BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN005D11

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              305   4e-98   Citrus sinensis [apfelsine]
ref|XP_011099674.1|  PREDICTED: amino acid permease 2-like              304   1e-97   Sesamum indicum [beniseed]
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   302   5e-97   Nelumbo nucifera [Indian lotus]
emb|CDY21569.1|  BnaC09g47230D                                          302   7e-97   Brassica napus [oilseed rape]
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   301   2e-96   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             300   2e-96   Citrus clementina [clementine]
ref|XP_007019168.1|  Amino acid permease isoform 2                      300   2e-96   Theobroma cacao [chocolate]
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        299   6e-96   Vitis vinifera
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    299   9e-96   Prunus mume [ume]
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             298   2e-95   Populus trichocarpa [western balsam poplar]
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              298   2e-95   Populus euphratica
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             298   3e-95   
ref|XP_011002450.1|  PREDICTED: amino acid permease 3-like              298   3e-95   Populus euphratica
gb|KHG20963.1|  Amino acid permease 3 -like protein                     298   3e-95   Gossypium arboreum [tree cotton]
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    298   3e-95   Prunus mume [ume]
ref|XP_007019167.1|  Amino acid permease isoform 1                      298   3e-95   
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             297   6e-95   
emb|CDX69918.1|  BnaA10g22670D                                          296   7e-95   
emb|CBI21586.3|  unnamed protein product                                294   1e-94   Vitis vinifera
ref|XP_002306650.2|  hypothetical protein POPTR_0005s20400g             296   1e-94   Populus trichocarpa [western balsam poplar]
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              296   1e-94   Populus euphratica
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              296   1e-94   
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    296   1e-94   Populus euphratica
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             296   1e-94   
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              295   4e-94   Pyrus x bretschneideri [bai li]
ref|XP_002520322.1|  amino acid transporter, putative                   295   4e-94   
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        295   4e-94   
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              294   5e-94   Cucumis melo [Oriental melon]
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   294   6e-94   Brassica rapa
emb|CAF22024.1|  amino acid permease                                    294   7e-94   Brassica napus [oilseed rape]
ref|XP_004142635.1|  PREDICTED: amino acid permease 3-like              293   1e-93   
ref|XP_011458812.1|  PREDICTED: amino acid permease 3-like isofor...    293   2e-93   Fragaria vesca subsp. vesca
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    292   3e-93   Populus euphratica
ref|XP_002520323.1|  amino acid transporter, putative                   292   5e-93   
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    291   6e-93   
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   291   8e-93   Camelina sativa [gold-of-pleasure]
ref|XP_010095435.1|  hypothetical protein L484_013392                   291   9e-93   
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like isofor...    291   1e-92   Fragaria vesca subsp. vesca
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             291   1e-92   Eutrema salsugineum [saltwater cress]
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              291   2e-92   Camelina sativa [gold-of-pleasure]
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        290   2e-92   Tarenaya hassleriana [spider flower]
emb|CDX81121.1|  BnaC03g03750D                                          290   2e-92   
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             290   2e-92   Citrus clementina [clementine]
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             290   3e-92   
gb|AAO40028.1|  amino acid transporter AAP2                             280   3e-92   Brassica napus [oilseed rape]
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              289   4e-92   Nelumbo nucifera [Indian lotus]
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             290   4e-92   
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              290   5e-92   Camelina sativa [gold-of-pleasure]
gb|AAM13223.1|  amino acid transporter AAP4                             288   6e-92   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201190.1|  amino acid permease 4                                 288   6e-92   Arabidopsis thaliana [mouse-ear cress]
emb|CAA54631.1|  amino acid transporter                                 288   7e-92   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   288   1e-91   
