NEGSNF-EFLPRFEPVDEATSF  207



>gb|ACN78586.1| 4-hydroxyphenylpyruvate dioxygenase [Lactuca sativa]
Length=446

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 150/195 (77%), Gaps = 9/195 (5%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF +F+R NP SD FSVKRFHH+ FWC DATNTARRFSW LGMPI  KSDLSTGN+
Sbjct  19   FKLVGFNNFIRTNPMSDKFSVKRFHHIGFWCSDATNTARRFSWGLGMPIVQKSDLSTGNA  78

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---RSFNATHGLGVRAVA  407
             HASYLLR+  G+L FLFTAPY+ SIS+  ++   S  + +H   R+F A+HGL VR+VA
Sbjct  79   THASYLLRS--GQLNFLFTAPYSPSISSAVTSTTASIPSFSHTDCRNFTASHGLAVRSVA  136

Query  408  LVVEDTQAAFSASVSRGAKPVSEPVTL-NNQVVLAEVHLYGDVVLRFISYLSDPS--AVT  578
            + VED + AFS SVS GAKP S P+TL NN VVL+EV LYGDVVLR+ISY  +P+   ++
Sbjct  137  IEVEDAEIAFSVSVSHGAKPSSSPITLGNNDVVLSEVKLYGDVVLRYISY-KNPNFDGIS  195

Query  579  TFLQGFEPMDGTASY  623
             FL GFEP++ T+S+
Sbjct  196  NFLPGFEPVEKTSSF  210



>ref|XP_004491317.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Cicer arietinum]
Length=434

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 151/197 (77%), Gaps = 10/197 (5%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF +FVR NPKSD F VKRFHHVEFWC DATNTARRFSW LGMPI AKSDLSTGN
Sbjct  9    GFKLVGFNNFVRTNPKSDRFKVKRFHHVEFWCPDATNTARRFSWGLGMPIVAKSDLSTGN  68

Query  234  SAHASYLLRASGGELQFLFTapyassisnpa---saaipsfsasaHRSFNATHGLGVRAV  404
              HASYLLR+  G+L FLFTA Y+ SIS  A   +A+IPSFSA    +F+A+HGLGVRAV
Sbjct  69   QTHASYLLRS--GDLNFLFTAAYSPSISLSAPHPTASIPSFSAPTSFAFSASHGLGVRAV  126

Query  405  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----LSDPS  569
            A+ V+D + A++ SV+ GA P S PV L+N+V LAEV LYGDVVLR++SY      S+P+
Sbjct  127  AIEVDDAEFAYTTSVNHGAIPSSPPVVLDNRVKLAEVQLYGDVVLRYVSYNDPIETSNPN  186

Query  570  AVTTFLQGFEPMDGTAS  620
                FL GFEP++ T+S
Sbjct  187  PNHWFLPGFEPVEETSS  203



>sp|O23920.1|HPPD_DAUCA RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Daucus carota]
 gb|AAC49815.1| 4-hydroxyphenylpyruvate dioxygenase [Daucus carota]
Length=442

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 152/206 (74%), Gaps = 8/206 (4%)
 Frame = +3

Query  9    ETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWA  188
            E  SS + +++P    FKLVGF +FVR NPKSDHF+VKRFHH+EFWCGDATNT+RRFSW 
Sbjct  9    EILSSNSSNTSPAT--FKLVGFNNFVRANPKSDHFAVKRFHHIEFWCGDATNTSRRFSWG  66

Query  189  LGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsf-sasaHR  365
            LGMP+ AKSDLSTGNS HASYL+R++   L F+FTAPY+ S +  + +A     SAS   
Sbjct  67   LGMPLVAKSDLSTGNSVHASYLVRSAN--LSFVFTAPYSPSTTTSSGSAAIPSFSASGFH  124

Query  366  SFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRF  545
            SF A HGL VRA+AL V D  AAF ASV+RGA+P S PV L++Q  LAEV LYGDVVLRF
Sbjct  125  SFAAKHGLAVRAIALEVADVAAAFEASVARGARPASAPVELDDQAWLAEVELYGDVVLRF  184

Query  546  ISYLSDPSAVTTFLQGFEPMDGTASY  623
            +S+  +      FL GFE ++GTAS+
Sbjct  185  VSFGREEG---LFLPGFEAVEGTASF  207



>ref|XP_010087866.1| 4-hydroxyphenylpyruvate dioxygenase [Morus notabilis]
 gb|EXB30302.1| 4-hydroxyphenylpyruvate dioxygenase [Morus notabilis]
Length=437

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 145/195 (74%), Gaps = 11/195 (6%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  224
            + G FKLVGF +FVR NPKSD F V+RFHHVEFWCGDATNTARRFSW LGMP+ AKS+LS
Sbjct  8    DGGDFKLVGFSNFVRTNPKSDRFGVRRFHHVEFWCGDATNTARRFSWGLGMPLIAKSNLS  67

Query  225  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--------saHRSFNAT  380
            TGN  HASYLLR+  G+LQFLFTAPY+ SI+  A+      S+        +A  SF+ +
Sbjct  68   TGNLIHASYLLRS--GDLQFLFTAPYSPSIAAAAANQTTDCSSAAIPTFDRAAFLSFSTS  125

Query  381  HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS  560
            HGL VRA+A+ VED + AF  SV+ GAKP S P+ L+N+VV+AEV LYGDVVLR++SY S
Sbjct  126  HGLAVRAIAVEVEDAELAFVTSVAHGAKPSSRPIFLDNRVVIAEVRLYGDVVLRYVSYKS  185

Query  561  DPSAVTTFLQGFEPM  605
             P+    FL GFEP+
Sbjct  186  -PAVSDEFLPGFEPV  199



>gb|AGO59892.1| hydroxyphenylpyruvate dioxygenase [Perilla frutescens]
Length=477

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 156/203 (77%), Gaps = 10/203 (5%)
 Frame = +3

Query  12   TSSSVNHHST---PENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            T+ ++   ST   P +G FKLVG+K+FVR NP SD F V RFHHVEFWCGDATNTARRFS
Sbjct  41   TTQTMGQESTNAAPAHGEFKLVGYKNFVRANPNSDRFPVHRFHHVEFWCGDATNTARRFS  100

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH  362
            W LGMP+ AKSDLSTGNSAHASYLLR+  GEL FLFTAPY  S+S+P+SAAIP+FS SAH
Sbjct  101  WGLGMPLVAKSDLSTGNSAHASYLLRS--GELSFLFTAPYPPSLSDPSSAAIPTFSFSAH  158

Query  363  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-QVVLAEVHLYGDVVL  539
            R+F ++HGL VRAVA+ VE   +A SASVSRGAKPVS PV L++ +  +AEVHLYGD VL
Sbjct  159  RAFTSSHGLAVRAVAIQVESAFSAHSASVSRGAKPVSPPVLLSDGKTAIAEVHLYGDAVL  218

Query  540  RFISYLSDPSAVTTFLQGFEPMD  608
            R++S   D      FL  FE +D
Sbjct  219  RYVSCGDD----GWFLPEFEAVD  237



>gb|ADZ24700.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Solanum pennellii]
Length=420

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 155/186 (83%), Gaps = 2/186 (1%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF +FVR NP+SD F+VKRFHH+EFWCGDATNTARRFSW LG+PIAA SDLSTGNS
Sbjct  22   FKLVGFNNFVRTNPRSDFFTVKRFHHIEFWCGDATNTARRFSWGLGLPIAAISDLSTGNS  81

Query  237  AHA-SYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALV  413
             HA   L  +S  +LQFLFTAPY+ +IS P+S++IP+FS S+HRSF ATHGLGVRA+AL 
Sbjct  82   VHASYLLRSSSSSQLQFLFTAPYSPAISTPSSSSIPTFSVSSHRSFTATHGLGVRAIALE  141

Query  414  VEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQG  593
            VE+++ AFS  VS GAKPVSEPV LN++VV+AEVHLYGDVVLRF+S+L D S    FL G
Sbjct  142  VENSRLAFSTCVSHGAKPVSEPVILNDEVVIAEVHLYGDVVLRFVSFLKD-SNCFVFLPG  200

Query  594  FEPMDG  611
            FE ++G
Sbjct  201  FESVEG  206



>ref|XP_010688905.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Beta vulgaris 
subsp. vulgaris]
Length=434

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 148/189 (78%), Gaps = 4/189 (2%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVG+ +F+RVNP SD F VKRFHHVEFWCGDATN +RRFSW LGMPI AKSDLSTGNS
Sbjct  15   FKLVGYSNFIRVNPLSDLFPVKRFHHVEFWCGDATNVSRRFSWGLGMPIVAKSDLSTGNS  74

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
             HASYLLR+  GEL FLFT+PY+ S+S+P+SA IP+FS S   SF  +HGL VRAVA+ V
Sbjct  75   VHASYLLRS--GELHFLFTSPYSPSLSSPSSATIPTFSFSLFTSFLTSHGLAVRAVAVEV  132

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
            +D +AAF  SVS GA PVS P+ L++ VVL+EVHLYGDVVLR++S  S    +  FL GF
Sbjct  133  QDAEAAFHISVSNGASPVSPPIRLHDGVVLSEVHLYGDVVLRYVSTSSVVDGI--FLPGF  190

Query  597  EPMDGTASY  623
            E M G +S+
Sbjct  191  EEMLGESSF  199



>ref|XP_011026229.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Populus 
euphratica]
Length=444

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 150/212 (71%), Gaps = 17/212 (8%)
 Frame = +3

Query  27   NHHSTPEN-GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPI  203
              + TPE  GGF+LVGF  FVR NP+SD F V RFHH+EFWC DATNTARRFSW LGMPI
Sbjct  3    KQNETPETPGGFRLVGFSSFVRANPRSDRFKVNRFHHIEFWCPDATNTARRFSWGLGMPI  62

Query  204  AAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saHR  365
             AKSDLSTGN+ HASYLLR+  G+L FLFTAPY+ SI++  + +  + ++         R
Sbjct  63   VAKSDLSTGNATHASYLLRS--GDLNFLFTAPYSPSIASMDNLSHTATASIPTFNHETSR  120

Query  366  SFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRF  545
             F+A HGL VRAVA+ V+D + AF+ SV+ GAKP + PV L+N+ V+AEVHLYGDVVLR+
Sbjct  121  GFSAKHGLAVRAVAIEVDDAELAFTTSVAHGAKPSASPVLLDNRAVVAEVHLYGDVVLRY  180

Query  546  ISY------LSDPSAVTTFLQGFEPMDGTASY  623
            +SY       SDP   + FL  FE ++  +S+
Sbjct  181  VSYGNSERDESDPG--SWFLPKFEAVEAASSF  210



>gb|AGG10562.1| 4-hydroxyphenylpyruvate dioxygenase [Amaranthus tuberculatus]
Length=434

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 149/197 (76%), Gaps = 6/197 (3%)
 Frame = +3

Query  42   PEN---GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAK  212
            PEN     FKLVG+ +FVRVNPKSD F+VKRFHH+EFWCGDATN +RRFSW LGMP  AK
Sbjct  6    PENQPDSEFKLVGYSNFVRVNPKSDRFNVKRFHHIEFWCGDATNVSRRFSWGLGMPTVAK  65

Query  213  SDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLG  392
            SDLSTGNS HAS+LL  S G+L FLFT+PY+ ++S P+SAAIPSF  +    F  +HGLG
Sbjct  66   SDLSTGNSVHASFLL--SSGDLSFLFTSPYSPTMSIPSSAAIPSFDFNHFTKFLTSHGLG  123

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSA  572
            VRAVA+ VED +AAF+ SVS GA P   P+ L N VVL+EVHLYGDVVLR++SY ++   
Sbjct  124  VRAVAVEVEDAEAAFNISVSNGAIPCVSPIHLENGVVLSEVHLYGDVVLRYVSYGNECGD  183

Query  573  VTTFLQGFEPMDGTASY  623
            V  FL GFE M   +S+
Sbjct  184  V-FFLPGFEEMPEESSF  199



>gb|KDP45435.1| hypothetical protein JCGZ_09684 [Jatropha curcas]
Length=442

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 145/198 (73%), Gaps = 10/198 (5%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GF+LVGF +FVR NP+SD F VKRFHHVEFWC DATNTARRFSW LGMPI  KSD+STGN
Sbjct  15   GFQLVGFSNFVRTNPRSDRFKVKRFHHVEFWCTDATNTARRFSWGLGMPIVVKSDISTGN  74

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saHRSFNATHGLGV  395
              HASYLLR+  G+L FLFTAPY+ SI+   + +  + ++         R+F A HGL V
Sbjct  75   VTHASYLLRS--GDLNFLFTAPYSPSIAAMENLSNTATASIPTFNHEDCRNFTAKHGLAV  132

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL-SDPSA  572
            RA+AL VED   AF+ SV+ GA+P +EP+ L+N+ V+AEVHLYGDVVLR+ISY  S+P+ 
Sbjct  133  RAIALEVEDAVIAFNTSVAHGAQPSAEPIALDNRAVVAEVHLYGDVVLRYISYYNSNPND  192

Query  573  VTT-FLQGFEPMDGTASY  623
                FL  FE MD ++S+
Sbjct  193  DHDWFLPKFEAMDESSSF  210



>gb|KDO51876.1| hypothetical protein CISIN_1g013898mg [Citrus sinensis]
Length=389

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 143/193 (74%), Gaps = 8/193 (4%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            KLVGFK+FVR NPKSD F V RFHHVEFWC DATNTARRFSW LGMPI AKSDLSTGN+ 
Sbjct  11   KLVGFKNFVRQNPKSDRFRVNRFHHVEFWCTDATNTARRFSWGLGMPIVAKSDLSTGNTV  70

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVRAV  404
            HASYLLR+  G+L+F+FTAPY+ SIS+ A A   S S      +A RSF A+HGL  R++
Sbjct  71   HASYLLRS--GDLRFVFTAPYSPSISDAADAGNSSASLPTFDHAACRSFAASHGLAARSI  128

Query  405  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTF  584
            A+ VED   AF+ SV+ GAKP S PV L+N  V+AEV LYGDVVLR++SY  D +    F
Sbjct  129  AVEVEDADVAFNTSVAHGAKPSSPPVILDNLAVIAEVQLYGDVVLRYVSY-KDKANHLDF  187

Query  585  LQGFEPMDGTASY  623
            L GFEP D  +S+
Sbjct  188  LPGFEPTDEISSF  200



>ref|XP_004243609.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Solanum lycopersicum]
Length=441

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 154/186 (83%), Gaps = 2/186 (1%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF  FVR NP+SD F+VKRFHH+EFWCGDATNTARRFSW LG+PIAA SDLSTGNS
Sbjct  22   FKLVGFNHFVRTNPRSDFFTVKRFHHIEFWCGDATNTARRFSWGLGLPIAAISDLSTGNS  81

Query  237  AHA-SYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALV  413
             HA   L  +S  +LQFLFTAPY+S+IS  +SA+IP+FS S+HRSF ATHGLGVRA+AL 
Sbjct  82   VHASYLLRSSSSSQLQFLFTAPYSSAISTSSSASIPTFSVSSHRSFTATHGLGVRAIALE  141

Query  414  VEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQG  593
            VE+++ AFS  V+ GAKPVSEPV LN++VV+AEVHLYGDVVLRF+S+L D S    FL G
Sbjct  142  VENSRLAFSTCVAHGAKPVSEPVILNDEVVIAEVHLYGDVVLRFVSFLKD-SNCFVFLPG  200

Query  594  FEPMDG  611
            FE ++G
Sbjct  201  FESVEG  206



>ref|XP_009119049.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa]
 gb|ABI63586.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa subsp. pekinensis]
Length=443

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 146/211 (69%), Gaps = 15/211 (7%)
 Frame = +3

Query  18   SSVNHH----STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSW  185
            S   HH    +T  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW
Sbjct  9    SENQHHDDAATTSASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSW  68

Query  186  ALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa----  353
             LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    + S     
Sbjct  69   GLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGENPPTTTASIPSFD  126

Query  354  -saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGD  530
               +RSF ++HGLGVRAVA+ VED +AAFS SVS GA P S P+ LN+ V +AEV LYGD
Sbjct  127  HVTYRSFFSSHGLGVRAVAVEVEDAEAAFSISVSNGAVPSSPPIVLNDAVTIAEVKLYGD  186

Query  531  VVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            VVLR++SY       T FL  FE +D T+S+
Sbjct  187  VVLRYVSY----KVATVFLPRFETVDDTSSF  213



>dbj|BAH10638.1| 4-hydroxyphenylpyruvate dioxygenase [Hevea brasiliensis]
Length=445

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 149/202 (74%), Gaps = 14/202 (7%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKL+GF +FVR NP+SD F VKRFHHVEFWC DATNTA RFSW LGMP  AKSDLSTGN
Sbjct  14   GFKLLGFSNFVRTNPRSDLFKVKRFHHVEFWCTDATNTACRFSWGLGMPFVAKSDLSTGN  73

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saHRSFNATHGLGV  395
              HASYLLR+  G+L FLFTAPY+ +I++  + +  + ++       A R+F+A HGLGV
Sbjct  74   VTHASYLLRS--GDLSFLFTAPYSPTIASMENFSHTATASIPTFSHEACRNFSAKHGLGV  131

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY------L  557
            RA+A+ VED + A++ SV+RGA P+  P+TL+N+ V+AEVHLYGDVVLR+ISY      L
Sbjct  132  RAIAIEVEDAEIAYNTSVARGALPMGGPITLDNRAVVAEVHLYGDVVLRYISYKNSNPNL  191

Query  558  SDPSAVTTFLQGFEPMDGTASY  623
            +D S  + FL  FE +D  +S+
Sbjct  192  NDSSPDSWFLPKFESVDEASSF  213



>ref|XP_006437130.1| hypothetical protein CICLE_v10031587mg [Citrus clementina]
 ref|XP_006484905.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Citrus sinensis]
 gb|ESR50370.1| hypothetical protein CICLE_v10031587mg [Citrus clementina]
 gb|KDO51875.1| hypothetical protein CISIN_1g013898mg [Citrus sinensis]
Length=434

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 143/193 (74%), Gaps = 8/193 (4%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            KLVGFK+FVR NPKSD F V RFHHVEFWC DATNTARRFSW LGMPI AKSDLSTGN+ 
Sbjct  11   KLVGFKNFVRQNPKSDRFRVNRFHHVEFWCTDATNTARRFSWGLGMPIVAKSDLSTGNTV  70

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVRAV  404
            HASYLLR+  G+L+F+FTAPY+ SIS+ A A   S S      +A RSF A+HGL  R++
Sbjct  71   HASYLLRS--GDLRFVFTAPYSPSISDAADAGNSSASLPTFDHAACRSFAASHGLAARSI  128

Query  405  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTF  584
            A+ VED   AF+ SV+ GAKP S PV L+N  V+AEV LYGDVVLR++SY  D +    F
Sbjct  129  AVEVEDADVAFNTSVAHGAKPSSPPVILDNLAVIAEVQLYGDVVLRYVSY-KDKANHLDF  187

Query  585  LQGFEPMDGTASY  623
            L GFEP D  +S+
Sbjct  188  LPGFEPTDEISSF  200



>ref|NP_001154311.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AEE28007.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=418

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  51   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  110

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  111  MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  168

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  169  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  228

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++  +S+
Sbjct  229  EFLPGFERVEDASSF  243



>gb|AID81984.1| hydroxyphenylpyruvate dioxygenase [Capsella bursa-pastoris]
Length=446

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 140/195 (72%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM   AKSDLSTGN
Sbjct  24   GFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFTAKSDLSTGN  83

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S        + S       + RSF ++HGLGVR
Sbjct  84   MVHASYLL--TPGDLRFLFTAPYSPSLSAGEIKLTATASIPSFDHVSSRSFFSSHGLGVR  141

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ V+D ++AFS SV+ GA P S P+ L+  V +AEV LYGDVVLR++SY    +   
Sbjct  142  AVAIEVDDAESAFSISVANGAIPSSPPIVLDESVTIAEVKLYGDVVLRYVSYKGGDTGQP  201

Query  579  TFLQGFEPMDGTASY  623
             FL GFEP++ T+S+
Sbjct  202  QFLPGFEPVEDTSSF  216



>pdb|1SQD|A Chain A, Structural Basis For Inhibitor Selectivity Revealed 
By Crystal Structures Of Plant And Mammalian 4- Hydroxyphenylpyruvate 
Dioxygenases
 pdb|1TFZ|A Chain A, Structural Basis For Herbicidal Inhibitor Selectivity 
Revealed By Comparison Of Crystal Structures Of Plant And 
Mammalian 4- Hydroxyphenylpyruvate Dioxygenases
 pdb|1TG5|A Chain A, Crystal Structures Of Plant 4-Hydroxyphenylpyruvate 
Dioxygenases Complexed With Das645
Length=424

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  2    GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  61

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  62   MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  119

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  120  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  179

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++  +S+
Sbjct  180  EFLPGFERVEDASSF  194



>ref|XP_006307507.1| hypothetical protein CARUB_v10009131mg [Capsella rubella]
 gb|EOA40405.1| hypothetical protein CARUB_v10009131mg [Capsella rubella]
Length=446

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 139/195 (71%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM   AKSDLSTGN
Sbjct  24   GFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFTAKSDLSTGN  83

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S        + S       + RSF ++HGLGVR
Sbjct  84   MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKLTATASIPSFDHVSSRSFFSSHGLGVR  141

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ V+D  +AFS SV+ GA P S P+ L+  V +AEV LYGDVVLR++SY    +   
Sbjct  142  AVAIEVDDADSAFSISVANGAIPSSPPIVLDESVTIAEVKLYGDVVLRYVSYKGGDTGQP  201

Query  579  TFLQGFEPMDGTASY  623
             FL GFEP++ T+S+
Sbjct  202  QFLPGFEPVEDTSSF  216



>sp|P93836.2|HPPD_ARATH RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Arabidopsis thaliana]
 pdb|1SP9|A Chain A, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP9|B Chain B, 4-hydroxyphenylpyruvate Dioxygenase
 gb|AAL16215.1|AF428446_1 At1g06570/F12K11_12 [Arabidopsis thaliana]
 gb|AAB58404.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAB70025.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAC15697.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAL61936.1| 4-hydroxyphenylpyruvate dioxygenase (HPD) [Arabidopsis thaliana]
 gb|AAM91145.1| 4-hydroxyphenylpyruvate dioxygenase (HPD) [Arabidopsis thaliana]
Length=445

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  23   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  82

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  83   MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  140

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  141  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  200

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++  +S+
Sbjct  201  EFLPGFERVEDASSF  215



>emb|CDY06652.1| BnaA10g04310D [Brassica napus]
Length=445

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 143/201 (71%), Gaps = 11/201 (5%)
 Frame = +3

Query  36   STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  215
            +T  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKS
Sbjct  21   ATSASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKS  80

Query  216  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNAT  380
            DLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    + S        +RSF ++
Sbjct  81   DLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGENPPTTTASIPSFDHVTYRSFFSS  138

Query  381  HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS  560
            HGLGVRAVA+ VED ++AFS SVS GA P S P+ LN+ V +AEV LYGDVVLR++SY  
Sbjct  139  HGLGVRAVAVEVEDAESAFSISVSNGAVPSSPPIVLNDAVTIAEVKLYGDVVLRYVSY--  196

Query  561  DPSAVTTFLQGFEPMDGTASY  623
                 T FL  FE +D T+S+
Sbjct  197  --KVATVFLPRFETVDDTSSF  215



>gb|AAC62457.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=419

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  23   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  82

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  83   MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  140

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  141  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  200

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++  +S+
Sbjct  201  EFLPGFERVEDASSF  215



>ref|NP_172144.2| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAF24813.1|AC007592_6 F12K11.9 [Arabidopsis thaliana]
 gb|AEE28006.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=473

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  51   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  110

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  111  MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  168

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  169  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  228

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++  +S+
Sbjct  229  EFLPGFERVEDASSF  243



>gb|AAM96960.1| 4-hydroxyphenylpyruvate dioxygenase HPD [Arabidopsis thaliana]
Length=473

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  51   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  110

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  111  MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  168

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  169  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  228

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++  +S+
Sbjct  229  EFLPGFERVEDASSF  243



>ref|XP_002300867.2| 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family protein [Populus trichocarpa]
 gb|EEE80140.2| 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family protein [Populus trichocarpa]
Length=444

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 152/219 (69%), Gaps = 22/219 (10%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKE  +S     TP  GGFKL GF  FVR NP+SD F V RFHH+EFWC DATNTARRFS
Sbjct  2    GKENETS----ETP--GGFKLGGFSSFVRANPRSDRFKVNRFHHIEFWCTDATNTARRFS  55

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa---  353
            W LGMPI AKSDLSTGN+ HASYLLR+  G+L FLFTAPY+ SI++  + +  + ++   
Sbjct  56   WGLGMPIVAKSDLSTGNATHASYLLRS--GDLNFLFTAPYSPSIASMDNLSHTATASIPT  113

Query  354  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  524
                  R F+A HGL VRA+A+ V+D + AF+ SV+ GAKP + PV L+N+ V+AEVHLY
Sbjct  114  FNHETSRGFSAKHGLAVRAIAIEVDDAELAFTTSVAHGAKPSASPVLLDNRAVVAEVHLY  173

Query  525  GDVVLRFISY------LSDPSAVTTFLQGFEPMDGTASY  623
            GDVVLR++SY       SDP   + FL  FE ++  +S+
Sbjct  174  GDVVLRYVSYGNSESDDSDPG--SWFLPKFEAVEAASSF  210



>ref|XP_009377128.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Pyrus x 
bretschneideri]
Length=440

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 143/196 (73%), Gaps = 15/196 (8%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            F LVGF +FVR NP+SD F V RFHHVEFWC DATN A RFSW LGMP+ AKSDLSTGN 
Sbjct  9    FNLVGFSNFVRTNPRSDRFKVHRFHHVEFWCTDATNAALRFSWGLGMPMVAKSDLSTGNQ  68

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--------saHRSFNATHGLG  392
             HASYLLR+  G+L FLFTAPY+ +++  A  A PS S+        +A R+F+ATHGLG
Sbjct  69   THASYLLRS--GDLNFLFTAPYSPTLTRTADPARPSNSSASIPTFDHTASRAFSATHGLG  126

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----L  557
            VRAVA+ VED  +AF+ SV+ GAKP + P+ L+N+V +AEV LYGDVVLR++SY     L
Sbjct  127  VRAVAIQVEDAVSAFTTSVAHGAKPSAAPILLDNRVTIAEVQLYGDVVLRYVSYSDHNHL  186