ref|NP_196484.1|  amino acid permease 2                                 289   1e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             287   2e-91   Capsella rubella
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             288   2e-91   Eutrema salsugineum [saltwater cress]
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              287   2e-91   Camelina sativa [gold-of-pleasure]
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             287   2e-91   Prunus persica
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              287   3e-91   Sesamum indicum [beniseed]
gb|AAM61320.1|  amino acid transporter AAP4                             286   3e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             286   4e-91   
gb|AFK34945.1|  unknown                                                 277   6e-91   Lotus japonicus
emb|CAN65437.1|  hypothetical protein VITISV_038918                     286   1e-90   Vitis vinifera
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        286   1e-90   Prunus mume [ume]
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        285   1e-90   Prunus mume [ume]
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        285   1e-90   Prunus mume [ume]
gb|AAM61227.1|  amino acid transport protein AAP2                       285   2e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   285   2e-90   Brassica rapa
emb|CDX78353.1|  BnaA03g02650D                                          285   2e-90   
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              285   2e-90   Camelina sativa [gold-of-pleasure]
emb|CDX88365.1|  BnaC06g38090D                                          285   3e-90   
emb|CDX88364.1|  BnaC06g38080D                                          284   3e-90   
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              285   3e-90   Prunus mume [ume]
gb|KJB59301.1|  hypothetical protein B456_009G248600                    284   4e-90   Gossypium raimondii
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   284   6e-90   Brassica rapa
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    283   7e-90   Arabis alpina [alpine rockcress]
ref|XP_006856752.1|  hypothetical protein AMTR_s00055p00034230          278   7e-90   
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             284   7e-90   Populus trichocarpa [western balsam poplar]
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             284   7e-90   Prunus persica
emb|CDX87522.1|  BnaA07g33510D                                          283   1e-89   
emb|CDY39844.1|  BnaC02g42740D                                          283   1e-89   Brassica napus [oilseed rape]
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   282   1e-89   Brassica rapa
gb|KJB75356.1|  hypothetical protein B456_012G038000                    284   1e-89   Gossypium raimondii
ref|XP_010537371.1|  PREDICTED: amino acid permease 3                   283   2e-89   Tarenaya hassleriana [spider flower]
emb|CDY31348.1|  BnaA02g33930D                                          282   2e-89   Brassica napus [oilseed rape]
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              283   2e-89   Populus euphratica
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             282   2e-89   Eutrema salsugineum [saltwater cress]
emb|CDP10973.1|  unnamed protein product                                282   2e-89   Coffea canephora [robusta coffee]
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             283   2e-89   
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    282   3e-89   Populus euphratica
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              282   4e-89   Eucalyptus grandis [rose gum]
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             282   5e-89   Capsella rubella
ref|NP_177862.1|  amino acid permease 3                                 281   5e-89   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62803.1|  amino acid carrier, putative                            281   5e-89   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32820.1|  hypothetical protein JCGZ_12112                         281   6e-89   Jatropha curcas
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        281   6e-89   Sesamum indicum [beniseed]
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   281   7e-89   Vitis vinifera
emb|CAN61092.1|  hypothetical protein VITISV_005276                     281   1e-88   Vitis vinifera
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    281   1e-88   Glycine max [soybeans]
ref|XP_006386355.1|  amino acid permease which transports basic a...    280   2e-88   Populus trichocarpa [western balsam poplar]
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              280   2e-88   Pyrus x bretschneideri [bai li]
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              280   3e-88   
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             280   3e-88   Phaseolus vulgaris [French bean]
ref|XP_006382883.1|  amino acid permease AAP1 family protein            280   4e-88   Populus trichocarpa [western balsam poplar]
gb|KJB16325.1|  hypothetical protein B456_002G223200                    279   4e-88   Gossypium raimondii