Query  558  SDPSAVTTFLQGFEPM  605
            +DP     FL GFEP+
Sbjct  187  TDPDPNLWFLPGFEPL  202



>ref|XP_009351285.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Pyrus x 
bretschneideri]
Length=440

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 143/196 (73%), Gaps = 15/196 (8%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            F LVGF +FVR NP+SD F V RFHHVEFWC DATN A RFSW LGMP+ AKSDLSTGN 
Sbjct  9    FNLVGFSNFVRTNPRSDRFKVHRFHHVEFWCTDATNAALRFSWGLGMPMVAKSDLSTGNQ  68

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--------saHRSFNATHGLG  392
             HASYLLR+  G+L FLFTAPY+ +++  A  A PS S+        +A R+F+ATHGLG
Sbjct  69   THASYLLRS--GDLNFLFTAPYSPTLTRTADPARPSNSSASIPTFDHTASRAFSATHGLG  126

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----L  557
            VRAVA+ VED  +AF+ SV+ GAKP + P+ L+N+V +AEV LYGDVVLR++SY     L
Sbjct  127  VRAVAIQVEDAVSAFTTSVAHGAKPSAAPILLDNRVTIAEVQLYGDVVLRYVSYSDHNHL  186

Query  558  SDPSAVTTFLQGFEPM  605
            +DP     FL GFEP+
Sbjct  187  TDPDPNLWFLPGFEPL  202



>gb|AFB74208.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
Length=445

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 142/201 (71%), Gaps = 11/201 (5%)
 Frame = +3

Query  36   STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  215
            +T  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKS
Sbjct  21   ATSASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKS  80

Query  216  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNAT  380
            DLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    + S        +RSF ++
Sbjct  81   DLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGENPPTTTASIPSFDHVTYRSFFSS  138

Query  381  HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS  560
            HGLGVRAVA+ VED ++AFS SVS GA P S P+ LN+ V +AEV LYGDV LR++SY  
Sbjct  139  HGLGVRAVAVEVEDAESAFSISVSNGAVPSSPPIVLNDAVTIAEVKLYGDVALRYVSY--  196

Query  561  DPSAVTTFLQGFEPMDGTASY  623
                 T FL  FE +D T+S+
Sbjct  197  --KVATVFLPRFETVDDTSSF  215



>ref|XP_008353631.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Malus domestica]
Length=457

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 143/196 (73%), Gaps = 15/196 (8%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            F LVGF +FVR NP+SD F V RFHHVEFWC DATN A RFSW LGMP+ AKSDLSTGN 
Sbjct  26   FNLVGFSNFVRTNPRSDRFRVHRFHHVEFWCTDATNAALRFSWGLGMPMVAKSDLSTGNQ  85

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--------saHRSFNATHGLG  392
             HASYLLR+  G+L FLFTAPY+ +++  A  A PS S+        +A R+F+ATHGLG
Sbjct  86   THASYLLRS--GDLNFLFTAPYSPTLTRTADPARPSNSSASIPTFDHTASRAFSATHGLG  143

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----L  557
            VRAVA+ VED  +AF+ SV+ GAKP + P+ L+N+V +AEV LYGDVVLR++SY     L
Sbjct  144  VRAVAIQVEDAVSAFTTSVAHGAKPSAAPILLDNRVTIAEVQLYGDVVLRYVSYSDHNHL  203

Query  558  SDPSAVTTFLQGFEPM  605
            +DP     FL GFEP+
Sbjct  204  TDPDPNLWFLPGFEPL  219



>ref|XP_002892349.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68608.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis lyrata subsp. 
lyrata]
Length=445

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 139/195 (71%), Gaps = 7/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VK FHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  23   GFKLVGFSKFVRKNPKSDKFKVKCFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  82

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S S        + S  +      RSF ++HGLGVR
Sbjct  83   MVHASYLL--TSGDLRFLFTAPYSPSFSAGEIKPTMTASIPSFDHVSCRSFFSSHGLGVR  140

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ VED ++AFS SV+ GA P S P+ L+  V +AEV LYGDVVLR++SY    +  +
Sbjct  141  AVAIEVEDAESAFSISVANGAIPSSPPIVLDESVTIAEVKLYGDVVLRYVSYKGGNTDKS  200

Query  579  TFLQGFEPMDGTASY  623
             FL GFEP++ T+S+
Sbjct  201  EFLPGFEPVEDTSSF  215



>gb|KFK42972.1| hypothetical protein AALP_AA1G063200 [Arabis alpina]
Length=439

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 144/205 (70%), Gaps = 7/205 (3%)
 Frame = +3

Query  18   SSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGM  197
            S  + H    +  FKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM
Sbjct  9    SETHQHDGSTSPEFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGM  68

Query  198  PIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---RS  368
              +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S        S  +  H   RS
Sbjct  69   RFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSATGPIDTASIPSFDHVTSRS  126

Query  369  FNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFI  548
            F ++HGLGVRAVA+ VED + AFS SV+ GA P S P+ L+  V ++EV LYGDVVLR++
Sbjct  127  FFSSHGLGVRAVAIEVEDAELAFSISVANGAIPSSPPIILDESVTISEVKLYGDVVLRYV  186

Query  549  SYLSDPSAVTTFLQGFEPMDGTASY  623
            SY  + +  T FL GFE ++ T+S+
Sbjct  187  SYKGEVN--TNFLPGFEAVEDTSSF  209



>ref|XP_010486350.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Camelina sativa]
Length=450

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 142/196 (72%), Gaps = 8/196 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  27   GFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  86

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S++   +    + S       + RSF ++HGLGVR
Sbjct  87   MVHASYLL--TSGDLRFLFTAPYSPSLTAGETKPTATASIPSFDHVSSRSFFSSHGLGVR  144

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLN-NQVVLAEVHLYGDVVLRFISYLSDPSAV  575
            AVA+ VED ++AFS SVS GA P S P+ L+   V +AEV LYGDVVLR++SY    +  
Sbjct  145  AVAIEVEDAESAFSVSVSNGAIPSSPPMVLDGGAVTIAEVKLYGDVVLRYVSYKEGDTDK  204

Query  576  TTFLQGFEPMDGTASY  623
            + FL GFEP+  T+S+
Sbjct  205  SEFLPGFEPVVDTSSF  220



>emb|CDY09969.1| BnaC08g44820D [Brassica napus]
Length=440

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 143/204 (70%), Gaps = 10/204 (5%)
 Frame = +3

Query  27   NHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIA  206
              H    + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN +RRFSW LGM  +
Sbjct  12   QQHDDAASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVSRRFSWGLGMRFS  71

Query  207  AKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSF  371
            AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    + S      ++ RSF
Sbjct  72   AKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGEAQPSATASIPSFDHASCRSF  129

Query  372  NATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFIS  551
             ++HGLGVRAVA+ VED ++AFS SV+ GA P S P  LN  V +AEV LYGDVVLR++S
Sbjct  130  FSSHGLGVRAVAIEVEDAESAFSISVANGAVPSSPPNVLNGAVTIAEVKLYGDVVLRYVS  189

Query  552  YLSDPSAVTTFLQGFEPMDGTASY  623
            Y    +   +FL GFE +D T+S+
Sbjct  190  YY---NGTVSFLPGFESVDDTSSF  210



>ref|XP_004303888.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 142/193 (74%), Gaps = 8/193 (4%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  224
            E   F LVGF +FVR NP+SD F+V RFHH+EFWC DATNTA RFSW LGMP+ AKSDLS
Sbjct  6    ETTQFNLVGFSNFVRSNPRSDRFAVTRFHHIEFWCTDATNTALRFSWGLGMPLVAKSDLS  65

Query  225  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsf-sasaHRSFNATHGLGVRA  401
            TGN +HASYLLR++  +L FLF+APY+ S+S P S+A       SA R+F+A HGL VRA
Sbjct  66   TGNHSHASYLLRSA--DLSFLFSAPYSPSLSGPTSSASIPSFDHSASRAFSAKHGLAVRA  123

Query  402  VALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----LSDP  566
            VA+ V D   AF ASVS GAKP S P+ L+N+V +AEVHLYGDVVLR++SY      SDP
Sbjct  124  VAIQVADADLAFHASVSHGAKPASPPILLDNRVTIAEVHLYGDVVLRYVSYKDPAQRSDP  183

Query  567  SAVTTFLQGFEPM  605
            +    FL GFEP+
Sbjct  184  NPDLWFLPGFEPV  196



>gb|AFB74207.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
Length=440

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 143/204 (70%), Gaps = 10/204 (5%)
 Frame = +3

Query  27   NHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIA  206
              H    + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN +RRFSW LGM  +
Sbjct  12   QQHDDAASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVSRRFSWGLGMRFS  71

Query  207  AKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSF  371
            AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    + S      ++ RSF
Sbjct  72   AKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGEAQPSATASIPSFDHASCRSF  129

Query  372  NATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFIS  551
             ++HGLGVRAVA+ VED ++AFS SV+ GA P S P  LN  V +AEV LYGDVVLR++S
Sbjct  130  FSSHGLGVRAVAIEVEDAESAFSISVANGAVPSSPPNVLNGAVTIAEVKLYGDVVLRYVS  189

Query  552  YLSDPSAVTTFLQGFEPMDGTASY  623
            Y    +   +FL GFE +D T+S+
Sbjct  190  YY---NGTVSFLPGFESVDDTSSF  210



>gb|AFB74218.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
 emb|CDY06216.1| BnaA09g49870D [Brassica napus]
Length=440

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 139/192 (72%), Gaps = 7/192 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  24   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  83

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfs--asaHRSFNATHGLGVRAVA  407
              HASYLL  + G+L+FLFTAPY+ S+S   ++     S    + RSF ++HGLGVRAVA
Sbjct  84   MVHASYLL--TSGDLRFLFTAPYSPSLSAGETSTASIPSFDHVSCRSFFSSHGLGVRAVA  141

Query  408  LVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFL  587
            + VED ++AFS SV+ GA P S P  LN  V +AEV LYGDVVLR++SY    +    FL
Sbjct  142  IEVEDAESAFSISVANGAVPSSPPNVLNGAVTIAEVKLYGDVVLRYVSY---HNGAVNFL  198

Query  588  QGFEPMDGTASY  623
             GFE +D T+S+
Sbjct  199  PGFESVDDTSSF  210



>ref|XP_009118533.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa]
Length=443

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 10/195 (5%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  24   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  83

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S+S   +    + S  +      RSF ++HGLGVR
Sbjct  84   MVHASYLL--TPGDLRFLFTAPYSPSLSAGETRTSATASIPSFDHVSCRSFFSSHGLGVR  141

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            AVA+ VED ++AFS SV+ GA P S P  LN  V +AEV LYGDVVLR++SY    +   
Sbjct  142  AVAIEVEDAESAFSISVANGAVPSSPPNVLNGAVTIAEVKLYGDVVLRYVSY---HNGAV  198

Query  579  TFLQGFEPMDGTASY  623
             FL GFE +D T+S+
Sbjct  199  NFLPGFESVDDTSSF  213



>ref|XP_006417901.1| hypothetical protein EUTSA_v10007634mg [Eutrema salsugineum]
 dbj|BAJ34100.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36254.1| hypothetical protein EUTSA_v10007634mg [Eutrema salsugineum]
Length=445

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 141/198 (71%), Gaps = 7/198 (4%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  224
            E+ GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLS
Sbjct  21   ESPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLS  80

Query  225  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGL  389
            TGN  HASYLL  + G+L+FLFTA Y+ S++        + S  +      RSF ++HGL
Sbjct  81   TGNMVHASYLL--TSGDLRFLFTAAYSPSLAAGEIRPTATASIPSFDHISWRSFFSSHGL  138

Query  390  GVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPS  569
            GVRAVA+ VED ++AFS SV+ GA P S P+ L+  V +AEV LYGDVVLR++S+    +
Sbjct  139  GVRAVAIEVEDAESAFSISVANGAIPSSPPIVLDEAVTIAEVKLYGDVVLRYVSHNGVNT  198

Query  570  AVTTFLQGFEPMDGTASY  623
              + FL GFE ++ T+S+
Sbjct  199  DKSDFLPGFELVEDTSSF  216



>gb|ADO62712.1| p-hydroxyphenylpyruvate dioxygenase [Mangifera indica]
Length=432

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 140/197 (71%), Gaps = 6/197 (3%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  224
            ++G F+LVGF +FVR NPKSD F VK+FHH+EFWC DATN ARRFSW LGMPI AKSDLS
Sbjct  4    QDGSFELVGFSNFVRHNPKSDRFKVKKFHHIEFWCTDATNVARRFSWGLGMPIIAKSDLS  63

Query  225  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---RSFNATHGLGV  395
            TGN  HASYLLR+  GEL F+FTAPY+ SIS        S    ++   R+F  +HGL V
Sbjct  64   TGNMVHASYLLRS--GELNFVFTAPYSPSISGDDYKNTASIPTFSYDSCRAFAVSHGLAV  121

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAV  575
            R+V + VED + AF+ S + GAKPVS P  L+N+ V++EVHLYGDVVLR++SY S  +  
Sbjct  122  RSVGVDVEDAEIAFTTSAAHGAKPVSSPRILDNRAVISEVHLYGDVVLRYVSYKSGNNFD  181

Query  576  TT-FLQGFEPMDGTASY  623
            +  FL GFE  D   S+
Sbjct  182  SCLFLPGFERTDEITSF  198



>ref|XP_007048963.1| Phytoene desaturation 1 isoform 3 [Theobroma cacao]
 gb|EOX93120.1| Phytoene desaturation 1 isoform 3 [Theobroma cacao]
Length=389

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 148/213 (69%), Gaps = 15/213 (7%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKET S+ +         FKLVGF  FVR NPKSD F+VKRFHH+EFWC DATNTARRFS
Sbjct  2    GKETLSNSSQE-------FKLVGFSKFVRTNPKSDRFNVKRFHHIEFWCSDATNTARRFS  54

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa---  353
            W LGM + AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI++  S +  S ++   
Sbjct  55   WGLGMQLLAKSDLSTGNLTHASYLLRS--GDLHFLFTAPYSPSIAHSQSLSPLSTASIPT  112

Query  354  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  524
               SA RSF+++HGL VRA+A+ VED + AF+ SVS GA P S PV L + V L+EV LY
Sbjct  113  FDHSACRSFSSSHGLAVRAIAIEVEDAETAFTTSVSHGALPSSPPVVLGDNVTLSEVKLY  172

Query  525  GDVVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            GDVVLR+IS+  +      FL GFE ++   SY
Sbjct  173  GDVVLRYISHNKNNDHDFFFLPGFEKIEDNLSY  205



>ref|XP_007048964.1| Phytoene desaturation 1 isoform 4, partial [Theobroma cacao]
 gb|EOX93121.1| Phytoene desaturation 1 isoform 4, partial [Theobroma cacao]
Length=396

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 148/213 (69%), Gaps = 15/213 (7%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKET S+ +         FKLVGF  FVR NPKSD F+VKRFHH+EFWC DATNTARRFS
Sbjct  2    GKETLSNSSQE-------FKLVGFSKFVRTNPKSDRFNVKRFHHIEFWCSDATNTARRFS  54

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa---  353
            W LGM + AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI++  S +  S ++   
Sbjct  55   WGLGMQLLAKSDLSTGNLTHASYLLRS--GDLHFLFTAPYSPSIAHSQSLSPLSTASIPT  112

Query  354  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  524
               SA RSF+++HGL VRA+A+ VED + AF+ SVS GA P S PV L + V L+EV LY
Sbjct  113  FDHSACRSFSSSHGLAVRAIAIEVEDAETAFTTSVSHGALPSSPPVVLGDNVTLSEVKLY  172

Query  525  GDVVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            GDVVLR+IS+  +      FL GFE ++   SY
Sbjct  173  GDVVLRYISHNKNNDHDFFFLPGFEKIEDNLSY  205



>ref|XP_007048961.1| Phytoene desaturation 1 isoform 1 [Theobroma cacao]
 gb|EOX93118.1| Phytoene desaturation 1 isoform 1 [Theobroma cacao]
Length=439

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 148/213 (69%), Gaps = 15/213 (7%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKET S+ +         FKLVGF  FVR NPKSD F+VKRFHH+EFWC DATNTARRFS
Sbjct  2    GKETLSNSSQE-------FKLVGFSKFVRTNPKSDRFNVKRFHHIEFWCSDATNTARRFS  54

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa---  353
            W LGM + AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI++  S +  S ++   
Sbjct  55   WGLGMQLLAKSDLSTGNLTHASYLLRS--GDLHFLFTAPYSPSIAHSQSLSPLSTASIPT  112

Query  354  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  524
               SA RSF+++HGL VRA+A+ VED + AF+ SVS GA P S PV L + V L+EV LY
Sbjct  113  FDHSACRSFSSSHGLAVRAIAIEVEDAETAFTTSVSHGALPSSPPVVLGDNVTLSEVKLY  172

Query  525  GDVVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            GDVVLR+IS+  +      FL GFE ++   SY
Sbjct  173  GDVVLRYISHNKNNDHDFFFLPGFEKIEDNLSY  205



>ref|XP_008466793.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Cucumis melo]
Length=467

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 137/203 (67%), Gaps = 15/203 (7%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKL GF +F R NPKSD F VKRFHH+EFWC DATN ARRFSW LGM I AKSDLSTGN
Sbjct  33   GFKLTGFNNFTRTNPKSDRFKVKRFHHIEFWCTDATNVARRFSWGLGMQIVAKSDLSTGN  92

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH------RSFNATHGLGV  395
              HASYLLR+  G+L FLFTAPY+ SI+   +    S ++         R+F+ THG G 
Sbjct  93   MTHASYLLRS--GQLCFLFTAPYSPSIAAAHNLTPASTASIPSFDHSVCRAFSGTHGFGA  150

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAV  575
            RA+AL VED + AF  SV+ GAKP   P+ L+N+ VL+EVH+YGDVVLR+ISY +  S  
Sbjct  151  RAIALEVEDAEIAFRTSVTHGAKPSCPPIVLDNRAVLSEVHMYGDVVLRYISYKNPVSGD  210

Query  576  TT-------FLQGFEPMDGTASY  623
                     FL  FE M+ TAS+
Sbjct  211  NGENKPDDWFLPKFEAMEETASF  233



>emb|CDY10210.1| BnaC05g04530D [Brassica napus]
Length=445

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 144/202 (71%), Gaps = 12/202 (6%)
 Frame = +3

Query  36   STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  215
            +T  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  ++KS
Sbjct  20   ATSASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSSKS  79

Query  216  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNAT  380
            DLSTGN  HASYLL  + G+L+FLFTAP++ SIS        + S        + SF ++
Sbjct  80   DLSTGNMVHASYLL--TSGDLRFLFTAPFSPSISAGEIPPNTTASIPSFDHVTYHSFFSS  137

Query  381  HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS  560
            HGLGVRAVA+ VED ++AFS S+S GA P S P+ LN+ V +AEV LYGDVVLR++SY  
Sbjct  138  HGLGVRAVAIEVEDAESAFSVSISNGAVPSSPPIALNDAVTIAEVKLYGDVVLRYVSY--  195

Query  561  DPSAVTT-FLQGFEPMDGTASY  623
               AVT+ FL  FE ++ T+S+
Sbjct  196  --KAVTSVFLPRFETVEDTSSF  215



>ref|XP_007048962.1| Phytoene desaturation 1 isoform 2 [Theobroma cacao]
 gb|EOX93119.1| Phytoene desaturation 1 isoform 2 [Theobroma cacao]
Length=445

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 148/213 (69%), Gaps = 15/213 (7%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKET S+ +         FKLVGF  FVR NPKSD F+VKRFHH+EFWC DATNTARRFS
Sbjct  2    GKETLSNSSQE-------FKLVGFSKFVRTNPKSDRFNVKRFHHIEFWCSDATNTARRFS  54

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa---  353
            W LGM + AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI++  S +  S ++   
Sbjct  55   WGLGMQLLAKSDLSTGNLTHASYLLRS--GDLHFLFTAPYSPSIAHSQSLSPLSTASIPT  112

Query  354  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  524
               SA RSF+++HGL VRA+A+ VED + AF+ SVS GA P S PV L + V L+EV LY
Sbjct  113  FDHSACRSFSSSHGLAVRAIAIEVEDAETAFTTSVSHGALPSSPPVVLGDNVTLSEVKLY  172

Query  525  GDVVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            GDVVLR+IS+  +      FL GFE ++   SY
Sbjct  173  GDVVLRYISHNKNNDHDFFFLPGFEKIEDNLSY  205



>ref|XP_010457787.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=450

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 142/196 (72%), Gaps = 8/196 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  27   GFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  86

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  398
              HASYLL  + G+L+FLFTAPY+ S++   +    + S  +      RSF ++HGLGVR
Sbjct  87   MVHASYLL--TSGDLRFLFTAPYSPSLTAGETKPTATASIPSFDHVSCRSFFSSHGLGVR  144

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLN-NQVVLAEVHLYGDVVLRFISYLSDPSAV  575
            AVA+ VED ++AFS S+S GA P S P+ L+   V +AEV LYGDVVLR++SY    +  
Sbjct  145  AVAIEVEDAESAFSISLSNGANPSSPPMVLDGGAVTIAEVKLYGDVVLRYVSYKEGDTDK  204

Query  576  TTFLQGFEPMDGTASY  623
            + FL GFE ++ T+S+
Sbjct  205  SEFLPGFEHVEDTSSF  220



>ref|XP_003617391.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AAX59006.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AET00350.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=437

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 141/195 (72%), Gaps = 8/195 (4%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGFK+FVR NPKSD F+VKRFHHVEFWC DATNTARRFS  LGMPI AKSDLSTGN
Sbjct  14   GFKLVGFKNFVRANPKSDRFNVKRFHHVEFWCTDATNTARRFSHGLGMPIVAKSDLSTGN  73

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR---SFNATHGLGVRAV  404
              HASYLLR+  G+L FLF+A Y+ SIS  + ++  +    +     SF+A+HGL VRAV
Sbjct  74   LTHASYLLRS--GDLNFLFSAAYSPSISLSSPSSTAAIPTFSASTCFSFSASHGLAVRAV  131

Query  405  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS-DPSAVTT  581
            A+ VED + AF+ SV+ GA P S PV L N V LAEVHLYGDVVLR++SY   +P+    
Sbjct  132  AVEVEDAEVAFTTSVNLGAIPSSPPVILENNVKLAEVHLYGDVVLRYVSYNDLNPNQNPN  191

Query  582  --FLQGFEPMDGTAS  620
              FL GFE +   +S
Sbjct  192  LFFLPGFERVSDESS  206



>ref|XP_010053900.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89762.1| hypothetical protein EUGRSUZ_A02022 [Eucalyptus grandis]
Length=448

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 139/201 (69%), Gaps = 14/201 (7%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF +FVR NP+SD F V+RFHHVEFWC DATN +RRF+W LGMP+ AKSDLSTGN+
Sbjct  16   FKLVGFSNFVRSNPRSDRFPVRRFHHVEFWCTDATNVSRRFAWGLGMPVVAKSDLSTGNA  75

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRS------FNATHGLGVR  398
             HASYL R+  G+L FLFTAPY+ SI+        + ++    S      F A HGLGVR
Sbjct  76   THASYLCRS--GDLCFLFTAPYSPSIAASEGLDPSATASLPSFSYSDCVAFAAKHGLGVR  133

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS------  560
            AVA+ VED  AAF  SV+ GA+PVS PV L+ +  +AEVHLYGDVVLR++SY +      
Sbjct  134  AVAVEVEDADAAFRTSVAHGARPVSPPVVLDGRAAVAEVHLYGDVVLRYVSYKTPASDRG  193

Query  561  DPSAVTTFLQGFEPMDGTASY  623
            D S  + FL  FEP D  +S+
Sbjct  194  DSSPDSWFLPRFEPTDEISSF  214



>ref|XP_008380188.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Malus domestica]
Length=457

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 141/195 (72%), Gaps = 14/195 (7%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            F LVGF +FVR NP+SD F V RFHHV+FWC DATN A RFSW LGMP+ AKSDLSTGN 
Sbjct  18   FNLVGFSNFVRTNPRSDRFKVHRFHHVZFWCTDATNAALRFSWGLGMPMVAKSDLSTGNQ  77

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-------saHRSFNATHGLGV  395
             HASYLLR+   +L FLFTAPY+ +++  A  A P  +A       SA R+F+ATHGLGV
Sbjct  78   XHASYLLRSX--DLVFLFTAPYSPTLTRXADPARPRTTASIPTFDHSASRAFSATHGLGV  135

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----LS  560
            RAVA+ VED  +AF+ASV+ GAKP + P+ L+N+V +AEV LYGDVVLR++SY     L+
Sbjct  136  RAVAIQVEDAVSAFTASVAHGAKPSAAPILLDNRVTIAEVQLYGDVVLRYVSYTDHNHLT  195

Query  561  DPSAVTTFLQGFEPM  605
            DP     FL GFE +
Sbjct  196  DPDPHLWFLPGFESL  210



>ref|XP_004162282.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Cucumis 
sativus]
Length=455

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 140/216 (65%), Gaps = 15/216 (7%)
 Frame = +3

Query  15   SSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALG  194
            S + +  +T     F+L GF +F+R NPKSD F VKRFHH+EFWC DATN ARRFSW LG
Sbjct  12   SEATDGGATASQSEFELQGFDNFIRTNPKSDRFKVKRFHHIEFWCTDATNVARRFSWGLG  71

Query  195  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH----  362
            M I AKSDLSTGN  HASYLLR+  G L FLFTAPY+ SI+   +    S ++       
Sbjct  72   MQIVAKSDLSTGNMTHASYLLRS--GHLCFLFTAPYSPSIAAAQNLTPASTASIPSFDHS  129

Query  363  --RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVV  536
              RSF+ THG G RA+AL VED + AF  SV+ GAKP   P+ L N+ VL+EVHLYGDVV
Sbjct  130  VCRSFSGTHGFGARAIALEVEDAEIAFRTSVAHGAKPSCPPIVLENRAVLSEVHLYGDVV  189

Query  537  LRFISYLSDPSAVTT-------FLQGFEPMDGTASY  623
            LR+ISY +  S           FL  FE M+ TAS+
Sbjct  190  LRYISYKNPVSGDNGENKPDEWFLPKFEAMEETASF  225



>ref|XP_010274102.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nelumbo nucifera]
Length=507

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = +3

Query  30   HHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAA  209
             H T    GFKLVG+ +FVR N KSD F VKRFHH+EFWC DATN+ARRFSW LGMPI A
Sbjct  76   EHVTNGAPGFKLVGYANFVRHNLKSDRFHVKRFHHIEFWCTDATNSARRFSWGLGMPIVA  135

Query  210  KSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfs--asaHRSFNATH  383
            KSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI+   +      +   SA RSF+A+H
Sbjct  136  KSDLSTGNLVHASYLLRS--GDLDFLFTAPYSPSITGNLTNTASIPTFNHSAARSFSASH  193

Query  384  GLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSD  563
            GL VRA+++ VED  +AF+ SV+ GAKP S PV + + VVL+E+HLYGD +LR+IS   +
Sbjct  194  GLAVRAISIEVEDATSAFNISVAHGAKPSSPPVEIGDGVVLSEIHLYGDAILRYISR-KN  252

Query  564  PSAVTTFLQGFEPMDGTASY  623
            P+    FL GFE  +  +SY
Sbjct  253  PNLNLIFLPGFEKYEEGSSY  272



>ref|XP_004144629.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Cucumis 
sativus]
 gb|KGN54940.1| 4-hydroxyphenylpyruvate dioxygenase [Cucumis sativus]
Length=455

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 140/216 (65%), Gaps = 15/216 (7%)
 Frame = +3

Query  15   SSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALG  194
            S + +  +T     F+L GF +F+R NPKSD F VKRFHH+EFWC DATN ARRFSW LG
Sbjct  12   SEATDGGATASQSEFELQGFDNFIRTNPKSDRFKVKRFHHIEFWCTDATNVARRFSWGLG  71

Query  195  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH----  362
            M I AKSDLSTGN  HASYLLR+  G L FLFTAPY+ SI+   +    S ++       
Sbjct  72   MQIVAKSDLSTGNMTHASYLLRS--GHLCFLFTAPYSPSIAAAQNLTPASTASIPSFDHS  129

Query  363  --RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVV  536
              RSF+ THG G RA+AL VED + AF  SV+ GAKP   P+ L N+ VL+EVHLYGDVV
Sbjct  130  VCRSFSGTHGFGARAIALEVEDAEIAFRTSVAHGAKPSCPPIVLENRAVLSEVHLYGDVV  189

Query  537  LRFISYLSDPSAVTT-------FLQGFEPMDGTASY  623
            LR+ISY +  S           FL  FE M+ TAS+
Sbjct  190  LRYISYKNPVSGDNGENKPDEWFLPKFEAMEETASF  225



>ref|XP_010542713.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Tarenaya hassleriana]
Length=454

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 138/199 (69%), Gaps = 11/199 (6%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF  FVR NPKSD F VK FHHVEFWCGDATN ARRFSW LGM IA KSDLSTGN
Sbjct  22   GFKLVGFSKFVRTNPKSDKFKVKSFHHVEFWCGDATNVARRFSWGLGMRIAGKSDLSTGN  81

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---------RSFNATHG  386
              HASYLL  + G+L+FLFTAPY+ S++  A+AA      +A           SF A+HG
Sbjct  82   MVHASYLL--TSGDLRFLFTAPYSPSLAAAAAAAEIRPMTTASIPTFNPAVCCSFFASHG  139

Query  387  LGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDP  566
            L VRAV + VED ++AFS SV+ GA P S PV L   V +AEV LYGDVVLR++SY++  
Sbjct  140  LSVRAVGIEVEDAESAFSISVANGAVPSSPPVVLAGAVTIAEVKLYGDVVLRYVSYVNKA  199

Query  567  SAVTTFLQGFEPMDGTASY  623
                 FL GFEP++ T S+
Sbjct  200  DFDFDFLPGFEPVEDTTSF  218



>ref|XP_010053920.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89764.1| hypothetical protein EUGRSUZ_A02024 [Eucalyptus grandis]
Length=447

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 143/211 (68%), Gaps = 14/211 (7%)
 Frame = +3

Query  27   NHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIA  206
            N   TP +  FKLVGF +FVR NP+SD F V+RFHHVEFWC DATN +RRFSW LGMPI 
Sbjct  5    NDGITPVSDEFKLVGFSNFVRSNPRSDRFPVRRFHHVEFWCTDATNASRRFSWGLGMPIV  64

Query  207  AKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNAT--  380
            AKSDLSTGN+ HASYL R+  G+L FLFTAPY+ SI+        S ++    S++A   
Sbjct  65   AKSDLSTGNATHASYLCRS--GDLCFLFTAPYSPSIAASEGLNPSSTASLPSFSYSACVA  122

Query  381  ----HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFI  548
                HGL VRA+A+ VED  AAF  SV++GA+PVS PV L+    +AEVHLYGDVVLR++
Sbjct  123  FAVKHGLAVRAIAIEVEDADAAFHISVAQGARPVSSPVVLDGTATIAEVHLYGDVVLRYV  182

Query  549  SYLS------DPSAVTTFLQGFEPMDGTASY  623
            SY +      + S  + FL  F+P D  +S+
Sbjct  183  SYKTPTSDHDNSSPDSWFLPRFKPTDEVSSF  213



>gb|KJB08583.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=396

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 8/195 (4%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF +FVR NPKSD F+VKRFHH+EFWC DATN ARRFSW LGM   AKSDLSTGN 
Sbjct  13   FKLVGFSNFVRSNPKSDRFTVKRFHHIEFWCTDATNVARRFSWGLGMQFVAKSDLSTGNL  72

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH------RSFNATHGLGVR  398
             H+SYLLR+  G+L FLFTAPY+ SI+   + +  S ++         RSF ATHGLGVR
Sbjct  73   THSSYLLRS--GDLNFLFTAPYSPSIAVAQNLSPQSTASIPSFDHSLCRSFAATHGLGVR  130

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            A+A+ V+D + AF+ SV+ GA P S P  L +   +AEV LYGDVVLR++SY +  ++  
Sbjct  131  AIAIEVDDAETAFTTSVTHGALPFSPPTPLGDVATIAEVKLYGDVVLRYVSYTTTINSDH  190

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++   SY
Sbjct  191  DFLPGFEKIEDALSY  205



>gb|KJB08582.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=413

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 8/195 (4%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF +FVR NPKSD F+VKRFHH+EFWC DATN ARRFSW LGM   AKSDLSTGN 
Sbjct  13   FKLVGFSNFVRSNPKSDRFTVKRFHHIEFWCTDATNVARRFSWGLGMQFVAKSDLSTGNL  72

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH------RSFNATHGLGVR  398
             H+SYLLR+  G+L FLFTAPY+ SI+   + +  S ++         RSF ATHGLGVR
Sbjct  73   THSSYLLRS--GDLNFLFTAPYSPSIAVAQNLSPQSTASIPSFDHSLCRSFAATHGLGVR  130

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            A+A+ V+D + AF+ SV+ GA P S P  L +   +AEV LYGDVVLR++SY +  ++  
Sbjct  131  AIAIEVDDAETAFTTSVTHGALPFSPPTPLGDVATIAEVKLYGDVVLRYVSYTTTINSDH  190

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++   SY
Sbjct  191  DFLPGFEKIEDALSY  205



>gb|KJB08581.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=463

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 8/195 (4%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF +FVR NPKSD F+VKRFHH+EFWC DATN ARRFSW LGM   AKSDLSTGN 
Sbjct  40   FKLVGFSNFVRSNPKSDRFTVKRFHHIEFWCTDATNVARRFSWGLGMQFVAKSDLSTGNL  99

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH------RSFNATHGLGVR  398
             H+SYLLR+  G+L FLFTAPY+ SI+   + +  S ++         RSF ATHGLGVR
Sbjct  100  THSSYLLRS--GDLNFLFTAPYSPSIAVAQNLSPQSTASIPSFDHSLCRSFAATHGLGVR  157

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            A+A+ V+D + AF+ SV+ GA P S P  L +   +AEV LYGDVVLR++SY +  ++  
Sbjct  158  AIAIEVDDAETAFTTSVTHGALPFSPPTPLGDVATIAEVKLYGDVVLRYVSYTTTINSDH  217

Query  579  TFLQGFEPMDGTASY  623
             FL GFE ++   SY
Sbjct  218  DFLPGFEKIEDALSY  232



>emb|CAN71143.1| hypothetical protein VITISV_033518 [Vitis vinifera]
Length=445

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 142/202 (70%), Gaps = 16/202 (8%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF +F+R NP SD F VKRFHH+EFW  DATN ARRFSW LGMPI AKSDLSTGN
Sbjct  14   GFKLVGFSNFLRTNPMSDRFGVKRFHHIEFWSTDATNLARRFSWGLGMPIVAKSDLSTGN  73

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  398
              HASYL R+  G+L FLFTAPY+ SI+     A  + S      SA  +F A+HGLGVR
Sbjct  74   VIHASYLTRS--GDLNFLFTAPYSPSIAGDLENAAATASIPSFDHSACHAFAASHGLGVR  131

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-------L  557
            A+A+ V+D + AF  SV+ GA+P+S PVT+   VV++EVHLYGD VLR++SY        
Sbjct  132  AIAIEVDDAEGAFHTSVAHGARPMSPPVTMGGSVVISEVHLYGDAVLRYVSYKNPNPNAT  191

Query  558  SDPSAVTTFLQGFEPMDGTASY  623
            SDPS  + FL GFE +D  +S+
Sbjct  192  SDPS--SWFLPGFEAVDEGSSF  211



>ref|NP_001235148.1| 4-hydroxyphenylpyruvate dioxygenase [Glycine max]
 gb|ABQ96868.1| 4-hydroxyphenylpyruvate dioxygenase [Glycine max]
Length=443

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 144/202 (71%), Gaps = 16/202 (8%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGFK+FVR NPKSD F V RFHH+EFWC DATN +RRFSW LGMPI AKSDLSTGN
Sbjct  16   GFKLVGFKNFVRTNPKSDRFQVNRFHHIEFWCTDATNASRRFSWGLGMPIVAKSDLSTGN  75

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfs----asaHRSFNATHGLGVRA  401
              HASYLLR+  G+L FLF+APY+ S+S  +SAA  +      A+   +F A HG GVRA
Sbjct  76   QIHASYLLRS--GDLSFLFSAPYSPSLSAGSSAASSASIPSFDAATCLAFAAKHGFGVRA  133

Query  402  VALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL--------  557
            +AL V D +AAFSASV++GA+P S PV ++++   AEV LYGDVVLR++SY         
Sbjct  134  IALEVADAEAAFSASVAKGAEPASPPVLVDDRTGFAEVRLYGDVVLRYVSYKDAAPQAPH  193

Query  558  SDPSAVTTFLQGFEPMDGTASY  623
            +DPS    FL GFE    ++S+
Sbjct  194  ADPS--RWFLPGFEAAASSSSF  213



>gb|AIN39549.1| 4-hydroxyphenylpyruvate dioxygenase short isoform [Glycine max]
Length=447

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 144/202 (71%), Gaps = 16/202 (8%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGFK+FVR NPKSD F V RFHH+EFWC DATN +RRFSW LGMPI AKSDLSTGN
Sbjct  20   GFKLVGFKNFVRTNPKSDRFQVNRFHHIEFWCTDATNASRRFSWGLGMPIVAKSDLSTGN  79

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfs----asaHRSFNATHGLGVRA  401
              HASYLLR+  G+L FLF+APY+ S+S  +SAA  +      A+   +F A HG GVRA
Sbjct  80   QIHASYLLRS--GDLSFLFSAPYSPSLSAGSSAASSASIPSFDAATCLAFAAKHGFGVRA  137

Query  402  VALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL--------  557
            +AL V D +AAFSASV++GA+P S PV ++++   AEV LYGDVVLR++SY         
Sbjct  138  IALEVADAEAAFSASVAKGAEPASPPVLVDDRTGFAEVRLYGDVVLRYVSYKDAAPQAPH  197

Query  558  SDPSAVTTFLQGFEPMDGTASY  623
            +DPS    FL GFE    ++S+
Sbjct  198  ADPS--RWFLPGFEAAASSSSF  217



>sp|Q9ARF9.1|HPPD_PLESU RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Solenostemon scutellarioides]
 emb|CAC37394.1| 4-hydroxyphenylpyruvate dioxygenase [Solenostemon scutellarioides]
Length=436

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 146/182 (80%), Gaps = 5/182 (3%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVG K+FVR NP SDHF V RFHHVEFWCGDATNT+RRFSW LGMP+ AKSDLSTGNS
Sbjct  16   FKLVGHKNFVRSNPMSDHFPVHRFHHVEFWCGDATNTSRRFSWGLGMPLVAKSDLSTGNS  75

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
            AHASYLLR+  GEL F+FTAPY+ S++ P+SA+IP+FS S HR+F ++HGL VRAVA+ V
Sbjct  76   AHASYLLRS--GELSFVFTAPYSPSLAEPSSASIPTFSFSDHRAFTSSHGLAVRAVAIQV  133

Query  417  EDTQAAFSASVSRGAKPVSEPVTL-NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQG  593
            +   +A+SA+VSRGAKPVS PV L + +  +AEVHLYGD VLRF+S  S   A   FL G
Sbjct  134  DSASSAYSAAVSRGAKPVSPPVVLADCETAIAEVHLYGDTVLRFVSCGS--GADGWFLPG  191

Query  594  FE  599
            FE
Sbjct  192  FE  193



>gb|AIN39550.1| chloroplast 4-hydroxyphenylpyruvate dioxygenase long isoform 
[Glycine max]
Length=488

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 144/202 (71%), Gaps = 16/202 (8%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGFK+FVR NPKSD F V RFHH+EFWC DATN +RRFSW LGMPI AKSDLSTGN
Sbjct  61   GFKLVGFKNFVRTNPKSDRFQVNRFHHIEFWCTDATNASRRFSWGLGMPIVAKSDLSTGN  120

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfs----asaHRSFNATHGLGVRA  401
              HASYLLR+  G+L FLF+APY+ S+S  +SAA  +      A+   +F A HG GVRA
Sbjct  121  QIHASYLLRS--GDLSFLFSAPYSPSLSAGSSAASSASIPSFDAATCLAFAAKHGFGVRA  178

Query  402  VALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL--------  557
            +AL V D +AAFSASV++GA+P S PV ++++   AEV LYGDVVLR++SY         
Sbjct  179  IALEVADAEAAFSASVAKGAEPASPPVLVDDRTGFAEVRLYGDVVLRYVSYKDAAPQAPH  238

Query  558  SDPSAVTTFLQGFEPMDGTASY  623
            +DPS    FL GFE    ++S+
Sbjct  239  ADPS--RWFLPGFEAAASSSSF  258



>ref|XP_002283275.2| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Vitis vinifera]
Length=491

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 142/202 (70%), Gaps = 16/202 (8%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVGF +F+R NP SD F VKRFHH+EFW  DATN ARRFSW LGMPI AKSDLSTGN
Sbjct  60   GFKLVGFSNFLRTNPMSDRFGVKRFHHIEFWSTDATNLARRFSWGLGMPIVAKSDLSTGN  119

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  398
              HASYL R+  G+L FLFTAPY+ SI+     A  + S      SA  +F A+HGLGVR
Sbjct  120  VIHASYLTRS--GDLNFLFTAPYSPSIAGDLENAAATASIPSFDHSACHAFAASHGLGVR  177

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-------L  557
            A+A+ V+D + AF  SV+ GA+P+S PVT+   VV++EVHLYGD VLR++SY        
Sbjct  178  AIAIEVDDAEGAFHTSVAHGARPMSPPVTMGGSVVISEVHLYGDAVLRYVSYKNPNPNAT  237

Query  558  SDPSAVTTFLQGFEPMDGTASY  623
            SDPS  + FL GFE +D  +S+
Sbjct  238  SDPS--SWFLPGFEAVDEGSSF  257



>gb|EPS60251.1| hydroxyphenylpyruvate dioxygenase, partial [Genlisea aurea]
Length=402

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 141/179 (79%), Gaps = 4/179 (2%)
 Frame = +3

Query  84   VRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA  263
            VR NP++D FSV RFHHVEFWCGDATN A RFSW LGMP+AAKSDLSTGNSAHASYLLR+
Sbjct  1    VRNNPRTDRFSVVRFHHVEFWCGDATNAASRFSWGLGMPLAAKSDLSTGNSAHASYLLRS  60

Query  264  SGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSA  443
              G+L F+FTAPY+ S+S+P+SAAIP+FS SAHRSF ++HG GVRAVA++V    +AF+ 
Sbjct  61   --GQLDFIFTAPYSPSLSDPSSAAIPTFSVSAHRSFTSSHGFGVRAVAILVNSADSAFAE  118

Query  444  SVSRGAKPVSEPVTLNN-QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGTA  617
            SVSRGA+PV+ P  L++ +  +AEVHLYGD VLRF+S+          L GFEP++  A
Sbjct  119  SVSRGARPVAAPSVLSDGKTAVAEVHLYGDTVLRFVSH-DGADHKGLLLPGFEPVENEA  176



>dbj|BAF74636.1| hydroxyphenylpyruvate dioxygenase [Coptis japonica var. dissecta]
Length=430

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG  +FV  NPKSD F VK+FHH+EFW  DATNTARRFSW LGMP+ AKSDLSTGN 
Sbjct  9    LKLVGHTNFVHNNPKSDKFHVKKFHHIEFWSTDATNTARRFSWGLGMPMVAKSDLSTGNM  68

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---RSFNATHGLGVRAVA  407
             HASYLLR+  GEL FLFTAPY+ SI+        S    +H   R F +THGL VRA+A
Sbjct  69   VHASYLLRS--GELNFLFTAPYSPSIAGNTLTHTASIPTYSHNLARLFASTHGLAVRAIA  126

Query  408  LVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFL  587
            + V+D + A++ SV+ GAKP S P+ L+  VVL+E+ LYGDVVLR++S+  + +    FL
Sbjct  127  IEVQDAELAYNISVANGAKPSSSPIKLDEGVVLSEIQLYGDVVLRYLSF-KNTNQSCPFL  185

Query  588  QGFEPMDGTAS  620
             GFE +   +S
Sbjct  186  PGFEEVGEVSS  196



>ref|XP_003617384.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AET00343.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=428

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 135/193 (70%), Gaps = 6/193 (3%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            GFKLVG K+F+R NPK+D F VK FHHVEFWC DATNTA RFS  LGMPI AKSDLSTGN
Sbjct  10   GFKLVGCKNFIRTNPKTDRFKVKHFHHVEFWCTDATNTAHRFSHGLGMPIVAKSDLSTGN  69

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR---SFNATHGLGVRAV  404
              HASYLLR+  G+L FLFTA Y+ SIS  + ++  S    +     SF+ +HGL VRA+
Sbjct  70   LTHASYLLRS--GDLNFLFTAAYSPSISLSSPSSTASIPTFSPSTCFSFSNSHGLNVRAL  127

Query  405  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-LSDPSAVTT  581
            A+ VED + A++ SVS GA P S PV L N V LAEV L+GDVVLR++SY   + +    
Sbjct  128  AVEVEDAELAYTVSVSYGALPSSPPVVLENGVKLAEVRLFGDVVLRYVSYNNPNQNQNLL  187

Query  582  FLQGFEPMDGTAS  620
            FL GFE + G +S
Sbjct  188  FLPGFETLSGESS  200



>gb|KEH40154.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=428

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 138/192 (72%), Gaps = 9/192 (5%)
 Frame = +3

Query  33   HSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAK  212
            + T    GFKLVGFK F+R NPK+D F VKRFHHVEFWC DATNTA RFS  LGMPI AK
Sbjct  3    NETQTKTGFKLVGFKKFIRTNPKTDRFKVKRFHHVEFWCTDATNTALRFSQGLGMPIVAK  62

Query  213  SDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR---SFNATH  383
            SDLSTGN  HASYLLR+  G+L FLF+APY+ SIS  + ++  S    +     SF A+H
Sbjct  63   SDLSTGNLIHASYLLRS--GDLNFLFSAPYSPSISLSSPSSTASIPTFSASTCFSFCASH  120

Query  384  GLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYG-DVVLRFISYLS  560
            GL VRA+A+ V+D + AF+ SV+ GA P S P+ L N V LAEVHL+G DVVLR++SY +
Sbjct  121  GLAVRAIAIEVDDAELAFTVSVNHGALPSSPPIVLENGVKLAEVHLFGVDVVLRYVSY-N  179

Query  561  DPSAVTTFLQGF  596
            +P+ +  FL GF
Sbjct  180  NPNLL--FLPGF  189



>ref|XP_007141424.1| hypothetical protein PHAVU_008G194300g [Phaseolus vulgaris]
 gb|ESW13418.1| hypothetical protein PHAVU_008G194300g [Phaseolus vulgaris]
Length=492

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 139/205 (68%), Gaps = 9/205 (4%)
 Frame = +3

Query  6    KETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSW  185
            +E  S+   + T     FKLVGFK+FVR N +SD F V RFHH+EFWC DATN A RFSW
Sbjct  52   QEPISNTMGNQTELQSPFKLVGFKNFVRTNSESDRFQVNRFHHIEFWCTDATNAASRFSW  111

Query  186  ALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfs--asa  359
             LGMPI AKSDLSTGN  HASYLLR+  G+L FLF+APYA SIS  A++     S  A+A
Sbjct  112  GLGMPIVAKSDLSTGNLIHASYLLRS--GDLSFLFSAPYAPSISAGAASTAAIPSFDAAA  169

Query  360  HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVL  539
              SF A HG GVRA+AL V D +AAF ASV+ GA+PVS P  L+ +   AEV LYGDVVL
Sbjct  170  CLSFAAKHGFGVRAIALEVADAEAAFRASVAHGAEPVSPPALLDGRTGFAEVRLYGDVVL  229

Query  540  RFISY-----LSDPSAVTTFLQGFE  599
            R++SY      S+ +    FL GFE
Sbjct  230  RYVSYKDASHASEANPSRWFLPGFE  254



>ref|XP_010053910.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89763.1| hypothetical protein EUGRSUZ_A02023 [Eucalyptus grandis]
Length=447

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 136/201 (68%), Gaps = 14/201 (7%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF +FV  NP+SD F  + FHHVEFWC DAT+ +RRFSWALGMP+ AKSDLSTGN+
Sbjct  15   FKLVGFSNFVGSNPRSDRFPARHFHHVEFWCTDATSASRRFSWALGMPVVAKSDLSTGNA  74

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNAT------HGLGVR  398
             HASYL R+  G+L  LFTAPY+ SI+        S ++    S++A       HGLGVR
Sbjct  75   THASYLCRS--GDLCLLFTAPYSPSIATSDGLEPSSMASLPSFSYSACVAFATKHGLGVR  132

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS------  560
            A+A+ VED   AF  S++ GA+PVS PV L+    +AEVHLYGDVVLR++SY +      
Sbjct  133  AIAVEVEDAAGAFHISITHGARPVSPPVVLDGAATIAEVHLYGDVVLRYVSYKTPASNRN  192

Query  561  DPSAVTTFLQGFEPMDGTASY  623
            + S  + FL  F+P+D  +S+
Sbjct  193  NSSPDSWFLPRFKPLDEVSSF  213



>gb|ABO69440.1| hydroxyphenylpyruvate dioxygenase [Salvia miltiorrhiza]
Length=481

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 152/203 (75%), Gaps = 6/203 (3%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFV-RVNPKSDHFSVKRFHHVEFWCGDATNTARRF  179
            G+E++++        + GFK    K+ V R NPKSDHF V RFHHVEFWCGDATN ARRF
Sbjct  45   GQESAATTAVEPAVVHRGFKPAARKNLVVRTNPKSDHFPVHRFHHVEFWCGDATNAARRF  104

Query  180  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  359
            SW LGMP+AAKSDLSTGNSAHASYLLR+  GEL FLFTAPY+ SI++P+SA+IP+FS SA
Sbjct  105  SWGLGMPLAAKSDLSTGNSAHASYLLRS--GELSFLFTAPYSPSIADPSSASIPTFSPSA  162

Query  360  HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-QVVLAEVHLYGDVV  536
            H +F ++HGL VRAVA+ V+   +A++ASV+RGA PVS P  L++ +  +AEVHLYGD V
Sbjct  163  HLAFTSSHGLAVRAVAIQVDSASSAYAASVARGAIPVSPPALLSDGKTAIAEVHLYGDSV  222

Query  537  LRFISYLSDPSAVTTFLQGFEPM  605
            LR+IS      A    L GFEP+
Sbjct  223  LRYISTAG--GANEWLLPGFEPV  243



>ref|XP_007215393.1| hypothetical protein PRUPE_ppa005851mg [Prunus persica]
 gb|EMJ16592.1| hypothetical protein PRUPE_ppa005851mg [Prunus persica]
Length=440

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 140/214 (65%), Gaps = 26/214 (12%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            G+E  S +N           LVGF +FVR NP+SD F V RFHHVEFWC DATN+A RFS
Sbjct  2    GQENDSQLN-----------LVGFSNFVRSNPRSDRFKVHRFHHVEFWCTDATNSALRFS  50

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa---  353
            W LGMP+ AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ +++       P+ S    
Sbjct  51   WGLGMPMVAKSDLSTGNQTHASYLLRS--GDLNFLFTAPYSPTLTRTDDPTRPNNSTASI  108

Query  354  -----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVH  518
                 SA R F++ HGLGVRAVA+ V+D  +AF+ SV+ GAKP + P+ L N+V +AEV 
Sbjct  109  PTFDHSASRDFSSRHGLGVRAVAIQVDDAVSAFTTSVAHGAKPSAPPILLGNRVTVAEVQ  168

Query  519  LYGDVVLRFISYLSDPSAVTT-----FLQGFEPM  605
            LYGDVVLR++SY +      +     FL GFE M
Sbjct  169  LYGDVVLRYVSYSNSSDVSDSNPDLWFLPGFEAM  202



>ref|XP_008229571.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Prunus mume]
Length=506

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 138/211 (65%), Gaps = 23/211 (11%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKE  S +N           LVGF +FVR NP+SD F V RFHHVEFWC DATN+A RFS
Sbjct  71   GKENDSQLN-----------LVGFSNFVRSNPRSDRFKVHRFHHVEFWCTDATNSALRFS  119

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa---  353
            W LGMP+ AKSDLSTGN +HASYLLR+  G+L FLFTAP A    +P     P  S    
Sbjct  120  WGLGMPMVAKSDLSTGNQSHASYLLRS--GDLNFLFTAPSAPXTDDPTRPNTPPASIPTF  177

Query  354  --saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYG  527
              SA R F++ HGLGVRAV + V++  +AF+ SV+ GAKP + P+ L+N+V +AEV LYG
Sbjct  178  DHSASRDFSSRHGLGVRAVGIQVDNAVSAFTTSVAHGAKPSAPPILLDNRVTIAEVQLYG  237