emb|CDY43761.1|  BnaA06g22970D                                          279   4e-88   Brassica napus [oilseed rape]
ref|XP_009150448.1|  PREDICTED: amino acid permease 4                   278   5e-88   Brassica rapa
ref|XP_004290905.1|  PREDICTED: amino acid permease 3-like              279   5e-88   Fragaria vesca subsp. vesca
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        279   6e-88   Sesamum indicum [beniseed]
emb|CDX84450.1|  BnaC03g50500D                                          278   6e-88   
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              278   8e-88   Elaeis guineensis
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             278   8e-88   
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                278   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              278   1e-87   Eucalyptus grandis [rose gum]
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                278   2e-87   Erythranthe guttata [common monkey flower]
gb|KHN44307.1|  Amino acid permease 3                                   277   2e-87   Glycine soja [wild soybean]
gb|KDP32819.1|  hypothetical protein JCGZ_12111                         277   3e-87   Jatropha curcas
gb|KJB33339.1|  hypothetical protein B456_006G007300                    277   3e-87   Gossypium raimondii
gb|KHG16478.1|  Amino acid permease 2 -like protein                     276   3e-87   Gossypium arboreum [tree cotton]
emb|CBI21597.3|  unnamed protein product                                272   4e-87   Vitis vinifera
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   276   5e-87   Glycine max [soybeans]
ref|XP_006383588.1|  hypothetical protein POPTR_0005s20390g             276   7e-87   Populus trichocarpa [western balsam poplar]
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              276   8e-87   Cucumis sativus [cucumbers]
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   276   8e-87   Phoenix dactylifera
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              276   9e-87   Phoenix dactylifera
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    276   1e-86   Populus euphratica
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    276   1e-86   Cicer arietinum [garbanzo]
ref|XP_010653015.1|  PREDICTED: amino acid permease 4-like              276   1e-86   
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              275   1e-86   Cucumis melo [Oriental melon]
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              275   2e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                275   2e-86   Erythranthe guttata [common monkey flower]
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              275   3e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003524313.1|  PREDICTED: amino acid permease 2-like              275   3e-86   Glycine max [soybeans]
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              275   4e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       273   8e-86   Cucumis sativus [cucumbers]
emb|CDO96925.1|  unnamed protein product                                274   9e-86   Coffea canephora [robusta coffee]
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              272   2e-85   Eucalyptus grandis [rose gum]
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              273   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    273   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              273   3e-85   Elaeis guineensis
gb|KCW70650.1|  hypothetical protein EUGRSUZ_F03824                     271   3e-85   Eucalyptus grandis [rose gum]
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    272   4e-85   Elaeis guineensis
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              271   4e-85   Populus euphratica
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              271   4e-85   Oryza brachyantha
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              271   6e-85   Eucalyptus grandis [rose gum]
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              271   6e-85   Nicotiana sylvestris
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    271   8e-85   Elaeis guineensis
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             271   8e-85   Phaseolus vulgaris [French bean]
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              271   8e-85   Phoenix dactylifera
gb|EEC81839.1|  hypothetical protein OsI_25597                          270   9e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              270   1e-84   Nicotiana tomentosiformis
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             270   1e-84   Capsella rubella
gb|EEE52230.1|  hypothetical protein OsJ_34158                          269   1e-84   Oryza sativa Japonica Group [Japonica rice]
emb|CAN77083.1|  hypothetical protein VITISV_003992                     272   2e-84   Vitis vinifera
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              270   2e-84   Populus euphratica
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    270   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH35329.1|  transmembrane amino acid transporter family protein     267   2e-84   Medicago truncatula