Query  528  DVVLRFISYLSDPSAVTT-----FLQGFEPM  605
            DVVLR++SY +      +     FL GFE M
Sbjct  238  DVVLRYVSYSNSSDVSDSNPDLWFLPGFEAM  268



>ref|XP_010688906.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Beta vulgaris 
subsp. vulgaris]
Length=408

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 131/174 (75%), Gaps = 3/174 (2%)
 Frame = +3

Query  105  DHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQF  284
            DHF VKRFHHVEFWCGDATN +RRFSW LG+PI AKSDLSTGNS HASYLLR+    L F
Sbjct  2    DHFPVKRFHHVEFWCGDATNVSRRFSWGLGIPIVAKSDLSTGNSVHASYLLRSYN--LCF  59

Query  285  LFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAK  464
            LFT+PY+ SIS+P+S+ IP+F+ S   SF  +HGLGVRA+A+ VED +AA++ S++ GA 
Sbjct  60   LFTSPYSPSISSPSSSTIPTFNTSHFTSFFTSHGLGVRAIAIEVEDAEAAYNISIAHGAI  119

Query  465  PVSEPVTLNNQVVLAEVHLYGDVVLRFISY-LSDPSAVTTFLQGFEPMDGTASY  623
            P S P    N  +LAEVHLYGDVVLR+IS+   +  A   FL GFE M G +S+
Sbjct  120  PSSAPSRFRNGTILAEVHLYGDVVLRYISFTYKNKPASEWFLPGFEEMPGESSF  173



>ref|XP_007048965.1| Phytoene desaturation 1 [Theobroma cacao]
 gb|EOX93122.1| Phytoene desaturation 1 [Theobroma cacao]
Length=408

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 136/205 (66%), Gaps = 14/205 (7%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  224
            ++ GFKL+GF  FVR  P SD F VK FHHVEFWC DATN A RF   LG  + AKSDLS
Sbjct  6    QSSGFKLLGFSKFVRTTPMSDLFKVKGFHHVEFWCTDATNVACRFLLGLGTQMVAKSDLS  65

Query  225  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saHRSFNATHG  386
            TGN  HASYL+  S G L FLFTAPY+ SI+   + +  + ++      +A R+F+++HG
Sbjct  66   TGNMIHASYLI--SSGHLNFLFTAPYSPSIAQAENLSPTATASIPTFDHAACRAFSSSHG  123

Query  387  LGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS--  560
            L VRA+A+ V+D + AFS SV+ GAKP S P  L+N+VVLAEVHLYGDV+LRFISY +  
Sbjct  124  LTVRAIAIEVQDAEIAFSTSVAHGAKPSSPPNFLDNRVVLAEVHLYGDVILRFISYKNCD  183

Query  561  ----DPSAVTTFLQGFEPMDGTASY  623
                D      FL GFE M    SY
Sbjct  184  DCSHDDGPGCWFLPGFEKMGEGFSY  208



>ref|XP_002453359.1| hypothetical protein SORBIDRAFT_04g004560 [Sorghum bicolor]
 gb|EES06335.1| hypothetical protein SORBIDRAFT_04g004560 [Sorghum bicolor]
Length=440

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 122/180 (68%), Gaps = 5/180 (3%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            F+LVG ++FVRVNP+SD F    FHHVE WC DA + A RFS+ LG P+AA+SDLSTGN+
Sbjct  25   FRLVGHRNFVRVNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNT  84

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
            AHAS LLR+  G L FLFTAPYA       ++     +A A R F A HGL VRAVAL V
Sbjct  85   AHASLLLRS--GALAFLFTAPYAHGADAATASLPSFSAAEARR-FAADHGLAVRAVALRV  141

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
             D + AF ASV+ GA+P  EPV L     LAEV LYGDVVLR++SY  D  A  +FL GF
Sbjct  142  ADAEDAFRASVAAGARPAFEPVELGLGFRLAEVELYGDVVLRYVSYPDDADA--SFLPGF  199



>ref|XP_004951787.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Setaria 
italica]
Length=441

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 123/185 (66%), Gaps = 5/185 (3%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  224
            +   F+LVG + FVRVNP+SD F    FHHVE WC DAT+ A RFS+ LG P+AA+SDLS
Sbjct  22   DQAAFRLVGHRGFVRVNPRSDRFHTLSFHHVELWCADATSAAGRFSFGLGAPLAARSDLS  81

Query  225  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAV  404
            TGNSAHAS LLR+  G L FLFTAPYA  +    ++     + +A RSF A HGL VRA+
Sbjct  82   TGNSAHASLLLRS--GSLAFLFTAPYAHGVDAATASLPSFSAPAA-RSFAADHGLAVRAI  138

Query  405  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTF  584
             L V D + AF ASV+ GA+P  +PV L     LAEV LYGDVVLR++SY     A   F
Sbjct  139  GLRVADAEDAFRASVAAGARPAFKPVELGLGFRLAEVELYGDVVLRYVSYPDAEDA--PF  196

Query  585  LQGFE  599
            L GFE
Sbjct  197  LPGFE  201



>dbj|BAD26248.1| putative 4-hydroxyphenylpyruvate dioxygenase [Oryza sativa Japonica 
Group]
 dbj|BAD25710.1| putative 4-hydroxyphenylpyruvate dioxygenase [Oryza sativa Japonica 
Group]
Length=446

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 123/189 (65%), Gaps = 8/189 (4%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  224
            EN GF+LVG + FVR NP+SD F    FHHVE WC DA + A RF++ALG P+AA+SDLS
Sbjct  22   ENAGFRLVGHRRFVRANPRSDRFQALAFHHVELWCADAASAAGRFAFALGAPLAARSDLS  81

Query  225  TGNSAHASYLLRASGGELQFLFTapy----assisnpasaaipsfsasaHRSFNATHGLG  392
            TGNSAHAS LLR++   + FLFTAPY            +A+IPSFS  A R F A HGL 
Sbjct  82   TGNSAHASLLLRSA--SVAFLFTAPYGGDHGVGADAATTASIPSFSPGAARRFAADHGLA  139

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSA  572
            V AVAL V D   AF ASV+ GA+P  +P  L     LAEV LYGDVVLRF+S+     A
Sbjct  140  VHAVALRVADAADAFRASVAAGARPAFQPADLGGGFGLAEVELYGDVVLRFVSHPD--GA  197

Query  573  VTTFLQGFE  599
               FL GFE
Sbjct  198  DAPFLPGFE  206



>emb|CAR47957.1| p-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=432

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 127/195 (65%), Gaps = 12/195 (6%)
 Frame = +3

Query  51   GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTG  230
            GG KLVG+K+FVR NP SD F+V +FHH++FWCGDATNT++RFS+ LGMP+ AKSD ST 
Sbjct  13   GGIKLVGYKNFVRQNPLSDKFTVHKFHHIDFWCGDATNTSKRFSYGLGMPLVAKSDQSTN  72

Query  231  NSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVA  407
            N   ASY+LR++  +L F FTAPY+   ++ +           H   F  +HGL VRAV 
Sbjct  73   NQLFASYVLRSN--DLVFTFTAPYSRKCASVSEGVPLRHYNIDHAYEFINSHGLAVRAVG  130

Query  408  LVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFISYLSDPSA  572
            L+V+D + A+  SV+ GAK V  PV L ++      V++EV LYG+VVLR++S     S 
Sbjct  131  LLVDDAKTAYEVSVAHGAKGVLPPVELRDEASGTSQVISEVLLYGEVVLRYVS----GSF  186

Query  573  VTTFLQGFEPMDGTA  617
               FL G+ P+  +A
Sbjct  187  QGPFLAGYTPVTDSA  201



>ref|XP_001694723.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
 emb|CAD24031.1| p-hydroxyphenylpyruvate dioxigenase [Chlamydomonas reinhardtii]
 gb|EDP02307.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=432

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 127/195 (65%), Gaps = 12/195 (6%)
 Frame = +3

Query  51   GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTG  230
            GG KLVG+K+FVR NP SD F+V +FHH++FWCGDATNT++RFS+ LGMP+ AKSD ST 
Sbjct  13   GGIKLVGYKNFVRQNPLSDKFTVHKFHHIDFWCGDATNTSKRFSYGLGMPLVAKSDQSTN  72

Query  231  NSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVA  407
            N   ASY+LR++  +L F FTAPY+   ++ +           H   F  +HGL VRAV 
Sbjct  73   NQLFASYVLRSN--DLVFTFTAPYSRKCASVSEGVPLRHYNIDHAYEFINSHGLAVRAVG  130

Query  408  LVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFISYLSDPSA  572
            L+V+D + A+  SV+ GAK V  PV L ++      V++EV LYG+VVLR++S     S 
Sbjct  131  LLVDDAKTAYEVSVAHGAKGVLPPVELRDEASGTSQVISEVLLYGEVVLRYVS----GSF  186

Query  573  VTTFLQGFEPMDGTA  617
               FL G+ P+  +A
Sbjct  187  QGPFLAGYTPVTDSA  201



>ref|XP_003570001.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brachypodium 
distachyon]
Length=436

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 121/176 (69%), Gaps = 4/176 (2%)
 Frame = +3

Query  75   KDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYL  254
            +   RVNP+SD FS   FHHVE WC DA + A RFS+ALG P AA+SDLSTGNSAHAS L
Sbjct  24   RRVARVNPRSDRFSALSFHHVELWCADAASAAGRFSFALGAPPAARSDLSTGNSAHASIL  83

Query  255  LRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATH-GLGVRAVALVVEDTQA  431
            LR+  G L FLFTAPYA S ++ ++A+IPSFSASA R F A H GL VRAVAL V     
Sbjct  84   LRS--GSLAFLFTAPYAPSPASDSAASIPSFSASAARQFTADHGGLAVRAVALRVSSASD  141

Query  432  AFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            AF ASVS GA+P   P  L     LAEV LYGDVVLRFIS+  D +    FL GFE
Sbjct  142  AFHASVSAGARPSFPPADLGQGFALAEVELYGDVVLRFISH-PDENTEIPFLPGFE  196



>ref|XP_001756086.1| predicted protein [Physcomitrella patens]
 gb|EDQ78952.1| predicted protein [Physcomitrella patens]
Length=433

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = +3

Query  51   GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTG  230
            G   LVG + FVR NPK+D F V+RFHHVEFWCGDA+NT RRFSW LGM + AKSD +TG
Sbjct  14   GPLHLVGCERFVRNNPKTDRFGVERFHHVEFWCGDASNTWRRFSWGLGMHLVAKSDQTTG  73

Query  231  NSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVA  407
            N  + SY ++++  EL F FTAPY+S+I    +        S   RSF  +HGL VRAV 
Sbjct  74   NQTYCSYAIQSN--ELVFAFTAPYSSTIDQTNTKMPHPGYKSDEARSFTDSHGLAVRAVG  131

Query  408  LVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFIS  551
            ++V+D   AF  SV  GA  V EP  L++     ++V+AEV LYGDVVLR++S
Sbjct  132  ILVDDADEAFRISVEHGAVSVLEPHVLSDDAKGGKMVMAEVKLYGDVVLRYVS  184



>ref|XP_001757940.1| predicted protein [Physcomitrella patens]
 gb|EDQ77182.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 113/173 (65%), Gaps = 8/173 (5%)
 Frame = +3

Query  51   GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTG  230
            G  +LVG   FVR NPK+DHF V+RFHH+EFWCGDA+NT RRFSW LGM + AKSD +TG
Sbjct  14   GALRLVGCDRFVRNNPKTDHFGVQRFHHIEFWCGDASNTWRRFSWGLGMHLVAKSDQTTG  73

Query  231  NSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVA  407
            N  + SY ++++  EL F FTAPY+S I    +        S   RSF   HGL VRAV 
Sbjct  74   NQTYCSYAIQSN--ELVFAFTAPYSSKIDQTNTKMPHPGYKSKEARSFVDAHGLAVRAVG  131

Query  408  LVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFIS  551
            ++V+D   A+  SV  GA  V EP  L++     ++ +AEV LYGDVVLR++S
Sbjct  132  ILVDDAAEAYRTSVEHGALSVLEPHVLSDDAKGGKMSMAEVKLYGDVVLRYVS  184



>gb|AAZ67144.1| 4-hydroxyphenylpyruvate dioxygenase [Triticum aestivum]
Length=436

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 112/175 (64%), Gaps = 5/175 (3%)
 Frame = +3

Query  75   KDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYL  254
            +  VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNS HAS L
Sbjct  27   RRMVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSVHASQL  86

Query  255  LRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAA  434
            LR+  G L FLFTAPYA+      ++     + +A R F+A HGL VR++AL V D   A
Sbjct  87   LRS--GNLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGLAVRSIALRVADAAEA  143

Query  435  FSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            F ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D      FL GFE
Sbjct  144  FRASVDGGARPAFSPVDLGRGFGFAEVELYGDVVLRFVSHPDDTD--VPFLPGFE  196



>sp|O48604.1|HPPD_HORVU RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Hordeum vulgare]
 emb|CAA04245.1| 4-hydroxyphenylpyruvate dioxygenase [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +3

Query  81   FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  260
             VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNSAHAS LLR
Sbjct  27   MVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLR  86

Query  261  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  440
            +  G L FLFTAPYA+      ++     + +A R F+A HG+ VR+VAL V D   AF 
Sbjct  87   S--GSLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGIAVRSVALRVADAAEAFR  143

Query  441  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            AS  RGA+P   PV L      AEV LYGDVVLRF+S+  D + V  FL GFE
Sbjct  144  ASRRRGARPAFAPVDLGRGFAFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE  194



>dbj|BAJ86732.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86970.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91713.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +3

Query  81   FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  260
             VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNSAHAS LLR
Sbjct  27   MVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLR  86

Query  261  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  440
            +  G L FLFTAPYA+      ++     + +A R F+A HG+ VR+VAL V D   AF 
Sbjct  87   S--GSLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGIAVRSVALRVADAAEAFR  143

Query  441  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D + V  FL GFE
Sbjct  144  ASVDGGARPAFAPVDLGRGFGFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE  194



>emb|CAJ29893.1| 4-hydroxyphenylpyruvate dioxygenase [Triticum aestivum]
Length=381

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 114/175 (65%), Gaps = 5/175 (3%)
 Frame = +3

Query  75   KDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYL  254
            +  VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNS HAS L
Sbjct  27   RRMVRFNPRSDRFHTLAFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSVHASQL  86

Query  255  LRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAA  434
            LR+  G L FLFTAPYA+      ++     + +A R F+A HGL VR++AL V D   A
Sbjct  87   LRS--GNLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGLAVRSIALRVADAAEA  143

Query  435  FSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            F ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D + V  FL GFE
Sbjct  144  FRASVDGGARPAFSPVDLGRGFGFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE  196



>ref|XP_002952694.1| 4-hydroxyphenylpyruvate dioxygenase [Volvox carteri f. nagariensis]
 gb|EFJ46247.1| 4-hydroxyphenylpyruvate dioxygenase [Volvox carteri f. nagariensis]
Length=433

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = +3

Query  36   STP--ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAA  209
            STP    GG KLVG+ +FVR NP+SD F+V++FHH+EFWC DATNT +RF   LGM + A
Sbjct  7    STPGGREGGVKLVGYHNFVRHNPRSDKFAVQKFHHIEFWCADATNTFKRFQHGLGMTLVA  66

Query  210  KSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHG  386
            KSD ST N+ +ASY+LR++  +L F FTAPY+   +  +               F   HG
Sbjct  67   KSDQSTNNTLYASYVLRSN--DLVFTFTAPYSRKCAAVSEGTPLRHYRVDEAYDFVNCHG  124

Query  387  LGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFIS  551
            LGV+AV L+VED +AA+  SV+ G K V  P  L ++       +AEV LYGDVVLR++S
Sbjct  125  LGVKAVGLLVEDARAAYEVSVADGGKGVLAPQELTDEATGTTQTVAEVLLYGDVVLRYVS  184

Query  552  YLSDPSAVTTFLQGFEPM  605
                 S    FL G+ P+
Sbjct  185  ----GSFTGPFLAGYTPL  198



>dbj|BAK02084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=459

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +3

Query  81   FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  260
             VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNSAHAS LLR
Sbjct  52   MVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLR  111

Query  261  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  440
            +  G L FLFTAPYA+      ++     + +A R F+A HG+ VR+VAL V D   AF 
Sbjct  112  S--GSLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGIAVRSVALRVADAAEAFR  168

Query  441  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D + V  FL GFE
Sbjct  169  ASVDGGARPAFAPVDLGRGFGFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE  219



>ref|XP_009419542.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 122/200 (61%), Gaps = 18/200 (9%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGF  FVR NP+SD F V  FHHVEFW  DATN+A RFS+ LGMP+AA+SDLSTGN 
Sbjct  38   FKLVGFTRFVRANPRSDRFPVLGFHHVEFWAADATNSAGRFSFGLGMPLAARSDLSTGNP  97

Query  237  AHASYLLRASGGELQFLFTa------pyassisnpasaaipsfsasaHRSFNATHGLGVR  398
              ASYLLR++   L+FLF+A         ++ +   ++ IPSF A   R F+  HGL VR
Sbjct  98   FFASYLLRSAS--LRFLFSAPYGGPAAADAAANPANTSPIPSFDADRARRFSVDHGLAVR  155

Query  399  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPS---  569
            A+A+ V D   AF  SV+ GA+P   P  L     LAEV LYGDVVLR++S    P    
Sbjct  156  AIAVEVADAAEAFRISVAHGARPSFPPADLGEGFALAEVELYGDVVLRYVSRPKPPPFPS  215

Query  570  -------AVTTFLQGFEPMD  608
                    V  FL GFE +D
Sbjct  216  EARQTPIKVPAFLPGFEDID  235



>ref|XP_008620054.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia diclina VS20]
 gb|EQC26475.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia diclina VS20]
Length=444

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 118/208 (57%), Gaps = 12/208 (6%)
 Frame = +3

Query  6    KETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSW  185
            K  +S      +P     KLVG+ +FVR NPKSD F  ++FHH+EF+C DATN ++RF W
Sbjct  18   KRAASPKKPAESPSKKKMKLVGYNNFVRHNPKSDKFDARKFHHIEFYCQDATNVSKRFGW  77

Query  186  ALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-  362
              G+   AKSD STGN ++ASY+++   GELQ + TAPY+ +                H 
Sbjct  78   GAGLKCVAKSDQSTGNHSYASYVMQT--GELQLVITAPYSRANKKADQVPPHPGYDINHA  135

Query  363  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYG  527
              FN  HGL VRA+A+ V D + A+  SV  GA  V EP TL +      +V+AEV  YG
Sbjct  136  HEFNNKHGLAVRAMAVTVGDAKNAYEVSVKNGAVGVCEPKTLKDAKTGTSLVIAEVKFYG  195

Query  528  DVVLRFISYLSDPSAVTTFLQGFEPMDG  611
            DVVLR++S          F  G+E ++G
Sbjct  196  DVVLRYVS----GDYKGRFFPGYEDVEG  219



>dbj|BAJ95714.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 113/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  81   FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  260
             VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGN AHAS LLR
Sbjct  27   MVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNFAHASQLLR  86

Query  261  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  440
            +  G L FLFTAPYA+      ++     + +A R F+A HG+ VR+VAL V D   AF 
Sbjct  87   S--GSLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGIAVRSVALRVADAAEAFR  143

Query  441  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D + V  FL GFE
Sbjct  144  ASVDGGARPAFAPVDLGRGFGFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE  194



>ref|XP_003617383.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=410

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 5/152 (3%)
 Frame = +3

Query  93   NPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGG  272
            NPKSD F  KRFHHVEFWC DATNTARRFS  LGMPI AKSDLSTG   HASYLLR+  G
Sbjct  81   NPKSDLFKFKRFHHVEFWCTDATNTARRFSHGLGMPIVAKSDLSTGILTHASYLLRS--G  138

Query  273  ELQFLFTapyassisnpasaaipsf---sasaHRSFNATHGLGVRAVALVVEDTQAAFSA  443
            +L  LF+A Y+ SIS  + +   S    SA A  +F+A+HGL VRAVA+ V++ + AF+ 
Sbjct  139  DLNLLFSAAYSPSISLSSPSPTASIPSFSAPACFAFSASHGLSVRAVAVEVDNAELAFTT  198

Query  444  SVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVL  539
            SV+ GA P S  V LNN+V L+EV L+GDVVL
Sbjct  199  SVNHGAVPSSPAVVLNNRVKLSEVRLFGDVVL  230



>pdb|1SP8|A Chain A, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|B Chain B, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|C Chain C, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|D Chain D, 4-hydroxyphenylpyruvate Dioxygenase
Length=418

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 124/188 (66%), Gaps = 4/188 (2%)
 Frame = +3

Query  36   STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  215
            S  E   F+LVG ++FVR NP+SD F    FHHVE WC DA + A RFS+ LG P+AA+S
Sbjct  2    SAAEQAAFRLVGHRNFVRFNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARS  61

Query  216  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGV  395
            DLSTGNSAHAS LLR+      F       +  ++ A+AA+PSFSA+A R F A HGL V
Sbjct  62   DLSTGNSAHASLLLRSGSLSFLF---TAPYAHGADAATAALPSFSAAAARRFAADHGLAV  118

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAV  575
            RAVAL V D + AF ASV+ GA+P   PV L     LAEV LYGDVVLR++SY  D +A 
Sbjct  119  RAVALRVADAEDAFRASVAAGARPAFGPVDLGRGFRLAEVELYGDVVLRYVSY-PDGAAG  177

Query  576  TTFLQGFE  599
              FL GFE
Sbjct  178  EPFLPGFE  185



>ref|XP_008863477.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
 gb|ETW07384.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
Length=445

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 12/191 (6%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVGFK+FVR NPK+D F + +FHHVEF+C DATN ++RF WA G+ + AKSD STGN 
Sbjct  36   MKLVGFKNFVRHNPKTDRFPMHKFHHVEFYCQDATNVSKRFGWAAGLNLVAKSDQSTGNH  95

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVALV  413
            A+ASY++++  GELQ + TAPY+       S A   +        F A HGL VRA+ + 
Sbjct  96   AYASYVMQS--GELQLVITAPYSRQQQKAESTAPLPYFDVPFAHEFCAKHGLAVRAMGVS  153

Query  414  VEDTQAAFSASVSRGAKPVSEP-----VTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            VED +AA+  SV+ GA+ V+ P      T     V++EV LYG+VVLR++S     +   
Sbjct  154  VEDAKAAYEISVAHGAEGVNPPREIKDATTGQVTVVSEVKLYGEVVLRYVS----GNFTG  209

Query  579  TFLQGFEPMDG  611
             +L G+E +DG
Sbjct  210  RYLPGYENVDG  220



>ref|XP_005650422.1| p-hydroxyphenylpyruvate dioxigenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25878.1| p-hydroxyphenylpyruvate dioxigenase [Coccomyxa subellipsoidea 
C-169]
Length=426

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 112/172 (65%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG   F RVNP SD F V +FHH+++WC DAT+T RRF W LGM + AKSDLSTGNS
Sbjct  8    LKLVGHGQFKRVNPNSDLFKVIKFHHIDWWCSDATSTQRRFGWGLGMQLVAKSDLSTGNS  67

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFN--ATHGLGVRAVAL  410
              ASY L+++  +L F FTAPY++ +     +  P     A  + N  A HGLGVR+V +
Sbjct  68   TFASYALKSN--DLVFSFTAPYSTKVEKSKESKSPIPWYKADMALNFIAAHGLGVRSVGV  125

Query  411  VVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFIS  551
            +VED   A   + + GA  V EPVTL ++      V++EV+LYGDVVLRF+S
Sbjct  126  LVEDAAEAHQKATAHGAVSVVEPVTLRDEASGTEQVVSEVNLYGDVVLRFVS  177



>ref|XP_009825673.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV83981.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=422

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = +3

Query  36   STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  215
            + P     +LVGFK+FVR NPKSD F++ +FHHVEF+C DATN ++RF W  G+ + AKS
Sbjct  6    AAPSTTKMQLVGFKNFVRHNPKSDRFTMHKFHHVEFYCQDATNVSKRFGWGAGLNLVAKS  65

Query  216  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLG  392
            D STGN A+ASY++++  G+LQ + TAPY+       S A            F A HGL 
Sbjct  66   DQSTGNHAYASYVMQS--GDLQLVITAPYSRQNQKTTSTAPLPHFDVPFAHEFCAKHGLA  123

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN----QV-VLAEVHLYGDVVLRFISYL  557
            VRA+ + VED +AA+  SV+ G + V+ P  L +    QV V++EV LYG+VVLRF+S  
Sbjct  124  VRAMGISVEDAKAAYDISVANGGEGVTPPQELTDAATGQVSVVSEVKLYGEVVLRFVS--  181

Query  558  SDPSAVTTFLQGFEPMDG  611
               +    FL G+E ++G
Sbjct  182  --GNFAGRFLPGYENVEG  197



>ref|XP_002974762.1| hypothetical protein SELMODRAFT_174278 [Selaginella moellendorffii]
 gb|EFJ24282.1| hypothetical protein SELMODRAFT_174278 [Selaginella moellendorffii]
Length=495

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 106/184 (58%), Gaps = 9/184 (5%)
 Frame = +3

Query  63   LVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAH  242
            LVGF  FVR NP +D F V  FHHVE WCGDATNT RRFSW LGMP+ AKSD +TGN  +
Sbjct  84   LVGFDKFVRSNPLTDRFKVLCFHHVELWCGDATNTWRRFSWGLGMPLVAKSDQTTGNHVY  143

Query  243  ASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVED  422
             SY L++    L F             +    P+ +  A   F   HGL VRAV + VED
Sbjct  144  CSYALQSEDLVLVFSAPYSDKHRYQPASPPPHPAMTKPAMLDFFDAHGLAVRAVGVRVED  203

Query  423  TQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDPSAVTTFL  587
               AF  SV  GA  V EP T+++     ++VL+EV LYGDVVLRF+S   D      FL
Sbjct  204  AATAFRTSVEHGAIAVLEPTTMHDVHSGQELVLSEVALYGDVVLRFVSGGFD----GPFL  259

Query  588  QGFE  599
             G+E
Sbjct  260  PGYE  263



>ref|XP_002963674.1| hypothetical protein SELMODRAFT_165961 [Selaginella moellendorffii]
 gb|EFJ35545.1| hypothetical protein SELMODRAFT_165961 [Selaginella moellendorffii]
Length=495

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 106/184 (58%), Gaps = 9/184 (5%)
 Frame = +3

Query  63   LVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAH  242
            LVGF  FVR NP +D F V  FHHVE WCGDATNT RRFSW LGMP+ AKSD +TGN  +
Sbjct  84   LVGFDKFVRSNPLTDRFKVLCFHHVELWCGDATNTWRRFSWGLGMPLVAKSDQTTGNHVY  143

Query  243  ASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVED  422
             SY L++    L F             +    P+ +  A   F   HGL VRAV + VED
Sbjct  144  CSYALQSEELVLVFSAPYSDKHRYQPASPPPHPAMTKPAMLDFFDAHGLAVRAVGVRVED  203

Query  423  TQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDPSAVTTFL  587
               AF  SV  GA  V EP T+++     ++VL+EV LYGDVVLRF+S   D      FL
Sbjct  204  AATAFRTSVEHGAIAVLEPTTMHDVHSGQELVLSEVALYGDVVLRFVSGGFD----GPFL  259

Query  588  QGFE  599
             G+E
Sbjct  260  PGYE  263



>gb|AFW70252.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Zea mays]
Length=444

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 122/181 (67%), Gaps = 4/181 (2%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            F+LVG ++FVR NP+SD F    FHHVE WC DA + A RFS+ LG P+AA+SDLSTGNS
Sbjct  25   FRLVGHRNFVRFNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNS  84

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
            AHAS LLR+      F       +  ++ A+AA+PSFSA+A R F A HGL VRAVAL V
Sbjct  85   AHASLLLRSGSLSFLF---TAPYAHGADAATAALPSFSAAAARRFAADHGLAVRAVALRV  141

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
             D + AF ASV+ GA+P   PV L     LAEV LYGDVVLR++SY  D +A   FL GF
Sbjct  142  ADAEDAFRASVAAGARPAFGPVDLGRGFRLAEVELYGDVVLRYVSY-PDGAAGEPFLPGF  200

Query  597  E  599
            E
Sbjct  201  E  201



>ref|XP_008811120.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Phoenix dactylifera]
Length=451

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 124/197 (63%), Gaps = 15/197 (8%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVGFK FVR NP++D F V  FHH+EFW  DATN A RFS+ LGM +AA+SDLSTGN 
Sbjct  18   FKLVGFKRFVRTNPRTDRFPVLGFHHIEFWTADATNAAGRFSFGLGMRLAARSDLSTGNP  77

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa--------HRSFNATHGLG  392
             HAS+LLR+  G LQFLF++PY+      A A      + +         R F A+HGL 
Sbjct  78   FHASFLLRS--GSLQFLFSSPYSPFTPAAAGAPAGDPGSPSIPSFDPDRARRFTASHGLA  135

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS----  560
            VRAVA+ V D  AAF  SV+ GA+    P  L     L+EV LYGDVVLR++S  +    
Sbjct  136  VRAVAVRVADAAAAFYTSVAHGARAALPPADLGAGFALSEVELYGDVVLRYVSLPAPESS  195

Query  561  -DPSAVTTFLQGFEPMD  608
             +PS + +FL GFE ++
Sbjct  196  QNPSKIPSFLPGFEDVE  212



>ref|NP_001105782.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Zea mays]
 emb|CAG25475.1| putative p-hydroxyphenylpyruvate dioxygenase [Zea mays]
Length=444

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 121/181 (67%), Gaps = 4/181 (2%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            F+LVG ++FVR NP+SD F    FHHVE WC DA + A RFS+ LG P+AA+SDLSTGNS
Sbjct  25   FRLVGHRNFVRFNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNS  84

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
            AHAS LLR+      F       +  ++ A+AA+PSFSA+A R F A HGL VRAVAL V
Sbjct  85   AHASLLLRSGSLSFLF---TAPYAHGADAATAALPSFSAAAARRFAADHGLAVRAVALRV  141

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
             D + AF  SV+ GA+P   PV L     LAEV LYGDVVLR++SY  D +A   FL GF
Sbjct  142  ADAEEAFRTSVAAGARPAFGPVDLGRGFRLAEVELYGDVVLRYVSY-PDGAAGEPFLPGF  200

Query  597  E  599
            E
Sbjct  201  E  201



>ref|XP_002461838.1| hypothetical protein SORBIDRAFT_02g008990 [Sorghum bicolor]
 gb|EER98359.1| hypothetical protein SORBIDRAFT_02g008990 [Sorghum bicolor]
Length=480

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 106/171 (62%), Gaps = 7/171 (4%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            +D F V  FHHVEFWC DA + A RFS+ALG+P+AA SDL+TGN+AHAS+LLR+  G L 
Sbjct  75   TDRFHVMDFHHVEFWCADAASAAGRFSFALGVPLAAHSDLTTGNTAHASHLLRSRSGPLA  134

Query  282  FLFTapyassisnpasaaipsfsasaHRS------FNATHGLGVRAVALVVEDTQAAFSA  443
             LFTAPYA+           S S     S      F A HGL VRAVA+ V D   AF A
Sbjct  135  LLFTAPYAAQHGGADDDDTASSSVLPSFSADAARRFAADHGLAVRAVAVCVSDAAEAFRA  194

Query  444  SVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
            SV+ GA+P   P  L +  V AEV LYGDVVLRF+SY  D   V  FL GF
Sbjct  195  SVAAGARPAFAPAELGHGFVFAEVELYGDVVLRFVSYPDDTDDV-AFLPGF  244



>gb|KDO16411.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia parasitica CBS 
223.65]
Length=417

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 117/195 (60%), Gaps = 12/195 (6%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  224
            EN   +LVG+ +FVR NPKSD F + +FHH+EF+C DATN ++RF W  G+   AKSD S
Sbjct  4    ENKKIQLVGYNNFVRHNPKSDRFPMHKFHHIEFYCQDATNVSKRFGWGAGLKCVAKSDQS  63

Query  225  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRA  401
            TGN ++ASY+++   GELQ + TAPY+ +     +          +   FN  HGL VRA
Sbjct  64   TGNHSYASYVMQT--GELQLVITAPYSRANKKADAIPPHQGFDMEYAHEFNNKHGLAVRA  121

Query  402  VALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDP  566
            +A+ V+D   A+  SV  GA  V  P T  +      +V++EV LYGDVVLR++S     
Sbjct  122  MAVSVDDAAQAYDISVKNGAVGVCSPKTTKDAATGETMVISEVKLYGDVVLRYVS----G  177

Query  567  SAVTTFLQGFEPMDG  611
            +    ++ G+E ++G
Sbjct  178  NYKGRYMPGYENVEG  192



>ref|XP_010480368.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=466

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 115/169 (68%), Gaps = 14/169 (8%)
 Frame = +3

Query  135  VEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassi  314
            + ++C   TN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+
Sbjct  76   IPYFC---TNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSL  130

Query  315  snpasaaipsfsa-----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEP  479
            +        + S       + RSF ++HGLGVRAVA+ VED ++AFS SVS GA P S P
Sbjct  131  TAGEIKPTATASIPSFDHVSSRSFFSSHGLGVRAVAIEVEDAESAFSVSVSNGAIPSSPP  190

Query  480  VTLN-NQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            + L+   V +AEV LYGDVVLR++SY  D S    FL GFEP++ T+S+
Sbjct  191  MVLDGGAVTIAEVKLYGDVVLRYVSYKEDKSE---FLPGFEPVEDTSSF  236



>ref|XP_010480369.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=466

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 115/169 (68%), Gaps = 14/169 (8%)
 Frame = +3

Query  135  VEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassi  314
            + ++C   TN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+
Sbjct  76   IPYFC---TNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSL  130

Query  315  snpasaaipsfsa-----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEP  479
            +        + S       + RSF ++HGLGVRAVA+ VED ++AFS SVS GA P S P
Sbjct  131  TAGEIKPTATASIPSFDHVSSRSFFSSHGLGVRAVAIEVEDAESAFSVSVSNGAIPSSPP  190

Query  480  VTLN-NQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            + L+   V +AEV LYGDVVLR++SY  D S    FL GFEP++ T+S+
Sbjct  191  MVLDGGAVTIAEVKLYGDVVLRYVSYKEDKSE---FLPGFEPVEDTSSF  236



>ref|XP_009825674.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV83982.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=420

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 127/205 (62%), Gaps = 17/205 (8%)
 Frame = +3

Query  15   SSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALG  194
            +++ N H T      KLVG+++FVR NPKSD F++ +FHHVEF+  DATN ++RF WA G
Sbjct  2    AATPNDHKT-----MKLVGYENFVRHNPKSDRFAMHKFHHVEFYTQDATNVSKRFGWAAG  56

Query  195  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSF  371
            + + +KSD STGN A+ASY++++  G+LQ + TAPY+       + A      +A+   F
Sbjct  57   LKLVSKSDQSTGNHAYASYVMQS--GDLQIVITAPYSRQQQKADNIAPNQGFDNAYAHEF  114

Query  372  NATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVV  536
             A HGL VRA+A+ V+D   A+  +V  GA  V+ P T  +       VL+EV LYGDVV
Sbjct  115  CAKHGLAVRAMAISVDDATVAYETAVKNGAVGVTSPKTSTDAATGEFQVLSEVKLYGDVV  174

Query  537  LRFISYLSDPSAVTTFLQGFEPMDG  611
            LRFIS     +    FL G++ ++G
Sbjct  175  LRFIS----GNYTGRFLPGYQNVEG  195



>ref|XP_002461829.1| hypothetical protein SORBIDRAFT_02g008850 [Sorghum bicolor]
 gb|EER98350.1| hypothetical protein SORBIDRAFT_02g008850 [Sorghum bicolor]
Length=496

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 107/174 (61%), Gaps = 10/174 (6%)
 Frame = +3

Query  105  DHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQF  284
            D F V  FHHVEFWC DA + A RFS+ALG+P+AA+SDL+TGN+AHAS LLR+  G L  
Sbjct  83   DRFHVMDFHHVEFWCADAASAAGRFSFALGVPLAAQSDLTTGNTAHASRLLRSRSGPLAL  142

Query  285  LFTapyassisnpasaaipsfsasaHRSFNATH---------GLGVRAVALVVEDTQAAF  437
            LFTAPYA  I     A   S S+    SF+A           GL VRAVA+ V D   AF
Sbjct  143  LFTAPYARHIGARPDADATSASSPVVPSFSADAARRFAADYGGLAVRAVAVRVSDAAEAF  202

Query  438  SASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
             ASV+ GA+P   P  L +  V AEV LYGD VLRF+SY  D   V  FL GFE
Sbjct  203  RASVAAGARPAFAPAELGHGFVFAEVELYGDAVLRFVSYPDDTGGV-AFLPGFE  255



>gb|ETL47152.1| hypothetical protein L916_03076, partial [Phytophthora parasitica]
Length=237

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 110/183 (60%), Gaps = 9/183 (5%)
 Frame = +3

Query  24   VNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPI  203
            V  +  P     KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM  
Sbjct  50   VKENMAPSADDMKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQ  109

Query  204  AAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNA  377
              KSD STGN   ASY++++  GE++ +FTAPYA        A  P         + F  
Sbjct  110  IGKSDQSTGNHVSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVM  167

Query  378  THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLR  542
             HGL VRAV ++V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R
Sbjct  168  KHGLAVRAVGILVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIR  227

Query  543  FIS  551
            ++S
Sbjct  228  WVS  230



>ref|XP_008863478.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
 gb|ETW07385.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
Length=420

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 125/205 (61%), Gaps = 17/205 (8%)
 Frame = +3

Query  15   SSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALG  194
            +++ N+H T      KLVG+++FVR NP SD F + +FHHVEF+  DATN ++RF WA G
Sbjct  2    AAASNNHKT-----MKLVGYENFVRHNPMSDRFPMHKFHHVEFYTQDATNVSKRFGWAAG  56

Query  195  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSF  371
            + + AKSD STGN  +ASY++++  GELQ + TAPY+         A      +A    F
Sbjct  57   LKLVAKSDQSTGNHVYASYVMQS--GELQIVITAPYSRQQQKVDHVAPNQGFDNAFAHEF  114

Query  372  NATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN----QV-VLAEVHLYGDVV  536
             A HGL VRA+A+ V+D   A+  SV  GA  ++ P T  +    QV VL+EV LYG+VV
Sbjct  115  CAKHGLAVRAMAITVDDATVAYETSVKNGAVGITSPKTTTDAATGQVQVLSEVKLYGEVV  174

Query  537  LRFISYLSDPSAVTTFLQGFEPMDG  611
            LRFIS     +    F+ G+E +DG
Sbjct  175  LRFIS----GNYTGRFMPGYENVDG  195



>gb|ETM53414.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Phytophthora parasitica]
Length=211

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 107/172 (62%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  410
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  411  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS  551
            +V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R++S
Sbjct  128  LVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIRWVS  179



>gb|ETM00249.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Phytophthora parasitica]
Length=219

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 107/172 (62%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  410
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  411  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS  551
            +V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R++S
Sbjct  128  LVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIRWVS  179



>ref|XP_002968708.1| hypothetical protein SELMODRAFT_91092 [Selaginella moellendorffii]
 gb|EFJ29824.1| hypothetical protein SELMODRAFT_91092 [Selaginella moellendorffii]
Length=475

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 128/211 (61%), Gaps = 19/211 (9%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKL--VGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARR  176
            G ++S+S   H      G+KL  VG   FVR NP SD F V  FHHVEFWCGDA+NT RR
Sbjct  48   GHQSSASCADHQ-----GYKLGLVGHDKFVRSNPMSDRFGVLGFHHVEFWCGDASNTWRR  102

Query  177  FSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaai--psfs  350
            F+W LGM + AKSD STGN  + SY++  S  EL F FTAPY+S  ++   + +  P FS
Sbjct  103  FAWGLGMHLVAKSDHSTGNHTYCSYVI--SSRELVFAFTAPYSSKKADQELSQMPHPGFS  160

Query  351  asaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEV  515
            +S  R F + HGL VRAV L+VED + AF  SV  GA  V +P  L ++      V++EV
Sbjct  161  SSDARRFFSMHGLAVRAVGLLVEDAEEAFRKSVLGGALAVFQPQELADEATGAKAVISEV  220

Query  516  HLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
             L GDVVLR++S      A   FL  + P++
Sbjct  221  KLLGDVVLRYVSLKGFSGA---FLPNYTPVE  248



>ref|XP_002901240.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
 gb|EEY59226.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
Length=418

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 106/177 (60%), Gaps = 9/177 (5%)
 Frame = +3

Query  42   PENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDL  221
            P     KLVG K+FVR NP +D F V +FHH+EF+C DATN +RRF+W LGM    KSD 
Sbjct  3    PSASDMKLVGCKNFVRNNPMTDRFDVHKFHHIEFYCADATNASRRFAWGLGMAQIGKSDQ  62

Query  222  STGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGV  395
            STGN   ASY++++  GE++ +FTAPYA        A            + F   HGL V
Sbjct  63   STGNHVSASYVIQS--GEVKLVFTAPYALETEKAPDAVSSISGYDPEFAQKFVMKHGLAV  120

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS  551
            RAV ++V D +AA+  SV  G   V EP TL ++       ++EV LYGDVV+R++S
Sbjct  121  RAVGILVGDAKAAYELSVQNGGVGVVEPQTLTDKESGKTTTVSEVKLYGDVVIRWVS  177



>ref|XP_008653702.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Zea mays]
 tpg|DAA60243.1| TPA: hypothetical protein ZEAMMB73_261174 [Zea mays]
Length=445

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 114/173 (66%), Gaps = 9/173 (5%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            +D F V  FHHVEFWC DA + A RFS+ALG+P+AA+SDL+TGN+AHAS LLR+  G L 
Sbjct  35   TDRFHVIDFHHVEFWCADAASAAGRFSFALGVPLAAQSDLTTGNTAHASRLLRSRSGPLA  94

Query  282  FLFTa-------pyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  440
            FLFTA           + +  +S+ +PSFSA A R F A +GL VRAVA+ V D   AF 
Sbjct  95   FLFTAPYAAQHGADDDATAASSSSVLPSFSADAARRFAADYGLAVRAVAIRVSDAAEAFR  154

Query  441  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            ASV  GA+P   P  L +  V AEV LYGD VLRF+SY  D + V +FL GFE
Sbjct  155  ASVDAGARPAFAPAELGHGFVFAEVELYGDAVLRFVSY-PDGTDV-SFLPGFE  205



>ref|XP_008900422.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETI53874.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P1569]
 gb|ETN14153.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETP23697.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
CJ01A1]
 gb|ETP51702.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P10297]
Length=471

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 110/183 (60%), Gaps = 9/183 (5%)
 Frame = +3

Query  24   VNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPI  203
            V  +  P     KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM  
Sbjct  50   VKENMAPSADDMKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQ  109

Query  204  AAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNA  377
              KSD STGN   ASY++++  GE++ +FTAPYA        A  P         + F  
Sbjct  110  IGKSDQSTGNHVSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVM  167

Query  378  THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLR  542
             HGL VRAV ++V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R
Sbjct  168  KHGLAVRAVGILVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIR  227

Query  543  FIS  551
            ++S
Sbjct  228  WVS  230



>gb|KDO32258.1| hypothetical protein SPRG_02737 [Saprolegnia parasitica CBS 223.65]
Length=432

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 115/191 (60%), Gaps = 12/191 (6%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG+++FVR NPK+D F + +FHHVEF+C DATN ++RF W  G    AKSD STGN 
Sbjct  1    MKLVGYQNFVRHNPKTDKFPMHKFHHVEFYCQDATNVSKRFGWGAGFKCVAKSDQSTGNH  60

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVALV  413
            ++ASY++++  GELQ + TAPY+     P +              FN  HGL VRA+A+ 
Sbjct  61   SYASYVMQS--GELQLVITAPYSRMNRKPDAIPPHQGFDMDFAHEFNNKHGLAVRAMAVS  118

Query  414  VEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            V+D   A+  SV  GA  V  P T  +      +V++EV LYGDVVLR++S     +   
Sbjct  119  VDDAAQAYDISVKNGAVGVCSPKTTKDATTGQTMVISEVKLYGDVVLRYVS----GNYKG  174

Query  579  TFLQGFEPMDG  611
             ++ G+E ++G
Sbjct  175  RYMPGYENVEG  185



>gb|ETI53876.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P1569]
Length=420

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 107/172 (62%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  410
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  411  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS  551
            +V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R++S
Sbjct  128  LVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIRWVS  179



>ref|XP_003055822.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH61074.1| predicted protein [Micromonas pusilla CCMP1545]
Length=447

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 121/205 (59%), Gaps = 13/205 (6%)
 Frame = +3

Query  18   SSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGM  197
            +S   ++ P     KLVG K+FVR NPKSD F++++FHHVEFWC DAT TA RF+  LGM
Sbjct  2    ASSEANAAPAAKRHKLVGCKNFVRNNPKSDLFTMRKFHHVEFWCRDATTTAARFAVGLGM  61

Query  198  PIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa------  359
             + AKSDL+TGN+ +ASY+L+++  +L+F+F+APY          A  S    +      
Sbjct  62   QLVAKSDLTTGNARYASYVLQSN--DLRFVFSAPYDVPEGEENDDARSSMFEKSGVLSHD  119

Query  360  ---HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGD  530
                R+F   HGL VRAV L+V+D   AF  S   G +  +     +    ++EV LYGD
Sbjct  120  PSFMRTFCERHGLAVRAVCLLVDDAAVAFYTSGQHGGRSPAFSSACDGFARVSEVELYGD  179

Query  531  VVLRFISYLSDP--SAVTTFLQGFE  599
            VVLR+ S+ +    +   TFL G+E
Sbjct  180  VVLRYYSFHAGEKNAKPKTFLPGYE  204



>ref|XP_008900424.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETN14155.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETP23699.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
CJ01A1]
Length=420

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 107/172 (62%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  410
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVVQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  411  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS  551
            +V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R++S
Sbjct  128  LVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIRWVS  179



>ref|XP_008881551.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
 gb|ETV89818.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
Length=287

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 105/185 (57%), Gaps = 23/185 (12%)
 Frame = +3

Query  36   STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  215
            STP N   KLVG+++FVR NPKSD F++ +FHH+EF+  DATN ++RF WA G+ + AKS
Sbjct  70   STP-NKKMKLVGYENFVRHNPKSDRFTMHKFHHMEFYTQDATNVSKRFGWAAGLKVVAKS  128

Query  216  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNA------  377
            D STGN A+ASY+L++  GEL+   T       +  +           H  FN       
Sbjct  129  DQSTGNHAYASYVLQS--GELKIAIT-------APYSRKNQKEGHVPPHPGFNVDFAHEF  179

Query  378  --THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN-----NQVVLAEVHLYGDVV  536
               HGL VRA+A+ V+D   A+  S   GA  V  P T+         VL+ V  YGDVV
Sbjct  180  CNKHGLAVRAMAISVDDAALAYELSTKHGAVGVCPPKTVKCAKSHTTQVLSSVKFYGDVV  239

Query  537  LRFIS  551
            LRF+S
Sbjct  240  LRFVS  244



>ref|XP_005854172.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana 
CCMP526]
 gb|EKU22183.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana 
CCMP526]
Length=464

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 104/186 (56%), Gaps = 24/186 (13%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            +LVG   FVR NPKSD F V  FHHVE +CGDATNT RRF   LGM + AKSDLSTGN  
Sbjct  86   ELVGAAKFVRQNPKSDRFKVLSFHHVEIYCGDATNTYRRFQLGLGMNLVAKSDLSTGNPL  145

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR------SFNAT-------  380
             ASY LR+    LQ +F+APY+ +       +         R       F A+       
Sbjct  146  FASYCLRSQ--RLQMVFSAPYSMNKVAAEEGSSMGKGEIVERRSSPNPGFEASHATQFFN  203

Query  381  -HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL--------NNQVVLAEVHLYGDV  533
             HG+ VRA+ L VED + A+   V+ G + V EPV L        +  +V++EV  YGDV
Sbjct  204  RHGVAVRALGLEVEDARQAYQECVANGGQGVLEPVRLDPSPGLGRDGYLVMSEVQAYGDV  263

Query  534  VLRFIS  551
            VLRF+S
Sbjct  264  VLRFVS  269



>gb|EWM23898.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=525

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 102/186 (55%), Gaps = 24/186 (13%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            +LVG   FVR NPKSD F V  FHHVE +CGDATNT RRF   LGM + AKSDLSTGN  
Sbjct  86   ELVGAAKFVRQNPKSDRFKVLSFHHVEIYCGDATNTYRRFQLGLGMNLVAKSDLSTGNPL  145

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR--------------SFNA  377
             ASY LR+    LQ +F+APY+ +       +         R               F  
Sbjct  146  FASYCLRSQ--RLQMVFSAPYSMNKVAAEEGSSMGKGEIVERRSSPNPGFEASHATQFFN  203

Query  378  THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL--------NNQVVLAEVHLYGDV  533
             HG+ VRA+ L VED + A+   V+ G + V EPV L        +  +V++EV  YGDV
Sbjct  204  RHGVAVRALGLEVEDARQAYQECVANGGQGVLEPVRLDPSPGLGRDGYLVMSEVQAYGDV  263

Query  534  VLRFIS  551
            VLRF+S
Sbjct  264  VLRFVS  269



>ref|XP_009520219.1| hypothetical protein PHYSODRAFT_539872 [Phytophthora sojae]
 gb|EGZ24931.1| hypothetical protein PHYSODRAFT_539872 [Phytophthora sojae]
Length=420

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 111/172 (65%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            FKLVG K+F R NP SD F V++FHH+EF+C DATN + RF+W LGM   AKSD STGN 
Sbjct  10   FKLVGNKNFKRHNPMSDRFDVQKFHHIEFFCLDATNVSSRFTWGLGMRQIAKSDQSTGNH  69

Query  237  AHASYLLRASGGELQFLFTapyassisnp--asaaipsfsasaHRSFNATHGLGVRAVAL  410
              ASY++ +  GE++ +FTAPYA        A + IP + A+  + F   HGL VRA+ +
Sbjct  70   VSASYVVES--GEVKLVFTAPYALETEKAPGAVSPIPGYDAAFAQQFVLKHGLAVRALGI  127

Query  411  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS  551
             V D + A+  SV  GA+ V EP  L ++      V++EV +YGDVV+R++S
Sbjct  128  QVADAKEAYEVSVQNGAEGVLEPQALTDKDSSKATVISEVKIYGDVVIRWVS  179



>ref|XP_011402112.1| 4-hydroxyphenylpyruvate dioxygenase [Auxenochlorella protothecoides]
 gb|KFM29063.1| 4-hydroxyphenylpyruvate dioxygenase [Auxenochlorella protothecoides]
Length=973

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 111/187 (59%), Gaps = 13/187 (7%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            KLVG K F R NP +D F + RFHH EF+CGDATNT+RRF   LG+   AKSD  TGN  
Sbjct  546  KLVGAKGFQRHNPLTDKFPIHRFHHFEFYCGDATNTSRRFGLGLGLSQVAKSDQGTGNQK  605

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsf----sasaHRSFNATHGLGVRAVA  407
             ASY++R++  +L F FTAPY  +    +     S        A  +FN  HGLGVRAV 
Sbjct  606  FASYVMRSN--QLIFTFTAPYNGAGGEASGPDAGSPVPWYDVDAAHTFNRNHGLGVRAVG  663

Query  408  LVVEDTQAAFSASVSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVT  578
            +VVED   AF  S + G  PV  P  L +    + ++E+ LYGDVVLRF+S   D S   
Sbjct  664  IVVEDAAEAFRISTANGGIPVQPPTRLADARGSLTVSEIVLYGDVVLRFLS--GDYSG--  719

Query  579  TFLQGFE  599
            ++L G+E
Sbjct  720  SYLPGYE  726



>ref|XP_001416712.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95005.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=427

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 103/174 (59%), Gaps = 12/174 (7%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            KLVG  +FVR NP SD F  ++F H+EFWCGDATN A RF   LGM +  KSD +TGN  
Sbjct  9    KLVGCANFVRSNPLSDAFECEKFDHIEFWCGDATNAAARFGVGLGMGLRCKSDATTGNGT  68

Query  240  HASYLLRASGGELQFLFTapyassisnpasaai-psfsasaHRSFNATHGLGVRAVALVV  416
            +ASY ++++  +L F+FTAPY          A  P     A   F   HGL  RAV + V
Sbjct  69   YASYAMKSN--DLTFVFTAPYGVESGGSRGEAPHPGHEGRAMMRFFEKHGLAARAVGVRV  126

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQV---------VLAEVHLYGDVVLRFIS  551
            +D +AA+  +V RGA+ V  P  L + V         V+AE+ LYGDVVLRF++
Sbjct  127  KDARAAYEEAVKRGARGVLAPTVLTHTVDDGCAKGGQVIAEIELYGDVVLRFVN  180