gb|KDP29639.1|  hypothetical protein JCGZ_18801                         270   2e-84   Jatropha curcas
ref|NP_001067425.1|  Os11g0195600                                       269   3e-84   
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    269   3e-84   Tarenaya hassleriana [spider flower]
gb|AAX56951.1|  amino acid transporter                                  269   4e-84   Pisum sativum [garden pea]
dbj|BAO45885.1|  amino acid permease                                    268   7e-84   Acacia mangium
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              268   7e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   268   8e-84   Tarenaya hassleriana [spider flower]
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              268   1e-83   Camelina sativa [gold-of-pleasure]
gb|KEH40510.1|  transmembrane amino acid transporter family protein     268   1e-83   Medicago truncatula
emb|CDY71454.1|  BnaAnng37520D                                          261   2e-83   Brassica napus [oilseed rape]
emb|CAC51425.1|  amino acid permease AAP4                               266   3e-83   Vicia faba var. minor [tick bean]
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              267   3e-83   Prunus mume [ume]
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              266   4e-83   
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   266   4e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006473027.1|  PREDICTED: amino acid permease 3-like              266   4e-83   
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              266   4e-83   Zea mays [maize]
ref|XP_004978920.1|  PREDICTED: amino acid permease 3-like              266   4e-83   
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          266   5e-83   Sorghum bicolor [broomcorn]
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              265   7e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006847199.1|  hypothetical protein AMTR_s00017p00252280          266   7e-83   Amborella trichopoda
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              266   9e-83   Eucalyptus grandis [rose gum]
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    265   9e-83   
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    265   1e-82   
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              265   1e-82   Solanum tuberosum [potatoes]
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              265   1e-82   Cucumis melo [Oriental melon]
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        264   2e-82   Glycine max [soybeans]
gb|EPS59884.1|  hypothetical protein M569_14923                         256   3e-82   Genlisea aurea
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             265   4e-82   Prunus persica
gb|AIL30502.1|  amino acid transporter                                  264   4e-82   Nicotiana tabacum [American tobacco]
gb|AIS71894.1|  amino acid transporter                                  264   4e-82   Nicotiana tabacum [American tobacco]
gb|AII99817.1|  amino acid transporter                                  263   7e-82   Nicotiana tabacum [American tobacco]
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              263   8e-82   Solanum tuberosum [potatoes]
gb|KEH35328.1|  transmembrane amino acid transporter family protein     263   9e-82   Medicago truncatula
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              263   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW56243.1|  hypothetical protein ZEAMMB73_107595                    255   1e-81   
ref|NP_001234606.1|  amino acid transporter                             262   1e-81   
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       262   1e-81   Solanum lycopersicum
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              263   1e-81   
gb|KEH35330.1|  transmembrane amino acid transporter family protein     262   1e-81   Medicago truncatula
ref|XP_004503904.1|  PREDICTED: amino acid permease 2-like              262   2e-81   Cicer arietinum [garbanzo]
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   262   3e-81   Vitis vinifera
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              261   3e-81   Nicotiana sylvestris
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    261   4e-81   
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    261   4e-81   Nicotiana tomentosiformis
ref|XP_004151465.1|  PREDICTED: amino acid permease 4-like              258   1e-80   
ref|NP_001233979.1|  amino acid transporter                             259   1e-80   Solanum lycopersicum
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                260   1e-80   Erythranthe guttata [common monkey flower]
gb|KJB15783.1|  hypothetical protein B456_002G196200                    260   2e-80   Gossypium raimondii
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              259   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004156002.1|  PREDICTED: amino acid permease 4-like              259   2e-80   
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              260   2e-80   Populus euphratica