>ref|XP_002499380.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60639.1| predicted protein [Micromonas sp. RCC299]
Length=441

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 105/174 (60%), Gaps = 12/174 (7%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            KLVG K+F R NP SD F + RFHHVEFWC DA  TA RF+ ALGM + AKSD++TGNS 
Sbjct  12   KLVGAKNFQRHNPNSDRFPLHRFHHVEFWCHDAITTASRFAVALGMQVVAKSDMTTGNSV  71

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNA--------THGLGV  395
            +ASY+LR++  +L F+F+APY       A       +   H  ++          HGL V
Sbjct  72   YASYVLRSN--DLVFVFSAPYGGGEEQTAEDIDKRRANMPHSCYDGENMTRFITKHGLAV  129

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV--LAEVHLYGDVVLRFIS  551
            +AV +VV+D + A  AS+  GA+  +       +    ++EV LYGDVV+RF+S
Sbjct  130  KAVGVVVDDAEEAHRASLKHGARNAAYDAGDGTKPAEGISEVELYGDVVMRFVS  183



>ref|XP_009825872.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV84180.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=475

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 101/178 (57%), Gaps = 21/178 (12%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG+++FVR NPK+D F++ +FHH+EF+  DATN ++RF WA G+ + AKSD STGN 
Sbjct  65   MKLVGYENFVRHNPKTDRFTMHKFHHIEFYTQDATNVSKRFGWAAGLKLVAKSDQSTGNH  124

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNA--------THGLG  392
            A+ASY+L++  G+L+   T                      H  FN          HGL 
Sbjct  125  AYASYVLQS--GDLKIAIT------APYSRKNQKDGGHVPPHPGFNVDYAHEFCNKHGLA  176

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFIS  551
            VRA+A+ V+D   A+  S   GA  V  P T+ +       V++ V LYGDVVLRF+S
Sbjct  177  VRAMAISVDDAALAYELSTKHGAVGVCPPKTIKDAATHTTQVISSVKLYGDVVLRFVS  234



>ref|XP_003078281.1| p-hydroxyphenylpyruvate dioxigenase (ISS) [Ostreococcus tauri]
 emb|CAL53021.1| Glyoxalase/fosfomycin resistance/dioxygenase domain [Ostreococcus 
tauri]
Length=432

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 100/181 (55%), Gaps = 17/181 (9%)
 Frame = +3

Query  54   GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  233
            G KLVG  +FVR NP SD F    F HVEFWCGDATN A RF   LGM + AKSD STGN
Sbjct  7    GRKLVGHANFVRCNPLSDAFECVGFDHVEFWCGDATNAASRFGVGLGMSLRAKSDASTGN  66

Query  234  SAHASYLLRASGGELQFLFTapyassisnpasaaips------fsasaHRSFNATHGLGV  395
              +ASY +++   +L F+FTAPY                        A   F   HGL  
Sbjct  67   GIYASYAMKSH--DLTFVFTAPYGDDERAVGCGGSSVNVPHPGNERGAMMRFFERHGLAA  124

Query  396  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ---------VVLAEVHLYGDVVLRFI  548
            RAV L V D +AA+  ++ RGA+ V EP  + ++          +++EV LYGDVVLRF+
Sbjct  125  RAVGLRVGDARAAYEEAMKRGARGVLEPTEMRHEKHDGCVMGTQIISEVELYGDVVLRFV  184

Query  549  S  551
            S
Sbjct  185  S  185



>gb|AAN28922.1| 4-hydroxyphenylpyruvate dioxygenase [Abutilon theophrasti]
Length=363

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 109/165 (66%), Gaps = 10/165 (6%)
 Frame = +3

Query  147  CGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpa  326
            C DATN A RFSW LGM   AKSDLSTGN +HASYLLR+    L  LFTAPY+ SI+   
Sbjct  1    CTDATNAACRFSWGLGMQFVAKSDLSTGNLSHASYLLRSD--HLSLLFTAPYSPSIALSQ  58

Query  327  saaipsfsa------saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL  488
            + +  S ++      +  RSF+++HGL VRA+AL VED++ AF+ S+S GA P S P+ L
Sbjct  59   NISPHSTASIPSFDHTLCRSFSSSHGLVVRAIALEVEDSETAFATSISNGALPSSPPILL  118

Query  489  NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            +   + +EV LYGDVVLR++SY S  +    FL GFE ++   SY
Sbjct  119  DGATI-SEVKLYGDVVLRYVSY-SKNTNPHHFLPGFEKVEDNLSY  161



>ref|XP_002990594.1| hypothetical protein SELMODRAFT_161008 [Selaginella moellendorffii]
 gb|EFJ08226.1| hypothetical protein SELMODRAFT_161008 [Selaginella moellendorffii]
Length=399

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 110/176 (63%), Gaps = 12/176 (7%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            SD F V  FHHVEFWCGDA+NT RRF+W LGM + AKSD STGN  + SY++  S  EL 
Sbjct  2    SDRFGVLGFHHVEFWCGDASNTWRRFAWGLGMHLVAKSDHSTGNHTYCSYVI--SSRELV  59

Query  282  FLFTapyassisnpasaai--psfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSR  455
            F FTAPY+S  ++   + +  P FS+S  R F + HGL VRAV L+VED + AF  SV  
Sbjct  60   FAFTAPYSSKKADQELSQMPHPGFSSSDARRFFSMHGLAVRAVGLLVEDAEEAFRKSVLG  119

Query  456  GAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
            GA  V +P  L ++      V+AEV L GDVVLR+IS      A   FL  + P++
Sbjct  120  GALAVFQPQELTDEATGTKAVIAEVKLLGDVVLRYISLKGFSGA---FLPNYTPVE  172



>ref|XP_004368015.1| 4hydroxyphenylpyruvate dioxygenase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR25260.1| 4hydroxyphenylpyruvate dioxygenase [Acanthamoeba castellanii 
str. Neff]
Length=420

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 103/172 (60%), Gaps = 8/172 (5%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            KLVG+ +F R NP +D F+VK+FHH+EF+ GDA N +RR++  LGM + AKSD STGN  
Sbjct  5    KLVGYANFKRNNPMTDKFAVKKFHHIEFYSGDALNVSRRWALGLGMALVAKSDQSTGNGT  64

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVE  419
            +ASY++++   +L F      A   S    A     +A A   FN  HG+   AV + VE
Sbjct  65   YASYVMQSHDIKLVFTAPYTTAGDKSQSKIAHPQFDTAKAQAFFNK-HGVAASAVGIEVE  123

Query  420  DTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLY--GDVVLRFISY  554
            D   A+  +V  GA  ++EP TL N+      V++EV LY  GDV LRFIS+
Sbjct  124  DAAEAYRIAVENGAVSIAEPATLVNEATGAKTVVSEVLLYTKGDVALRFISF  175



>gb|EWM22210.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=439

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 114/193 (59%), Gaps = 31/193 (16%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            +LVG K FVR NP SD F +KRFHH+EF+CGDATNT+RRFSW LG+   AKSD STGN  
Sbjct  24   ELVGHKRFVRHNPLSDRFEMKRFHHLEFYCGDATNTSRRFSWGLGLSQVAKSDNSTGNPL  83

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsf------------sasaHRSFNAT-  380
            +ASY+L++   EL F+FTAPYAS+  + + AA  S             + S H +F+++ 
Sbjct  84   YASYVLQSQ--ELVFVFTAPYASTPPSSSVAAALSQPSHRIAEASPSLAPSPHPAFDSSM  141

Query  381  -------HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV-----LAEVHLY  524
                   HGL VRA+ + V D   A+ A ++ G K V  P  L +        +AEV  Y
Sbjct  142  AMGFFGRHGLAVRAIGIEVHDASQAYEACLAHGGKGVLAPQILKDTATGQVKWIAEVLAY  201

Query  525  ----GDVVLRFIS  551
                 +VVLRF+S
Sbjct  202  PGNDAEVVLRFVS  214



>gb|EWM22209.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=458

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 114/193 (59%), Gaps = 31/193 (16%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            +LVG K FVR NP SD F +KRFHH+EF+CGDATNT+RRFSW LG+   AKSD STGN  
Sbjct  24   ELVGHKRFVRHNPLSDRFEMKRFHHLEFYCGDATNTSRRFSWGLGLSQVAKSDNSTGNPL  83

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsf------------sasaHRSFNAT-  380
            +ASY+L++   EL F+FTAPYAS+  + + AA  S             + S H +F+++ 
Sbjct  84   YASYVLQSQ--ELVFVFTAPYASTPPSSSVAAALSQPSHRIAEASPSLAPSPHPAFDSSM  141

Query  381  -------HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV-----LAEVHLY  524
                   HGL VRA+ + V D   A+ A ++ G K V  P  L +        +AEV  Y
Sbjct  142  AMGFFGRHGLAVRAIGIEVHDASQAYEACLAHGGKGVLAPQILKDTATGQVKWIAEVLAY  201

Query  525  ----GDVVLRFIS  551
                 +VVLRF+S
Sbjct  202  PGNDAEVVLRFVS  214



>ref|XP_010475412.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=197

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 101/149 (68%), Gaps = 11/149 (7%)
 Frame = +3

Query  195  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----sa  359
            M  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S++        + S       +
Sbjct  1    MRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLTAGEIKPTATASIPSFDHVS  58

Query  360  HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN-NQVVLAEVHLYGDVV  536
             RSF ++HGLGVRAVA+ VED ++AFS SVS GA P S P+ L+   V +AEV LYGDVV
Sbjct  59   SRSFFSSHGLGVRAVAIEVEDAESAFSVSVSNGAIPSSPPMVLDGGAVTIAEVKLYGDVV  118

Query  537  LRFISYLSDPSAVTTFLQGFEPMDGTASY  623
            LR++SY  D S    FL GFEP++ T+S+
Sbjct  119  LRYVSYKEDKS---EFLPGFEPVEDTSSF  144



>gb|ACN36372.1| unknown [Zea mays]
Length=426

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 114/181 (63%), Gaps = 22/181 (12%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            F+LVG ++FVR NP+SD F    FHHVE WC DA + A RFS+ LG P+AA+SDLSTGNS
Sbjct  25   FRLVGHRNFVRFNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNS  84

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
            AHAS LLR+      F       +  ++ A+AA+PSFSA+A R F A HGL VRAVAL V
Sbjct  85   AHASLLLRSGSLSFLF---TAPYAHGADAATAALPSFSAAAARRFAADHGLAVRAVALRV  141

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGF  596
             D + AF     RG +             LAEV LYGDVVLR++SY  D +A   FL GF
Sbjct  142  ADAEDAF-----RGFR-------------LAEVELYGDVVLRYVSY-PDGAAGEPFLPGF  182

Query  597  E  599
            E
Sbjct  183  E  183



>ref|XP_002902379.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
 gb|EEY56305.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
Length=335

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 94/157 (60%), Gaps = 9/157 (6%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            +D F V +FHH+EF+C DATN +RRF+W LGM    KSD STGN   ASY++++  GE++
Sbjct  2    TDRFDVHKFHHIEFYCADATNASRRFAWGLGMAQIGKSDQSTGNHVSASYVIQS--GEVK  59

Query  282  FLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVALVVEDTQAAFSASVSR  455
             +FTAPYA        A            + F   HGL VRAV ++V D +AA+  SV  
Sbjct  60   LVFTAPYALETEKAPDAVSSISGYDPEFAQKFVMKHGLAVRAVGILVGDAKAAYELSVQN  119

Query  456  GAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS  551
            G   V EP TL ++       ++EV LYGDVV+R++S
Sbjct  120  GGVGVVEPQTLTDKESGKTTTVSEVKLYGDVVIRWVS  156



>ref|XP_005850767.1| hypothetical protein CHLNCDRAFT_20078 [Chlorella variabilis]
 gb|EFN58665.1| hypothetical protein CHLNCDRAFT_20078 [Chlorella variabilis]
Length=446

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 113/197 (57%), Gaps = 20/197 (10%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARR---------FSWALGMPIAAK  212
            KLVG+  F R NP+SD F + +FHHVEFWCGDAT T+ R         F + LG+ + AK
Sbjct  22   KLVGYDGFQRHNPRSDRFPMHKFHHVEFWCGDATTTSCRQARPPEAPMFGYGLGLTLVAK  81

Query  213  SDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLG  392
            SD STGN  +ASY++++  G+L   FTAPY++      S+   ++   A  +F   HG+ 
Sbjct  82   SDQSTGNHHYASYVMQS--GDLVMAFTAPYSTQTDKSGSSPPAAYDQDAAYAFLKKHGMA  139

Query  393  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYL  557
            VRA  ++V+D   A+  + + G   V+ P T  +      +  +EV LYGD VLRF+S  
Sbjct  140  VRAFGILVDDAAEAYRIATAHGGVGVAPPTTRTDAASGTSLTWSEVQLYGDCVLRFVSGD  199

Query  558  SDPSAVTTFLQGFEPMD  608
             +      F+ G++P++
Sbjct  200  YE----GAFIPGYQPVE  212



>gb|ETK93728.1| hypothetical protein L915_03107, partial [Phytophthora parasitica]
Length=146

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  410
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  411  VVEDTQAAFSASVSRG  458
            +V D +AA+ +SV  G
Sbjct  128  LVGDAKAAYESSVQNG  143



>gb|KDD74142.1| hypothetical protein H632_c1538p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=362

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 102/170 (60%), Gaps = 8/170 (5%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  239
            +LVG K F R NP +D F + +F H EF+C DATN ++RF + +GM + AKSD  TGN  
Sbjct  15   QLVGHKVFKRNNPMTDRFPMHKFLHFEFYCQDATNVSKRFGYGMGMTMVAKSDQGTGNHT  74

Query  240  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVALVV  416
            +ASY+++++  E+ F FTAPY  S +   S     +   A   +F A HGL VRAV + V
Sbjct  75   YASYVMKSN--EVVFTFTAPYGLSTNKSDSQPPLPYFDCAQAHAFVADHGLAVRAVGVAV  132

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFIS  551
            +D   AF  +   GA  +  PV L +     ++ ++EV LYGDV LRF+S
Sbjct  133  DDAAEAFRIATENGAVAMQSPVVLEDASGAGKLTVSEVKLYGDVALRFVS  182



>ref|XP_008881550.1| hypothetical protein H310_15345 [Aphanomyces invadans]
 gb|ETV89817.1| hypothetical protein H310_15345 [Aphanomyces invadans]
Length=238

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 91/159 (57%), Gaps = 18/159 (11%)
 Frame = +3

Query  36   STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  215
            STP N   KLVG+++FVR NPKSD F++ +FHH+EF+  DATN ++RF WA G+ + AKS
Sbjct  70   STP-NKKMKLVGYENFVRHNPKSDRFTMHKFHHIEFYTQDATNVSKRFGWAAGLKVVAKS  128

Query  216  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNA------  377
            D STGN A+ASY+L++  GEL+   T       +  +           H  FN       
Sbjct  129  DQSTGNHAYASYVLQS--GELKIAIT-------APYSRKNQKEGHVPPHPGFNVDFAHEF  179

Query  378  --THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL  488
               HGL VRA+A+ V+D   A+  S   GA  V  P T+
Sbjct  180  CNKHGLAVRAMAISVDDAALAYELSTKHGAVGVCPPKTV  218



>gb|EAZ21880.1| hypothetical protein OsJ_05532 [Oryza sativa Japonica Group]
Length=447

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 106/190 (56%), Gaps = 9/190 (5%)
 Frame = +3

Query  45   ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDL-  221
            EN GF+LVG + FVR NP+SD F    FHHVE WC DA + A RF++ALG   AA+  + 
Sbjct  22   ENAGFRLVGHRRFVRANPRSDRFQALAFHHVELWCADAASAAGRFAFALGR--AARRQVR  79

Query  222  ----STGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGL  389
                 T  +  +S     S         A  AS+     +A+IPSFS  A R F A HGL
Sbjct  80   PLHGGTPRTPPSSSAPPPSRSSSPPPTAATTASATDAATTASIPSFSPGAARRFAADHGL  139

Query  390  GVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPS  569
             V AVAL V D   AF ASV+ GA+P  +P  L     LAEV LYGDVVLRF+S+     
Sbjct  140  AVHAVALRVADAADAFRASVAAGARPAFQPADLGGGFGLAEVELYGDVVLRFVSHPD--G  197

Query  570  AVTTFLQGFE  599
            A   FL GFE
Sbjct  198  ADAPFLPGFE  207



>ref|XP_003575746.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Brachypodium 
distachyon]
Length=493

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 101/172 (59%), Gaps = 9/172 (5%)
 Frame = +3

Query  105  DHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS--GGEL  278
            +   V  FHH EFWC DA + A RFS  LG+P+AA+SDLS GN+ HAS+LLR+S  G  +
Sbjct  82   NRLRVIDFHHAEFWCADAASAAARFSSGLGVPVAARSDLSMGNTVHASHLLRSSSPGSSI  141

Query  279  QFLFTapyassisnpasaaipsfsasaHRSFNATH-----GLGVRAVALVVEDTQAAFSA  443
              LFTAPYA + S+ +S++  S   S              GL VR VA+ V D   A+ A
Sbjct  142  ALLFTAPYADAASSSSSSSSSSTVPSFSADAARAFTAAHGGLAVRTVAVRVADAAEAYHA  201

Query  444  SVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            SV  GA+P   PV L +  + AEV LYGD VLRF+SY  D      FL GFE
Sbjct  202  SVEAGARPAFAPVDLGHGFLFAEVELYGDSVLRFVSYPDDTE--VPFLPGFE  251



>ref|XP_006853409.1| hypothetical protein AMTR_s00032p00156270 [Amborella trichopoda]
 gb|ERN14876.1| hypothetical protein AMTR_s00032p00156270 [Amborella trichopoda]
Length=144

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +3

Query  48   NGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLST  227
            NGG KLVGFK+FVR NPK+D     +FHH+EFWC DATNT+ RF  AL MP+ AKSDLST
Sbjct  5    NGGLKLVGFKNFVRSNPKTDRIPPTKFHHIEFWCSDATNTSGRFQNALLMPLNAKSDLST  64

Query  228  GNSAHASYLLRASGGELQFLFT  293
            GNS ++SY+LR+   +L F FT
Sbjct  65   GNSVYSSYVLRSH--DLIFAFT  84



>ref|XP_007511204.1| 4-hydroxyphenylpyruvate dioxygenase [Bathycoccus prasinos]
 emb|CCO66764.1| 4-hydroxyphenylpyruvate dioxygenase [Bathycoccus prasinos]
Length=466

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 96/186 (52%), Gaps = 24/186 (13%)
 Frame = +3

Query  60   KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSD-LSTGNS  236
            KLVG+ +F R NP+SD F V RFH +EF+C DA  TA RF+ ALGM +   SD  +TGN 
Sbjct  15   KLVGYSNFKRANPRSDLFPVTRFHSIEFFCQDAKTTANRFAIALGMNVIGLSDQTTTGNV  74

Query  237  AHASYLLRASGGELQFLFT----------------apyassisnpasaaipsfsasaHRS  368
             + SY ++++  EL F+FT                     ++S+  +        +  + 
Sbjct  75   IYNSYAMKSN--ELVFVFTAPVMTEEKGYGRDLEGEKEEKNVSDDETTKAIEEEKALAKQ  132

Query  369  FNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDV  533
            F   HGL V+ V + V D + A++ S   G   V  P TL N     +  +AEV LYGDV
Sbjct  133  FVEKHGLAVKRVCVRVNDCKEAYAVSTKNGGVSVRAPRTLRNRKDGREATVAEVALYGDV  192

Query  534  VLRFIS  551
             LRF+ 
Sbjct  193  ELRFVE  198



>ref|XP_002307562.2| hypothetical protein POPTR_0005s22680g [Populus trichocarpa]
 gb|EEE94558.2| hypothetical protein POPTR_0005s22680g [Populus trichocarpa]
Length=254

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 87/170 (51%), Gaps = 46/170 (27%)
 Frame = +3

Query  3    GKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFS  182
            GKE  +S     TP  G FKLVGF +FVR N +SD F V RFHHVEFWC DATNTAR  S
Sbjct  2    GKENETS----ETP--GEFKLVGFSNFVRTNSRSDLFKVNRFHHVEFWCSDATNTARP-S  54

Query  183  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH  362
              + +   A + + T N  H +                                      
Sbjct  55   MDVNLSHTATASIPTFN--HETC-------------------------------------  75

Query  363  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAE  512
            R+F+A HGL VRA+A+ V+D + AF+ SV+ GAKP + P+ L+N  V+ E
Sbjct  76   RNFSAKHGLAVRAIAIEVDDAELAFTTSVAHGAKPSASPILLDNGAVITE  125



>ref|XP_007048969.1| Phytoene desaturation 1, putative [Theobroma cacao]
 gb|EOX93126.1| Phytoene desaturation 1, putative [Theobroma cacao]
Length=422

 Score =   102 bits (253),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 15/154 (10%)
 Frame = +3

Query  201  IAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saH  362
            I  +   STGN A ASYL+R+  GE  FLFTAPY+ SI+   + +  + ++      +  
Sbjct  84   IGCQVRPSTGNMAQASYLIRS--GECNFLFTAPYSLSIAQAENLSPTATASIPTFDHAIC  141

Query  363  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLR  542
            R+F A+HGL  RA+ + VED + AF  SVS GAKP S P  L+NQ VLAEV L+GDVVLR
Sbjct  142  RAFVASHGLAPRAIFVEVEDAETAFFISVSHGAKPSSPPTVLDNQAVLAEVFLFGDVVLR  201

Query  543  FISYL-------SDPSAVTTFLQGFEPMDGTASY  623
            +IS+        +D    T FL  FE M+ T SY
Sbjct  202  YISFKNSDHESPNDDENCTWFLPRFEKMEDTLSY  235


 Score = 31.6 bits (70),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +2

Query  101  IRPLLRETLPPCGVLVRRCY*HCPPLLLGAGNA  199
            +RPL  + +  C VLV+RC+  C P+L+G  +A
Sbjct  51   VRPLQSQAVSSCRVLVQRCHKCCSPVLMGPWHA  83



>ref|XP_002895668.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Phytophthora infestans 
T30-4]
 ref|XP_002901242.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Phytophthora infestans 
T30-4]
 gb|EEY55147.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Phytophthora infestans 
T30-4]
 gb|EEY59228.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Phytophthora infestans 
T30-4]
Length=175

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (59%), Gaps = 4/134 (3%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            +D F V +FHH++F+C DATN +RRF+W LGM    KSD STGN   ASY++++  GE++
Sbjct  2    TDRFDVHKFHHIKFYCADATNASRRFAWGLGMAQIGKSDQSTGNHVSASYVIQS--GEVK  59

Query  282  FLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVALVVEDTQAAFSASVSR  455
             +FTAPYA        A            + F   HGL VRAV ++V D +AA+  SV  
Sbjct  60   LVFTAPYALETEKAPDAVSSISGYDPEFAQMFVMKHGLAVRAVGILVGDAKAAYELSVQN  119

Query  456  GAKPVSEPVTLNNQ  497
            G   V EP TL ++
Sbjct  120  GGVGVVEPQTLTDK  133



>gb|AET00342.2| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=314

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = +3

Query  195  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRS--  368
            MPI AKSDLSTG   HASYLLR+  G+L  LF+A Y+ SIS  + +   S  + +  +  
Sbjct  1    MPIVAKSDLSTGILTHASYLLRS--GDLNLLFSAAYSPSISLSSPSPTASIPSFSAPACF  58

Query  369  -FNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRF  545
             F+A+HGL VRAVA+ V++ + AF+ SV+ GA P S  V LNN+V L+EV L+GDVVLR+
Sbjct  59   AFSASHGLSVRAVAVEVDNAELAFTTSVNHGAVPSSPAVVLNNRVKLSEVRLFGDVVLRY  118

Query  546  ISY  554
            ISY
Sbjct  119  ISY  121



>emb|CBJ28697.1| 4-hydroxyphenylpyruvate dioxygenase, plastid precursor [Ectocarpus 
siliculosus]
Length=516

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 97/187 (52%), Gaps = 33/187 (18%)
 Frame = +3

Query  87   RVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS  266
            + N  +D F +K+FHHVEF+CGDAT  A RF W LGM + AKSD STGN+ HASY+++++
Sbjct  35   KENTGTDLFRMKKFHHVEFYCGDATAAASRFVWGLGMKLVAKSDQSTGNAQHASYVVQSN  94

Query  267  GGELQFLFTapyassisnpasaaipsfsasaHR---------------------SFNATH  383
              +L+F+ TAPY+ + +             + R                      F   H
Sbjct  95   --DLRFVCTAPYSLATTPTTEGGAGDRRDPSSRVVDVGESGGSPLPGFDPAAAHEFFRRH  152

Query  384  GLGVRAVALVVEDTQAAFSASV----SRGAKP-VSEPVTLNN-----QVVLAEVHLYGDV  533
            GL  RA+ + VED   A+   +    S G+   V  P  + +     +  ++EV  YGDV
Sbjct  153  GLAGRAIGIEVEDAAHAYEQCIEHCGSDGSNASVRRPTRVTDVDGRGRATISEVRAYGDV  212

Query  534  VLRFISY  554
            VLRFIS+
Sbjct  213  VLRFISF  219



>dbj|BAJ93624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +3

Query  84   VRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA  263
            VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNSAHAS LLR+
Sbjct  28   VRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLRS  87

Query  264  SGGELQFL  287
              G L FL
Sbjct  88   --GSLAFL  93



>gb|ETP51665.1| hypothetical protein F442_03207, partial [Phytophthora parasitica 
P10297]
Length=74

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  237  AHASY  251
              ASY
Sbjct  70   VSASY  74



>ref|XP_005852430.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Nannochloropsis 
gaditana CCMP526]
 gb|EKU23402.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Nannochloropsis 
gaditana CCMP526]
Length=200

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 22/142 (15%)
 Frame = +3

Query  114  SVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFT  293
            ++KRFHH+EF+CGDATNT+RRFSW LG+   AKSD STGN  +ASY+L++   EL F+FT
Sbjct  9    NMKRFHHLEFYCGDATNTSRRFSWGLGLSQVAKSDNSTGNPLYASYVLQSQ--ELVFVFT  66

Query  294  apyassisnpasaaipsf------------sasaHRSFNAT--------HGLGVRAVALV  413
            APYAS+  + + AA  S             + S H +F+++        HGL VRA+ + 
Sbjct  67   APYASTPPSSSVAAALSQPSHRIAEASPSLAPSPHPAFDSSMAMGFFGRHGLAVRAIGIE  126

Query  414  VEDTQAAFSASVSRGAKPVSEP  479
            V D   A+ A ++ G K V  P
Sbjct  127  VHDASQAYEACLAHGGKGVLAP  148



>gb|EEC72567.1| hypothetical protein OsI_06005 [Oryza sativa Indica Group]
Length=601

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 87/146 (60%), Gaps = 10/146 (7%)
 Frame = +3

Query  174  RFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa  353
            RF W +G+ +  +SDLSTGNSAHAS LLR++   + FLFTAPY       A AA  +   
Sbjct  222  RF-W-MGICVMDRSDLSTGNSAHASLLLRSA--SVAFLFTAPYGGDHGVGADAATTASIP  277

Query  354  s----aHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  521
            S    A R F A HGL V AVAL V D   AF ASV+ GA+P  +P  L     LAEV L
Sbjct  278  SFSPGAARRFAADHGLAVHAVALRVADAADAFRASVAAGARPAFQPADLGGGFGLAEVEL  337

Query  522  YGDVVLRFISYLSDPSAVTTFLQGFE  599
            YGDVVLRF+S+     A   FL GFE
Sbjct  338  YGDVVLRFVSHPD--GADAPFLPGFE  361



>ref|XP_008360256.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase-like 
[Malus domestica]
Length=347

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 5/86 (6%)
 Frame = +3

Query  363  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLR  542
            R+F+AT GL VRAVA+ VEDT +AF+ASV+ G KP + P  +NN+V +AEV LYGDV+LR
Sbjct  79   RTFSATQGLSVRAVAIQVEDTISAFTASVAHGTKPSAAPNLVNNRVTIAEVQLYGDVILR  138

Query  543  FISY-----LSDPSAVTTFLQGFEPM  605
            ++SY      +DP     FL GFE +
Sbjct  139  YVSYTNHNHFTDPDLHLWFLPGFESL  164



>ref|XP_002287272.1| 4-hydroxyphenylpyruvate dioxygenase [Thalassiosira pseudonana 
CCMP1335]
 gb|EED94715.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Thalassiosira pseudonana 
CCMP1335]
Length=418

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 89/174 (51%), Gaps = 17/174 (10%)
 Frame = +3

Query  126  FHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapya  305
            FHH+EF+  DA  TA+RF  ALG+PI   S L+TGN    +Y L   G + + + T    
Sbjct  1    FHHIEFFASDALTTAKRFELALGLPITCWSSLATGNDVCVTYGLE--GMQTRKIETDNAN  58

Query  306  ssisnpasaaips------fsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKP  467
             +    ++  + +      +       F + HGL VRAV + V+D   A++ +V  GA  
Sbjct  59   KNGGAGSNVQMTAPLPLPGYDIDKAHEFYSKHGLAVRAVGVEVKDATVAYANAVENGATG  118

Query  468  VSEPVTLNN--------QVVLAEVHLYGDVVLRFISYLSDPSA-VTTFLQGFEP  602
            V EP  + N        +  +AEV LYGDVVLR +S+  D SA  +TFL    P
Sbjct  119  VLEPTIVENFNSDGDSQKCHMAEVELYGDVVLRLVSFHGDCSAEQSTFLPHLSP  172



>ref|XP_008390582.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Malus domestica]
Length=361

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 5/85 (6%)
 Frame = +3

Query  366  SFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRF  545
            +F+ATHGLG+RAVA+ VEDT +AF ASV+   KP + P+ ++N+V + EV LYGDV+LR+
Sbjct  97   TFSATHGLGIRAVAIQVEDTVSAFIASVAHDTKPSAAPIIVDNRVTITEVQLYGDVILRY  156

Query  546  ISY-----LSDPSAVTTFLQGFEPM  605
            +SY     L++P     FL GF+ +
Sbjct  157  VSYTDHNHLTEPDLHLWFLPGFKSL  181



>gb|EJK75816.1| hypothetical protein THAOC_02448 [Thalassiosira oceanica]
Length=508

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 87/178 (49%), Gaps = 35/178 (20%)
 Frame = +3

Query  126  FHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA---------SGGEL  278
            FHHVEF+ GDA  TA+RF  ALG+PI   S L+TGN    +Y L           SG  +
Sbjct  80   FHHVEFYTGDALMTAKRFELALGVPITCWSSLATGNDVCVTYGLECGIDYNSDTESGHGV  139

Query  279  QFLFTapyassisnpasaaipsfsasaHR------------------SFNATHGLGVRAV  404
            +FL TAP + ++    + A  + +                        F + HGL VRAV
Sbjct  140  RFLITAPLSRAMQKVNNDAPSAPTGVPSNVQMTAPLPLPGYSIEGAHEFYSKHGLAVRAV  199

Query  405  ALVVEDTQAAFSASVSRGAKPVSEPVTL--------NNQVVLAEVHLYGDVVLRFISY  554
             + V+D + A+ A++  GA  V  P  +          +  +AEV LYGDVVLRF+S+
Sbjct  200  GVEVQDAKEAYEAALRNGAHGVLPPTDIPTNYEGQFTGECQMAEVKLYGDVVLRFVSF  257



>gb|ETM53453.1| hypothetical protein L914_03077, partial [Phytophthora parasitica]
Length=61

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  42   PENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSD  218
            P     KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD
Sbjct  3    PSADDMKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSD  61



>ref|XP_001694722.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
 gb|EDP02306.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=372

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 82/143 (57%), Gaps = 12/143 (8%)
 Frame = +3

Query  195  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR-SF  371
            MP+ AKSD ST N   ASY+LR++  +L F FTAPY+   ++ +           H   F
Sbjct  1    MPLVAKSDQSTNNQLFASYVLRSN--DLVFTFTAPYSRKCASVSEGVPLRHYNIDHAYEF  58

Query  372  NATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVV  536
              +HGL VRAV L+V+D + A+  SV+ GAK V  PV L ++      V++EV +YGDVV
Sbjct  59   INSHGLAVRAVGLLVDDAKTAYEVSVAHGAKGVLPPVELRDEASGTSQVISEVIVYGDVV  118

Query  537  LRFISYLSDPSAVTTFLQGFEPM  605
             R++S     S    F+ G+ P+
Sbjct  119  FRYVS----GSFEGPFMAGYTPV  137



>gb|EDL65287.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. SG-1]
Length=378

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 83/172 (48%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   ++E++ G+A   A  F  A G  I A S L TGN    SY+L+ +  +++
Sbjct  20   EDFFPVRDVDYLEYYTGNAKQAAHYFCTAFGFKIVAYSGLETGNRETVSYVLQQN--KVR  77

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             L T     S                  SF   HG G++ +ALVV+D + A+S +VSRGA
Sbjct  78   MLVTGSLTESSRVA--------------SFVKKHGDGIKDIALVVDDVEKAYSEAVSRGA  123

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P+TL   N  +  A +  YGD +   +    D   V  F+ GFE M+
Sbjct  124  IEITPPMTLSDDNGTIKKAIIGTYGDTIHTLVER-KDYKGV--FMPGFEAME  172



>ref|WP_044022537.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. SG-1]
Length=373

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 83/172 (48%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   ++E++ G+A   A  F  A G  I A S L TGN    SY+L+ +  +++
Sbjct  15   EDFFPVRDVDYLEYYTGNAKQAAHYFCTAFGFKIVAYSGLETGNRETVSYVLQQN--KVR  72

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             L T     S                  SF   HG G++ +ALVV+D + A+S +VSRGA
Sbjct  73   MLVTGSLTESSRVA--------------SFVKKHGDGIKDIALVVDDVEKAYSEAVSRGA  118

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P+TL   N  +  A +  YGD +   +    D   V  F+ GFE M+
Sbjct  119  IEITPPMTLSDDNGTIKKAIIGTYGDTIHTLVE-RKDYKGV--FMPGFEAME  167



>gb|KIZ04447.1| 4-hydroxyphenylpyruvate dioxygenase [Monoraphidium neglectum]
Length=341

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +3

Query  99   KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  278
            + D F V  FHH+EFW  DATNT++RF   LGM +AAKSD STGNS  ASY LR+  G++
Sbjct  37   RRDRFCVHGFHHLEFWTADATNTSKRFQHGLGMSLAAKSDYSTGNSQCASYALRS--GDV  94

Query  279  QFLFT  293
             F+FT
Sbjct  95   LFVFT  99



>gb|AIF24945.1| 4-hydroxyphenylpyruvate dioxygenase (HPD, hppD) [uncultured marine 
group II/III euryarchaeote SAT1000_41_C12]
Length=362

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 73/154 (47%), Gaps = 19/154 (12%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D   +K  HH+EFW G+A   A  +  A G    A S L TGN   ASY+L    G+++
Sbjct  3    KDPVPLKAVHHLEFWVGNAKQAAYFYRTAFGFNQIAYSGLETGNRERASYVLEQ--GKIR  60

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             +F+ P  S+                       HG GV+ +A  V+D +A + A ++RGA
Sbjct  61   LMFSTPLNSNNRISEHI--------------KLHGDGVKDIAFHVDDAKACYEACITRGA  106

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISY  554
            K   EP  +   N  V  A ++ YG+ +  FISY
Sbjct  107  KSAKEPEVISDDNGSVTQAAIYTYGETIHSFISY  140



>ref|WP_035350816.1| 4-hydroxyphenylpyruvate dioxygenase [Edaphobacter aggregans]
Length=374

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 86/172 (50%), Gaps = 26/172 (15%)
 Frame = +3

Query  96   PKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGE  275
            P +D   +K   HVEF+ G+A  +A  +  A GM + A S   TG+   ASY+L+   G+
Sbjct  11   PAADFLPLKGTDHVEFYVGNARQSAYFYCAAFGMTLVAYSGPETGHRDRASYVLQQ--GK  68

Query  276  LQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSR  455
            ++F+ T                      H+     HG GVRA+AL V+D + A+  + SR
Sbjct  69   VRFVLTTALRPDSEIAQHV---------HK-----HGDGVRAIALWVDDARQAWRETTSR  114

Query  456  GAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFI--SYLSDPSAVTTFLQGF  596
            GA+ + EP  L++   QVV + +  YGD +  F+  ++ + P     FL GF
Sbjct  115  GARSIQEPTELSDEHGQVVTSSIAAYGDTIHTFVERTHYTGP-----FLPGF  161



>ref|WP_027987430.1| 4-hydroxyphenylpyruvate dioxygenase [delta proteobacterium JGI 
0002000-E07]
Length=357

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 82/166 (49%), Gaps = 22/166 (13%)
 Frame = +3

Query  111  FSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLF  290
              +K  HHVE + G+A  +A  +  A G    A S L TGN   ASY+L  + G+++F+ 
Sbjct  1    MKLKSVHHVELYAGNAKQSAWFYRKAFGFSQIAYSGLETGNRTAASYVL--AQGKIRFVI  58

Query  291  TapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPV  470
            T+P                           HG GV  +AL+VED   AF+ +V RGAKP 
Sbjct  59   TSPLTPHHPGAEHIR--------------RHGDGVCDIALLVEDADFAFAEAVRRGAKPA  104

Query  471  SEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
             +P  ++++   V  A +H+YGD +  F+SY     A   FL G++
Sbjct  105  IDPHDVHDEHGSVRRAAIHIYGDTIHTFLSYKDYKGA---FLPGYQ  147



>ref|WP_020060738.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. 123MFChir2]
Length=372

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 84/177 (47%), Gaps = 22/177 (12%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  T+   + A G  IAA S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQTSYYLARAFGFSIAAYSGLETGNRDKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    ++                   F   HG GV+ VAL+VED + A++ +V RGA
Sbjct  72   FVVSGALNTNSRIA--------------EFVKQHGDGVKDVALLVEDVEKAYAEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGTASY  623
              ++ P  L+++   +  A +  YGD +   +   +   A   F+ G+EP++    +
Sbjct  118  VAIAPPEVLSDEHGTLKKAVIGTYGDTIHTLVERKNYKGA---FMPGYEPLESIVPF  171



>gb|AJD92913.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus sp. D5]
Length=373

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 77/184 (42%), Gaps = 24/184 (13%)
 Frame = +3

Query  75   KDFVRVNPK--SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHAS  248
            KD   V  +   D F V+ FHH+E + G+A  +A  F  A G  I A   L TG+    S
Sbjct  3    KDVTEVTQEMVEDIFPVESFHHLELYVGNAKQSAYYFCHAFGFEIKAYRGLETGSRERVS  62

Query  249  YLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQ  428
            Y+L    G ++ + T    +                    F   HG G + + L V D  
Sbjct  63   YVLEQ--GVIRLVITGSLTNETDIA--------------EFVKLHGEGTKDIGLEVSDID  106

Query  429  AAFSASVSRGAKPVSEPVT---LNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
             A+  +V RG   + EP T    N  V  A +  YGDV+   +  +    A   FL G+E
Sbjct  107  KAYYGAVERGGTGIREPWTEKDENGTVKKAIIGTYGDVIHTLVENVDYEGA---FLPGYE  163

Query  600  PMDG  611
            P DG
Sbjct  164  PYDG  167



>ref|WP_035432465.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. UNC322MFChir4.1]
Length=372

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 82/174 (47%), Gaps = 22/174 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  T+   + A G  IAA S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQTSYYLARAFGFSIAAYSGLETGNRDKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    ++                   F   HG GV+ VAL+VED + A++ +V RGA
Sbjct  72   FVVSGALNTNSRIA--------------EFVKQHGDGVKDVALLVEDVEKAYTEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGT  614
              ++ P  L+++   +  A +  YGD +   +   +   A   F+ G+EP   T
Sbjct  118  VAIAPPEELSDEHGTLKKAVIGTYGDTIHTLVERKNYKGA---FMPGYEPFTST  168



>ref|WP_039814073.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus sp. D5]
Length=362

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 73/173 (42%), Gaps = 22/173 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+ FHH+E + G+A  +A  F  A G  I A   L TG+    SY+L    G ++
Sbjct  3    EDIFPVESFHHLELYVGNAKQSAYYFCHAFGFEIKAYRGLETGSRERVSYVLEQ--GVIR  60

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             + T    +                    F   HG G + + L V D   A+  +V RG 
Sbjct  61   LVITGSLTNETDIA--------------EFVKLHGEGTKDIGLEVSDIDKAYYGAVERGG  106

Query  462  KPVSEPVT---LNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDG  611
              + EP T    N  V  A +  YGDV+   +  +    A   FL G+EP DG
Sbjct  107  TGIREPWTEKDENGTVKKAIIGTYGDVIHTLVENVDYEGA---FLPGYEPYDG  156



>gb|ABI53728.2| 4-hydroxyphenylpyruvate dioxygenase [uncultured bacterium]
Length=375

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 69/151 (46%), Gaps = 19/151 (13%)
 Frame = +3

Query  111  FSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLF  290
              +K+ HHVEF+ G+A      +  A G   AA S L TGN    SYL+R +   + F+ 
Sbjct  12   LGLKKIHHVEFYVGNAKQAEFYYRKAFGFSRAAYSGLETGNRETTSYLIRQNN--VNFVL  69

Query  291  TapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPV  470
            T P +                         HG GVR +A +V+D   AF+ +V RGA+  
Sbjct  70   TTPLSPDHPAAEHI--------------KQHGDGVRDIAFLVDDADHAFNEAVKRGARVA  115

Query  471  SEPVTL---NNQVVLAEVHLYGDVVLRFISY  554
             EP  L   N  V  A +  YGD +  FISY
Sbjct  116  VEPRDLKDDNGSVRHAAIATYGDTIHSFISY  146



>ref|WP_019122205.1| 4-hydroxyphenylpyruvate dioxygenase [Brevibacillus massiliensis]
Length=362

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 68/153 (44%), Gaps = 19/153 (12%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            +D F +K + HVEF+ G+A       + A G    A S L TG+    SY+L+ +   L 
Sbjct  3    TDFFPIKDWDHVEFYVGNAKQAMHYLTKAFGFKATAYSGLETGSREMVSYVLKQN--HLT  60

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +                         F   HG GV+ +AL VED   AF  +VSRGA
Sbjct  61   FVVSGALVPEHPIA--------------EFVREHGEGVKDIALTVEDCDKAFREAVSRGA  106

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFIS  551
             PV EP   ++Q   V  A +  YGD V   I 
Sbjct  107  VPVMEPTEYSDQHGTVKKATIRTYGDTVHSLIE  139



>gb|KIW05916.1| 4-hydroxyphenylpyruvate dioxygenase [Verruconis gallopava]
Length=425

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 82/168 (49%), Gaps = 12/168 (7%)
 Frame = +3

Query  120  KRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTap  299
            K +HH+ +W G+A   A  +    G    AKSDL+TG+   AS+++  + G ++F+F +P
Sbjct  44   KGYHHITWWVGNAKQAASYYITRFGFRPVAKSDLTTGSRTVASHVV--ASGNIKFVFQSP  101

Query  300  yassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEP  479
              +S                       HG  V+ VA  V D +A +  +++RGA+ V EP
Sbjct  102  ILASNPRRGGLKKEDKLLEDMYESLEQHGDAVKDVAFEVNDVRAVYEGAIARGAEGVREP  161

Query  480  VTLNNQ---VVLAEVHLYGDVVLRFISY--LSDPSAVTTFLQGFEPMD  608
             T+ ++   V +A V  YGD    F+     + P     FL GF+P+D
Sbjct  162  WTVKDEFGAVTMASVKTYGDTTHTFVERDGYNGP-----FLPGFKPVD  204



>gb|AIM09594.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
Length=161

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 16/149 (11%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTLNNQVVLAEVHLYGDVVLRFI  548
              ++ PV L ++    +  L   +V++FI
Sbjct  131  VAIAPPVELTDENGTLKKQLLVRMVIQFI  159



>ref|WP_009334741.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus]
 gb|EFV75864.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. 2_A_57_CT2]
Length=371

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 81/177 (46%), Gaps = 22/177 (12%)
 Frame = +3

Query  81   FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  260
             +R   K+D F VK   ++E + G+A  +   F  A G    A S L TGN    SY+L+
Sbjct  6    MLREQKKADFFPVKEVDYLEIYSGNAKQSCHYFCTAFGFKPVAYSGLETGNRETVSYVLQ  65

Query  261  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  440
                +++ + T     S                  +F   HG GV+ +AL V+D + A++
Sbjct  66   QR--KIRLVITGTLNDSSRVS--------------NFIKKHGDGVKDIALAVDDVETAYN  109

Query  441  ASVSRGAKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEP  602
            A+V RGA  +  P  + ++   V  A +  YGD +   +   +D   V  F+ GFEP
Sbjct  110  AAVERGAIEIQPPFEIKDEHGTVKKAVIGTYGDTIHTLVE-RNDYKGV--FMPGFEP  163



>ref|WP_002115481.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJQ56242.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG6X1-2]
Length=372

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 81/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++  F+ A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHIEFYVGNAKQSSYYFARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_011522806.1| 4-hydroxyphenylpyruvate dioxygenase [Candidatus Koribacter versatilis]
 gb|ABF41005.1| 4-hydroxyphenylpyruvate dioxygenase [Candidatus Koribacter versatilis 
Ellin345]
Length=361

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 73/166 (44%), Gaps = 22/166 (13%)
 Frame = +3

Query  111  FSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLF  290
              +K+ HHVEFW G+A   A  +    G    A   L TG+   ASY+L+ +  +  F+ 
Sbjct  5    LKLKKIHHVEFWVGNAKQAAYYYRKGFGFNQLAYRGLETGSRDVASYVLQQN--KCNFVL  62

Query  291  TapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPV  470
            T                             HG GV+ +AL VED   AF  +V RGAK V
Sbjct  63   TTAINPEHPAADHVR--------------RHGDGVKDIALHVEDADFAFEEAVKRGAKAV  108

Query  471  SEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
             EP  + +    V  A VH YG+ +  FISY    +    FL GF+
Sbjct  109  FEPKDVIDNYGTVRWAAVHTYGETIHSFISY---KNYGGPFLPGFQ  151



>ref|WP_033694710.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Bacillus thuringiensis]
Length=371

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_000810915.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|AIE77850.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|KFM92484.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ATCC 4342]
 gb|AJH73133.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ATCC 4342]
Length=372

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>gb|EEK86219.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ATCC 4342]
 gb|EEM24586.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
tochigiensis BGSC 4Y1]
Length=389

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  31   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  88

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  89   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  134

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  135  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  183



>ref|WP_026963420.1| 4-hydroxyphenylpyruvate dioxygenase [Alicyclobacillus pomorum]
Length=369

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            +DH  ++   +VEF+ G+A   A   S A G  + A + + TG    ASY+L    G+++
Sbjct  7    ADHLPLQGIDYVEFYVGNAKQFAYFLSRAYGFQVVAYAGMETGVRDKASYVLEQ--GDIR  64

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ T+                        F   HG GV+ +A  V+D   A+  S SRGA
Sbjct  65   FVVTSALGPDHPIA--------------EFVKKHGDGVKEIAFTVDDAAVAYRESTSRGA  110

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
             PV++ + L ++   V  + +  YG+ V  FI           FL G+EPMD
Sbjct  111  IPVADVIELKDKHGVVRKSVIGTYGETVHAFIER---EKYDGVFLPGYEPMD  159



>ref|WP_016089597.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EOP03960.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2O-3]
 gb|EOQ18488.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus B5-2]
 gb|EOQ35092.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG3O-1]
Length=372

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 81/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ PV L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPVELTDEDGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_000810916.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJQ39449.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG5X2-1]
 gb|EJS63351.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2X1-2]
 gb|EJV56473.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG6X1-1]
Length=372

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQQVE  166



>gb|EEK69629.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MM3]
 gb|EEL84061.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH1271]
Length=385

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQQVE  179



>ref|WP_001975475.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EAL14217.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus G9241]
 gb|KDB41847.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|AIY74588.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|AJG92647.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|AJI05457.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus G9241]
Length=372

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +                     F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSGDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_000810914.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|AJH63292.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|AJH83337.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
 gb|AJK33581.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
Length=372

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  163



>ref|WP_000810913.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus]
 ref|NP_842794.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Ames]
 ref|YP_026511.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Sterne]
 ref|YP_034568.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
konkukian str. 97-27]
 gb|AAP24280.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Ames]
 gb|AAS39196.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ATCC 10987]
 gb|AAT29321.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
'Ames Ancestor']
 gb|AAT52562.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Sterne]
 gb|AAT61344.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
konkukian str. 97-27]
 gb|AAU20018.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus E33L]
 gb|EDR18205.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0488]
 gb|EDR87062.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0193]
 gb|EDR93230.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0442]
 gb|EDS96130.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0389]
 gb|EDT19033.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0465]
 gb|EDT66480.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0174]
 gb|EDV15418.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Tsiankovskii-I]
 gb|EDX55333.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus W]
 gb|EDX61593.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 03BB108]
 gb|EDX66616.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus NVH0597-99]
 gb|EDZ56110.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus H3081.97]
 gb|ACJ77205.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH187]
 gb|ACK91608.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH820]
 gb|ACM10759.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Q1]
 gb|ACO29802.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 03BB102]
 gb|ACP14951.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
CDC 684]
 gb|ACQ48677.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0248]
 gb|ADK03036.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus biovar anthracis 
str. CI]
 gb|ADY19499.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
finitimus YBT-020]
 dbj|BAL16024.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus NC7401]
 gb|AEW53459.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus F837/76]
 gb|EJP84191.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus IS075]
 gb|EJP97338.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AND1407]
 gb|EJQ89793.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ISP3191]
 gb|EJR04636.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MSX-A12]
 gb|EJR10798.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MSX-D12]
 gb|EJR45949.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD102]
 gb|AFQ09250.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus FRI-35]
 gb|EJT17712.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
UR-1]
 gb|EJY89136.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
BF1]
 gb|EOO91640.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus IS845/00]
 gb|EOO97721.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus IS195]
 gb|AHE81666.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A16R]
 gb|AHE87585.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A16]
 dbj|GAE95744.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis CZC5]
 gb|EVT94759.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis 8903-G]
 gb|EVU00623.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis 9080-G]
 gb|EVU07353.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis 52-G]
 gb|AHK36414.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
SVA11]
 gb|EXJ22173.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
95014]
 gb|AIF54723.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KEY91929.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Carbosap]
 gb|KFJ83554.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AIK33094.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AIK56777.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AIK64954.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Vollum]
 gb|AIK52764.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KFK76181.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|KFL76766.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KFL80543.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KFL86061.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|KGZ43021.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ52713.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ54706.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ60952.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ64652.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ65585.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ76649.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ80211.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ90236.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ90981.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ96990.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA06012.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA11873.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA11984.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA16035.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA31764.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA31801.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA36204.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA39131.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHG47433.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHG58166.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHG58290.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJA84730.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJF88079.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG27196.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG45707.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Turkey32]
 gb|AJG51749.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 03BB102]
 gb|AJG56882.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus D17]
 gb|AJG64551.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG73240.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG74673.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
 gb|AJG82863.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG87144.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH28712.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH32893.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH38811.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH47932.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Sterne]
 gb|AJH51070.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH59928.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH99617.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
V770-NP-1R]
 gb|AJH66759.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
 gb|AJI10714.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 03BB108]
 gb|AJH88550.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJI29185.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus E33L]
 gb|AJH95416.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJI31852.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
 gb|AJI37788.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJM79009.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
Length=372

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  163



>gb|AIM04210.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
Length=384

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  176



>gb|EEL19135.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 95/8201]
Length=385

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  176



>gb|EEK46877.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus m1293]
 gb|EEK58419.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BGSC 6E1]
 gb|EEL02587.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BDRD-ST26]
 gb|EEL47650.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Rock3-42]
 gb|EEM73647.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
andalousiensis BGSC 4AW1]
 gb|EEM79775.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
pondicheriensis BGSC 4BA1]
 gb|EEM91674.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
pulsiensis BGSC 4CC1]
Length=385

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  176



>ref|WP_038414892.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
Length=371

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  163



>gb|ABK83632.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis str. 
Al Hakam]
Length=389

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  31   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  88

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  89   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  134

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  135  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  180



>gb|AFH81613.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
H9401]
Length=385

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  176



>ref|WP_041488236.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Bacillus mycoides]
Length=359

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  1    EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  58

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F   HG GV+ VAL+V+D + A+S +V RGA
Sbjct  59   FVVSGTLNSDSRIA--------------EFVKIHGDGVKDVALLVDDVEKAYSEAVKRGA  104

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ G+E +D
Sbjct  105  VAIAPPEELTDEQGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGYEKID  153