ref|XP_004289864.1|  PREDICTED: amino acid permease 4-like              259   3e-80   Fragaria vesca subsp. vesca
gb|KHN19623.1|  Amino acid permease 3                                   258   3e-80   Glycine soja [wild soybean]
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    258   3e-80   Glycine max [soybeans]
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   259   4e-80   Brassica rapa
ref|XP_007224395.1|  hypothetical protein PRUPE_ppa021701mg             259   4e-80   Prunus persica
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              259   5e-80   
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              258   1e-79   
gb|EEC68963.1|  hypothetical protein OsI_37697                          257   1e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              257   1e-79   Prunus mume [ume]
ref|XP_004977213.1|  PREDICTED: amino acid permease 3-like              257   1e-79   Setaria italica
ref|XP_006422618.1|  hypothetical protein CICLE_v10028230mg             258   1e-79   Citrus clementina [clementine]
ref|XP_004977210.1|  PREDICTED: amino acid permease 3-like              257   1e-79   Setaria italica
gb|KDO68035.1|  hypothetical protein CISIN_1g010376mg                   258   1e-79   Citrus sinensis [apfelsine]
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              258   1e-79   Citrus sinensis [apfelsine]
ref|XP_003578826.1|  PREDICTED: amino acid permease 3-like              257   2e-79   Brachypodium distachyon [annual false brome]
emb|CDY36017.1|  BnaA08g04440D                                          257   2e-79   Brassica napus [oilseed rape]
dbj|BAK02045.1|  predicted protein                                      256   2e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG27248.1|  Amino acid permease 3 -like protein                     256   2e-79   Gossypium arboreum [tree cotton]
ref|XP_003578825.1|  PREDICTED: amino acid permease 4-like              256   2e-79   Brachypodium distachyon [annual false brome]
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    257   2e-79   
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              256   3e-79   Pyrus x bretschneideri [bai li]
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              256   3e-79   Cucumis melo [Oriental melon]
ref|XP_004977211.1|  PREDICTED: amino acid permease 3-like              256   3e-79   Setaria italica
ref|NP_001066316.1|  Os12g0181500                                       255   6e-79   
ref|XP_009604405.1|  PREDICTED: amino acid permease 4-like              256   7e-79   Nicotiana tomentosiformis
gb|EAY82481.1|  hypothetical protein OsI_37698                          255   7e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_004977212.1|  PREDICTED: amino acid permease 3-like              255   8e-79   Setaria italica
ref|XP_002442926.1|  hypothetical protein SORBIDRAFT_08g005000          255   1e-78   Sorghum bicolor [broomcorn]
ref|XP_003630316.1|  Amino acid permease                                254   1e-78   
ref|XP_002442925.1|  hypothetical protein SORBIDRAFT_08g004990          255   1e-78   Sorghum bicolor [broomcorn]
gb|AFW56244.1|  hypothetical protein ZEAMMB73_131551                    254   1e-78   
ref|XP_006578773.1|  PREDICTED: amino acid permease 3-like isofor...    255   1e-78   Glycine max [soybeans]
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              254   1e-78   Zea mays [maize]
ref|XP_007226332.1|  hypothetical protein PRUPE_ppa022253mg             254   2e-78   Prunus persica
ref|XP_010090330.1|  hypothetical protein L484_024995                   255   2e-78   Morus notabilis
gb|KHF99365.1|  Amino acid permease 2                                   249   2e-78   Gossypium arboreum [tree cotton]
dbj|BAK03497.1|  predicted protein                                      254   2e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006581782.1|  PREDICTED: amino acid permease 3-like isofor...    254   2e-78   Glycine max [soybeans]
ref|XP_006581783.1|  PREDICTED: amino acid permease 3-like isofor...    254   2e-78   Glycine max [soybeans]
ref|NP_001142349.1|  hypothetical protein                               254   2e-78   Zea mays [maize]
gb|AFW56242.1|  hypothetical protein ZEAMMB73_107595                    254   2e-78   
ref|NP_001066317.1|  Os12g0181600                                       253   3e-78   
ref|XP_002534252.1|  amino acid transporter, putative                   254   3e-78   
ref|NP_001045010.1|  Os01g0882800                                       254   3e-78   
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              253   4e-78   Brassica rapa
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              254   4e-78   Cicer arietinum [garbanzo]
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    253   5e-78   Brachypodium distachyon [annual false brome]
gb|KHN25477.1|  Amino acid permease 2                                   254   5e-78   Glycine soja [wild soybean]
ref|XP_003540867.1|  PREDICTED: amino acid permease 2                   254   5e-78   Glycine max [soybeans]
ref|XP_006578775.1|  PREDICTED: amino acid permease 3-like isofor...    253   6e-78   Glycine max [soybeans]