>ref|WP_003205593.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus]
 gb|EEM13055.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides Rock3-17]
 gb|EEM18929.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus pseudomycoides 
DSM 12442]
 gb|AIK37583.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
 gb|KFN14696.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
 gb|AJI18127.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
Length=372

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F   HG GV+ VAL+V+D + A+S +V RGA
Sbjct  72   FVVSGTLNSDSRIA--------------EFVKIHGDGVKDVALLVDDVEKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ G+E +D
Sbjct  118  VAIAPPEELTDEQGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGYEKID  166



>ref|WP_016117024.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EOP61844.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD136]
 gb|EOP76842.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM006]
 gb|EOQ17961.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM021]
Length=372

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F   HG GV+ VAL+V+D + A+S +V RGA
Sbjct  72   FVVSGTLNSDSRIA--------------EFVKIHGDGVKDVALLVDDVEKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ G+E +D
Sbjct  118  VAIAPPEELTDEQGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGYEKID  166



>ref|WP_040930444.1| hypothetical protein [Prochloron didemni]
Length=403

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 23/183 (13%)
 Frame = +3

Query  63   LVGFKDFVRV--NPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  236
            LVG    V+   N + +  + + FHHVE W G+A   A  +S  +G+   A   L TG+ 
Sbjct  13   LVGLDAGVKYQKNSRPNFGAYQGFHHVEMWVGNAYQAALYYSTHMGLKPIAYKGLETGDR  72

Query  237  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  416
             +AS++LRA  GE+  + T+P     +                 F A HG  V  VA  V
Sbjct  73   QYASHVLRA--GEVTLVLTSPLKPGETKI-------------NQFLAQHGDAVYDVAFRV  117

Query  417  EDTQAAFSASVSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFL  587
            E+ +A +  +++ GAK +S P  L +   QV +A VH +G  V  F+          TFL
Sbjct  118  ENAKATYEHALAYGAKSISPPKILEDERGQVTVATVHAFGSTVHSFV---EKKDYQGTFL  174

Query  588  QGF  596
             G+
Sbjct  175  PGY  177



>ref|WP_025606603.1| 4-hydroxyphenylpyruvate dioxygenase [Pontibacter actiniarum]
Length=364

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 71/143 (50%), Gaps = 19/143 (13%)
 Frame = +3

Query  132  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  311
            ++EF+ G+A   A  +  A G  + A +   TG    ASY+L+    +++F+FT      
Sbjct  13   YIEFYVGNAKQAAHYYQTAFGFKLVAYAGPETGVRDRASYVLQQE--KIRFVFTTAINPD  70

Query  312  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  491
                            H+     HG GV+ +AL V+D + AF  +V RGAKP  EP T++
Sbjct  71   SDIARHV---------HQ-----HGDGVKVLALWVDDAEEAFRGTVERGAKPAMEPKTIS  116

Query  492  N---QVVLAEVHLYGDVVLRFIS  551
            +   +V LA +H YG+ +  F+ 
Sbjct  117  DEHGEVKLASIHTYGETIHTFVE  139



>ref|WP_028785141.1| 4-hydroxyphenylpyruvate dioxygenase [Thalassobacillus devorans]
Length=373

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 77/172 (45%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F VK   ++E++ G+A   A  F  A G    A S L TGN    SY+L+    +++
Sbjct  15   EDFFPVKEVDYLEYYTGNAKQAAHFFCTAFGFEPVAYSGLETGNRETVSYVLQQR--KVR  72

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             + T     S                   F   HG GV+ VAL V+D   A+  +VSRGA
Sbjct  73   IVVTGTLTESSRVA--------------EFTKKHGDGVKDVALTVDDVDKAYKEAVSRGA  118

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P T++++   V  A +  YGD +   +    D   V  F+ GF P D
Sbjct  119  IEITPPFTIDDEYGPVKKAVIGTYGDTIHTLVE-RKDYKGV--FMPGFLPAD  167



>gb|KIY94741.1| hypothetical protein MNEG_13223, partial [Monoraphidium neglectum]
Length=58

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  57   FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARR  176
             KLVG+  F R NPKSD F V RFHH+EFWC DATNT +R
Sbjct  19   LKLVGYDKFKRHNPKSDRFKVHRFHHIEFWCADATNTYKR  58



>ref|WP_034641974.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus manliponensis]
 gb|KEK18059.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus manliponensis]
Length=372

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 70/148 (47%), Gaps = 19/148 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   HVEF+ G+A   +  F+ A G  I A S L TGN    SY+L  S   ++
Sbjct  14   EDFFPVRDVDHVEFYVGNAKQASYYFARAFGFKIVAYSGLETGNREKVSYVL--SQKNMR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    +                    F   HG GV+ VAL+V+D + A+  +V RGA
Sbjct  72   FVISGTLNADTKVA--------------EFVKKHGDGVKDVALLVDDVEKAYGEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVV  536
              ++ P  L+++   +  A +  YGD +
Sbjct  118  VAIAPPKELSDEQGTLKTAIIGTYGDTI  145



>ref|WP_018479076.1| 4-hydroxyphenylpyruvate dioxygenase [Pontibacter roseus]
Length=364

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 22/160 (14%)
 Frame = +3

Query  132  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  311
            H+EF+ G+A   A  +  A G  + A +   TG    ASY+++    +++ + T     +
Sbjct  13   HIEFYVGNAKQAAHFYQTAFGFKLVAYAGPETGVRDRASYVVQQE--KIRLVLTTSLDPN  70

Query  312  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  491
                                   HG GV+ +AL V+D +A+F  +V RGAKP  EP TL 
Sbjct  71   SDIAQHVH--------------LHGDGVKVLALWVDDAEASFRGTVERGAKPALEPKTLT  116

Query  492  N---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEP  602
            +   +V +A +H YGD +  F+    + S V  F+ G+EP
Sbjct  117  DEHGEVKVASIHTYGDTIHTFVER-RNYSGV--FMPGYEP  153



>ref|WP_000810921.1| hypothetical protein, partial [Bacillus cereus]
Length=248

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSENRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +   +   A   F+ GF+ ++
Sbjct  118  VAIAPPQELTDEDGTLKKAVIGTYGDTIHTLVERKNYKGA---FMPGFQKVE  166



>ref|WP_041057061.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus campisalis]
 gb|KIL47474.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus campisalis]
Length=371

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 81/175 (46%), Gaps = 22/175 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            +D F VK   ++E + G+A  +A  F  A G  + A S L TGN    SY+L+ +  +++
Sbjct  13   NDFFPVKEVDYLEIYTGNAKQSAHFFCTAFGFKMVAYSGLETGNRETVSYVLQQN--KVR  70

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             + T     S                  +F   HG GVR +AL +++ ++A+  +VSRGA
Sbjct  71   LVITGSLTDSSDVA--------------AFVKKHGDGVRDIALTMDNVESAYKEAVSRGA  116

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGTA  617
              + +P  + +Q   V  A +  YGD +   +           FL GFEP + + 
Sbjct  117  IEIKKPFEVEDQYGIVKKAIIGTYGDTIHTMVERTGYKG---IFLPGFEPYESSV  168



>ref|WP_026581629.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. J33]
Length=371

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 78/178 (44%), Gaps = 22/178 (12%)
 Frame = +3

Query  84   VRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA  263
            ++V    D F VK   ++E + G+A  +   F  A G    A S L TGN    SY+L+ 
Sbjct  7    LKVQKTEDFFPVKEVDYLEIYSGNAKQSCHYFCTAFGFKPVAYSGLETGNRETVSYVLQQ  66

Query  264  SGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSA  443
               +++ + T     S                   F   HG GV+ +AL V+D + A+ A
Sbjct  67   R--KIRLVITGTLTDSSRVS--------------GFINKHGDGVKDIALTVDDVEKAYQA  110

Query  444  SVSRGAKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
            +VSRGA  +  P  + ++   V  A +  YGD +   I      +    FL G+EP +
Sbjct  111  AVSRGAIEIQPPYEMKDEHGIVKKAVIGTYGDTIHTLI---ERNNYKGVFLPGYEPYE  165



>ref|WP_000810925.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
Length=372

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 77/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++     A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLVRAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  163



>gb|EEM61947.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
monterrey BGSC 4AJ1]
Length=385

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 77/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++     A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLVRAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ PV L   N  +  A +  YGD +   +      +   TF+ GF+
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  176



>ref|WP_025151089.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. H1a]
Length=372

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHIEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_011983355.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cytotoxicus]
 gb|ABS20594.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cytotoxicus NVH 
391-98]
Length=372

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 75/169 (44%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   HVEF+ G+A   +   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHVEFYVGNAKQASYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F   HG GV+ VAL+V+D + A+S +V RGA
Sbjct  72   FVVSGALNSDNRIA--------------EFVKLHGDGVKDVALLVDDVEKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              +S P  L   N  +  A +  YGD +   +      +   TF+ G+E
Sbjct  118  VAISPPEELTDENGAIKKAVIGTYGDTIHTLVER---KNYKGTFMPGYE  163



>ref|WP_002113414.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJQ39468.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG5X1-1]
 gb|EJR01088.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MC67]
 gb|EJV58524.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG6O-2]
 gb|EOP02261.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MC118]
Length=372

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHIEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDGRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_026951577.1| 4-hydroxyphenylpyruvate dioxygenase [Algoriphagus mannitolivorans]
Length=364

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 82/170 (48%), Gaps = 22/170 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D   +    H+E + G+A  +A  + +A G  + A S   TG    ASY+L+    +++
Sbjct  3    EDFLPINGTDHIELYVGNAKQSALYYQYAFGFELIAYSGPETGVKDRASYVLKQD--KIR  60

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             + T+P +++                       HG GV+ +AL V+D + ++  + SRGA
Sbjct  61   LILTSPLSANHPIAEHI--------------QKHGDGVKVLALWVDDAEKSWKETTSRGA  106

Query  462  KPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEP  602
            K  SEP T  +   +V +A +H YGD +  F+    + S V  FL GF+P
Sbjct  107  KSASEPKTFQDEHGEVKMASIHTYGDTIHTFVE-RKNYSGV--FLPGFKP  153



>ref|WP_043930760.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. EB01]
Length=371

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 76/169 (45%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   ++E + G+A   A  F  A G    A S L TGN    SY+L+    +++
Sbjct  13   EDFFPVRDVDYMEIYTGNAKQAAYFFCKAFGFRTVAYSGLETGNRQTVSYVLQQR--KIR  70

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             + T  Y  +                  SF   HG GV+ +AL+V+D + AF A+V RGA
Sbjct  71   LVITGSYDENSDVA--------------SFVKKHGDGVKDIALLVDDVEKAFGAAVDRGA  116

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              +  P  LN++   V  A +  YGD V   I       A   FL GF+
Sbjct  117  IALEAPTVLNDEFGTVKKAVIGTYGDTVHSLIERQDYKGA---FLPGFD  162



>ref|WP_009194781.1| 4-hydroxyphenylpyruvate dioxygenase [Cesiribacter andamanensis]
 gb|EMR03448.1| 4-hydroxyphenylpyruvate dioxygenase [Cesiribacter andamanensis 
AMV16]
Length=364

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 74/154 (48%), Gaps = 19/154 (12%)
 Frame = +3

Query  99   KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  278
            + D   +    H+EFW G+A  +A  +  ALG  + A +   TG    ASY+L+ +  +L
Sbjct  2    EQDFLPINGTDHIEFWVGNAKQSAMYYMAALGFELVAYAGPETGQRDRASYVLQQN--KL  59

Query  279  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  458
            +F+ T+                            HG GV+ +AL V+D   ++  ++SRG
Sbjct  60   RFVLTSSLLPDTDIARHVY--------------QHGDGVKVLALWVDDAAKSYHETMSRG  105

Query  459  AKPVSEPVTLNN---QVVLAEVHLYGDVVLRFIS  551
            A+   EP TL +   ++V+A +  YGD + +F+ 
Sbjct  106  AESALEPQTLRDDSGELVVAAIKTYGDTIHKFVE  139



>ref|WP_014798570.1| 4-hydroxyphenylpyruvate dioxygenase [Flexibacter litoralis]
 gb|AFM05135.1| 4-hydroxyphenylpyruvate dioxygenase [Flexibacter litoralis DSM 
6794]
Length=365

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 83/171 (49%), Gaps = 22/171 (13%)
 Frame = +3

Query  99   KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  278
            + D   +K   H+EF+ G+A   A  +  A G  + A +   TG    +SY+L+   G++
Sbjct  3    QEDILPLKGTDHIEFYVGNAKQAAYYYQAAFGFEVVAYAGQETGVRDRSSYVLQQ--GKI  60

Query  279  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  458
            +F+ T+P +S                        HG GV+ +AL V+D + A+  ++ RG
Sbjct  61   RFVLTSPMSSDSPIAEHI--------------KKHGDGVKVLALWVDDAEKAYYDTMGRG  106

Query  459  AKPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEP  602
            AK   EP  L   N +VV++ +H YG  + +F+   +   A   F+ G++P
Sbjct  107  AKSALEPTRLSDENGEVVVSGIHTYGQTIHKFVERGNYTGA---FMPGYQP  154



>ref|WP_004428063.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus alcalophilus]
 gb|KGA98918.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus alcalophilus ATCC 
27647]
Length=373

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 75/173 (43%), Gaps = 22/173 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+ FHH+E + G+A  +A  F  A G  I A   L TG+    SY+L    G ++
Sbjct  14   EDIFPVESFHHLEIYVGNAKQSAYYFCQAFGFQIKAYRGLETGSREVVSYVLEQ--GAIR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             + +    +                    F   HG GV+ +AL V D   A+  ++ RG 
Sbjct  72   LILSGSLTADHEVS--------------KFVKLHGEGVKDIALKVSDVDKAYYGAIERGG  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDG  611
              + EP    ++   V  A +  YGD V   + Y  D   +  FL G++P +G
Sbjct  118  IAIKEPWIDKDESGYVKKAIIGTYGDTVHTLVEY-GDYQGL--FLPGYQPYEG  167



>ref|WP_044202951.1| 4-hydroxyphenylpyruvate dioxygenase [Flammeovirga sp. OC4]
Length=365

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 81/168 (48%), Gaps = 22/168 (13%)
 Frame = +3

Query  105  DHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQF  284
            D   +    H+EF+ G+A   A  +  A G  + A S   TG    +SY+L+   G+L+F
Sbjct  5    DFLPINGTDHIEFYVGNAKQAAYFYQAAFGFELLAYSGPETGVRDRSSYVLQQ--GKLRF  62

Query  285  LFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAK  464
            +FT   +S+                H+     HG GV+ +AL V+D + +F  +V RGA 
Sbjct  63   VFTTSLSSNSEISDHV---------HK-----HGDGVKVLALWVDDARKSFEETVKRGAI  108

Query  465  PVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
            PV  P  +++   +VV+A +  YGD V  F+      +   TFL  FE
Sbjct  109  PVHTPRVMSDESGEVVMATIKTYGDTVHTFVER---KNYKGTFLPKFE  153



>ref|WP_037994498.1| 4-hydroxyphenylpyruvate dioxygenase [Thermoactinomyces sp. Gus2-1]
 gb|KFZ40767.1| 4-hydroxyphenylpyruvate dioxygenase [Thermoactinomyces sp. Gus2-1]
Length=373

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 70/148 (47%), Gaps = 19/148 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
            SD F +    ++E++ G+A   A  F    G    A S L TGN    SYL+    G ++
Sbjct  14   SDFFPIHDVDYLEYYTGNARQAASYFCQTFGFRPVAYSGLETGNRETVSYLVEQ--GNVR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            FL T  Y+                    SF   HG GV+ +AL+V+D ++AF  +VSRG 
Sbjct  72   FLITGAYSPEHEIS--------------SFVRQHGDGVKDIALLVDDVESAFKEAVSRGG  117

Query  462  KPVSEPVTL-NNQVVL--AEVHLYGDVV  536
              + EP  L + Q VL  A +  YGD V
Sbjct  118  IAIKEPYELRDEQGVLKKAVIGTYGDTV  145



>ref|WP_002151375.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJQ72946.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuA4-10]
Length=372

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_002091386.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJP82364.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD142]
Length=372

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_002140158.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|ABY41487.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus weihenstephanensis 
KBAB4]
 gb|EJQ75308.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuA2-4]
 gb|EOO10879.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuA3-9]
 gb|EOO65845.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD021]
 dbj|GAE42774.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus weihenstephanensis 
NBRC 101238 = DSM 11821]
 gb|AIW88023.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus weihenstephanensis]
 gb|KIV72987.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
Length=372

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_007657880.1| 4-hydroxyphenylpyruvate dioxygenase [Pontibacter sp. BAB1700]
 gb|EJF09226.1| 4-hydroxyphenylpyruvate dioxygenase [Pontibacter sp. BAB1700]
Length=364

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = +3

Query  132  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  311
            H+EF+ G+A   A  +  A G  + A +   TG    ASY+L+    +++ + T     +
Sbjct  13   HIEFYVGNAKQAAHFYQTAFGFKLIAYAGPETGVRDRASYVLQQE--KIRLVLTTSLDPN  70

Query  312  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  491
                                   HG GV+ +AL V+D +A+F  +V RGAKP  EP TL 
Sbjct  71   SDIAQHVH--------------QHGDGVKVLALWVDDAEASFRGTVERGAKPAMEPKTLT  116

Query  492  N---QVVLAEVHLYGDVVLRFIS  551
            +   +V +A +H YGD +  F+ 
Sbjct  117  DEHGEVKVASIHTYGDTIHTFVE  139



>gb|EEL89883.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH1272]
 gb|EEL95663.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH1273]
Length=385

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  131  VAIAPPEELTDEDGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  179



>gb|EEM01328.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides DSM 2048]
Length=385

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDSRIA--------------DFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  131  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  179



>gb|EEL08156.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BDRD-ST196]
 gb|EEL72779.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH603]
Length=385

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  131  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  179



>ref|WP_000810911.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJS63651.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2X1-1]
 gb|EJS70402.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2X1-3]
Length=372

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 78/172 (45%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALGSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_002175349.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJR44382.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD107]
Length=372

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHIEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              +  P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIVPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_000810917.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|EJQ05296.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG3X2-1]
 gb|EJR97166.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM034]
 gb|EJS16914.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM062]
 gb|EJS48049.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG1X1-3]
 gb|EOO81278.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG1O-1]
 gb|EOP61967.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM053]
Length=372

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEDGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_012930763.1| 4-hydroxyphenylpyruvate dioxygenase [Spirosoma linguale]
 gb|ADB42279.1| 4-hydroxyphenylpyruvate dioxygenase [Spirosoma linguale DSM 74]
Length=377

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 81/164 (49%), Gaps = 22/164 (13%)
 Frame = +3

Query  132  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  311
            ++E + G+A  +A  F  A G    A + L+TG     SYL++   G+++ + T+P    
Sbjct  26   YLELYVGNARQSAHYFQTAFGFQPVAHAGLATGLRDRESYLVQQ--GKIRLVLTSPLHGD  83

Query  312  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  491
                             R  +  HG GVR VAL V+D + AF  +  RGAKP  EPV   
Sbjct  84   SEIG-------------RHIDQ-HGDGVRVVALWVDDARKAFDETTKRGAKPYMEPVREQ  129

Query  492  NQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGT  614
            +    VV + +H+YGD V  F+   +D + V  FL G++P + T
Sbjct  130  DDTGYVVRSGIHIYGDTVHVFVE-RNDYTGV--FLPGYQPWNPT  170



>ref|WP_007921180.1| 4-hydroxyphenylpyruvate dioxygenase [Ktedonobacter racemifer]
 gb|EFH82795.1| 4-hydroxyphenylpyruvate dioxygenase [Ktedonobacter racemifer 
DSM 44963]
Length=367

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 81/177 (46%), Gaps = 22/177 (12%)
 Frame = +3

Query  99   KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  278
            + D   ++ F ++E + GDA +T+  FS A G    A + L TG   H SY+L    G +
Sbjct  3    EQDFMPIQNFDYIEMYVGDARHTSYYFSQAWGFVPVAYAGLETGVRDHTSYVLEQ--GNI  60

Query  279  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  458
            + + TAP +                         HG GV+ VA  VE+ + A+  + SRG
Sbjct  61   RLVITAPLSPEGEIAEHVH--------------LHGDGVKDVAFRVENAEQAYREATSRG  106

Query  459  AKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMDGTAS  620
            A+ V EP    +    V LA +  YGD +  F+    D   +  FL GF+P++   S
Sbjct  107  AQGVLEPTERRDNYGSVKLAAIKTYGDTIHTFVER-QDYKGI--FLPGFKPLESNQS  160



>ref|WP_017154241.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. FJAT-13831]
Length=372

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 70/148 (47%), Gaps = 19/148 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F  THG GV+ VAL+V+D + A+S +V RGA
Sbjct  72   FVVSGTLNSESRIA--------------EFVKTHGDGVKDVALLVDDVEKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVV  536
              ++ P  L ++   +  A +  YGD +
Sbjct  118  VAIAPPEELTDEHGTLKKAVIGTYGDTI  145



>ref|WP_002124802.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|EJQ58964.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus CER074]
 gb|EJQ69070.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus CER057]
 gb|EJR25222.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD048]
 gb|EJR32688.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD078]
 gb|EJR96276.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM022]
 gb|EJV73442.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BtB2-4]
 gb|EOO42613.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM019]
 gb|EOP47603.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD146]
 gb|ETT73992.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus weihenstephanensis 
FSL H7-687]
 gb|AJH20958.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
Length=372

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------DFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_000810924.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EEL52435.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Rock3-44]
Length=372

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 70/148 (47%), Gaps = 19/148 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F  THG GV+ VAL+V+D + A+S +V RGA
Sbjct  72   FVVSGTLNSESRIA--------------EFVKTHGDGVKDVALLVDDVEKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVV  536
              ++ P  L ++   +  A +  YGD +
Sbjct  118  VAIAPPEELTDEHGTLKKAVIGTYGDTI  145



>ref|WP_026576504.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. UNC438CL73TsuS30]
Length=371

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 74/170 (44%), Gaps = 22/170 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   ++E + G+A      F  A G    A S L TGN    SY+L+     ++
Sbjct  13   DDFFPVRDVDYIEIYTGNAKQACHYFCTAFGFKPVAYSGLETGNRESVSYVLKQRN--IR  70

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
             + T  Y                      F   HG GVR VAL+V+D + A+SA+V RGA
Sbjct  71   LIITGSYTEDSRIA--------------QFVKKHGDGVRDVALLVDDVEKAYSAAVERGA  116

Query  462  KPVSEPVTLNNQV-VLAEVHL--YGDVVLRFISYLSDPSAVTTFLQGFEP  602
              +  P  + ++  VL +  L  YGD V   I      +    F+ GFEP
Sbjct  117  IAIIAPFEMKDEKGVLKKAVLGTYGDTVHTLI---ERKNYQGVFMPGFEP  163



>ref|WP_012793017.1| 4-hydroxyphenylpyruvate dioxygenase [Chitinophaga pinensis]
 gb|ACU62849.1| 4-hydroxyphenylpyruvate dioxygenase [Chitinophaga pinensis DSM 
2588]
Length=378

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 69/143 (48%), Gaps = 19/143 (13%)
 Frame = +3

Query  132  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  311
            +VEF+ G+A   A  +  A G    A +   TG    ASY+L  +  +L+F+ T P    
Sbjct  27   YVEFYVGNAKQAAHYYKTAFGFQSLAYAGPETGVKDRASYVLVQN--KLRFVLTTPLNPD  84

Query  312  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  491
                                   HG GV+ +AL V+D +AAF  +V RGAKP  EPVT  
Sbjct  85   NEIAQHIL--------------EHGDGVKVIALWVDDARAAFEETVKRGAKPYLEPVTEE  130

Query  492  NQ---VVLAEVHLYGDVVLRFIS  551
            ++   VV + +H+YGD V  F+ 
Sbjct  131  DEFGAVVRSGIHIYGDTVHLFVE  153



>ref|WP_000810912.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
Length=372

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 78/172 (45%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALGSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>ref|WP_000810910.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|EJQ33989.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG5O-1]
 gb|EJQ74397.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuB4-10]
 gb|EJQ94063.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuB5-5]
 gb|EJR56497.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD148]
 gb|EJS46496.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG1O-2]
 gb|EJV43466.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG4X2-1]
 gb|EJV44657.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG6O-1]
 gb|EJV91449.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuB2-9]
 gb|EOP31515.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD131]
 gb|EOP33350.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuA2-3]
 gb|EOP48602.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD214]
 gb|EPF08116.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2O-2]
Length=372

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALGSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  118  VAIAPPEELTDEDGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  166



>gb|EEK80866.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus R309803]
Length=385

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 78/172 (45%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALGSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L   N  +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  131  VAIAPPEELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  179



>ref|WP_042981475.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
 gb|KFM99862.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
Length=372

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 78/169 (46%), Gaps = 22/169 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGTLSSESRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFE  599
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+
Sbjct  118  VAIAPPEELTDEHGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQ  163



>ref|XP_004039245.1| hypothetical protein IMG5_030220 [Ichthyophthirius multifiliis]
 gb|EGR33941.1| hypothetical protein IMG5_030220 [Ichthyophthirius multifiliis]
Length=400

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 72/145 (50%), Gaps = 14/145 (10%)
 Frame = +3

Query  126  FHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapya  305
            F H+  W G+A   A  ++   G    A   L TG+    ++++R   G +   F++PY 
Sbjct  23   FDHLHLWVGNAKQAAGWYTTHFGFQYYAYKGLETGSRDVCTHVIRNHKG-VTLAFSSPYG  81

Query  306  ssisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVT  485
            +                 H+S    HG GVR VA  VE+  + ++ +V+RGAKPV EP T
Sbjct  82   NQNQEQIEMNQ-------HQSL---HGDGVRDVAFTVENCISIYNKAVTRGAKPVFEPKT  131

Query  486  LNNQ---VVLAEVHLYGDVVLRFIS  551
            L +Q   V++A VH YGD +  F+ 
Sbjct  132  LEDQYGKVIVASVHTYGDTIHTFVQ  156



>gb|EEL36476.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Rock3-28]
 gb|EEL60959.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Rock4-18]
 gb|AFU16351.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis MC28]
Length=385

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALGSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  131  VAIAPPEELTDEDGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  179



>gb|EEL24963.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Rock1-3]
 gb|EEL42347.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Rock3-29]
Length=385

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 22/172 (13%)
 Frame = +3

Query  102  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  281
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  282  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  461
            F+ +    S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALGSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  462  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLQGFEPMD  608
              ++ P  L ++   +  A +  YGD +   +      +   TF+ GF+ ++
Sbjct  131  VAIAPPEELTDEDGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVE  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380