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          253   7e-78   
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             253   8e-78   Capsella rubella
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    252   2e-77   Brachypodium distachyon [annual false brome]
emb|CDY47793.1|  BnaC06g00580D                                          251   2e-77   Brassica napus [oilseed rape]
ref|XP_004144658.1|  PREDICTED: amino acid permease 4-like              251   2e-77   
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    253   2e-77   Nicotiana sylvestris
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          251   2e-77   
ref|XP_002442923.1|  hypothetical protein SORBIDRAFT_08g004960          251   2e-77   Sorghum bicolor [broomcorn]
ref|XP_006645132.1|  PREDICTED: amino acid permease 2-like              251   3e-77   Oryza brachyantha
ref|XP_009123048.1|  PREDICTED: amino acid permease 5                   251   3e-77   Brassica rapa
gb|KEH30491.1|  transmembrane amino acid transporter family protein     252   3e-77   Medicago truncatula
ref|XP_007137760.1|  hypothetical protein PHAVU_009G153600g             251   3e-77   Phaseolus vulgaris [French bean]
emb|CAA70778.1|  amino acid transporter                                 252   3e-77   Vicia faba [broad bean]
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             251   3e-77   Eutrema salsugineum [saltwater cress]
gb|KEH30492.1|  transmembrane amino acid transporter family protein     252   3e-77   Medicago truncatula
ref|XP_010266973.1|  PREDICTED: amino acid permease 3-like              251   3e-77   Nelumbo nucifera [Indian lotus]
gb|AFK37021.1|  unknown                                                 252   3e-77   Medicago truncatula
ref|XP_002441927.1|  hypothetical protein SORBIDRAFT_08g004980          251   4e-77   Sorghum bicolor [broomcorn]
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    251   6e-77   Setaria italica
ref|XP_006590854.1|  PREDICTED: amino acid permease 2-like              251   7e-77   Glycine max [soybeans]
gb|KCW44733.1|  hypothetical protein EUGRSUZ_L017182                    244   1e-76   Eucalyptus grandis [rose gum]
ref|XP_004502978.1|  PREDICTED: amino acid permease 2-like isofor...    249   2e-76   
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              249   2e-76   
dbj|BAJ86012.1|  predicted protein                                      249   3e-76   
gb|AFK39617.1|  unknown                                                 246   3e-76   
ref|NP_001045595.1|  Os02g0102200                                       249   3e-76   
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              248   4e-76   
gb|KHG27393.1|  Amino acid permease 6 -like protein                     240   4e-76   
gb|EAY84081.1|  hypothetical protein OsI_05462                          248   4e-76   
gb|EMS49682.1|  hypothetical protein TRIUR3_22806                       243   5e-76   
gb|AAK33098.1|  amino acid transporter                                  249   5e-76   
ref|XP_003602666.1|  Amino acid permease                                248   5e-76   
ref|XP_002893978.1|  hypothetical protein ARALYDRAFT_473798             247   1e-75   
ref|NP_175076.2|  amino acid permease 5                                 247   1e-75   
ref|NP_001055592.1|  Os05g0424000                                       247   1e-75   
emb|CAA54632.1|  amino acid permease                                    247   1e-75   
ref|XP_010527719.1|  PREDICTED: amino acid permease 5-like isofor...    248   1e-75   
gb|EMT14141.1|  hypothetical protein F775_19210                         244   1e-75   
gb|ABR18002.1|  unknown                                                 247   1e-75   
gb|AAF15945.1|AF061435_1  amino acid transporter b                      240   2e-75   
ref|XP_002442927.1|  hypothetical protein SORBIDRAFT_08g005010          248   2e-75   
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              246   2e-75   
ref|XP_003602669.1|  Amino acid permease                                246   2e-75   
ref|NP_001149036.1|  amino acid carrier                                 246   2e-75   
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           246   2e-75   
gb|AAD16014.1|  amino acid transporter                                  243   2e-75   
emb|CAA10608.1|  amino acid carrier                                     245   3e-75   
gb|AAX56952.1|  amino acid transporter                                  245   4e-75   
gb|KJB64023.1|  hypothetical protein B456_010G029800                    239   4e-75   
ref|XP_010051542.1|  PREDICTED: amino acid permease 3-like              245   4e-75   
dbj|BAK03421.1|  predicted protein                                      245   7e-75   
dbj|BAJ95327.1|  predicted protein                                      245   7e-75   
ref|XP_008674422.1|  PREDICTED: amino acid permease 3-like              245   7e-75   
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        244   1e-74   
ref|XP_010040981.1|  PREDICTED: amino acid permease 3-like              244   1e-74   
emb|CDM85443.1|  unnamed protein product                                244   2e-74   
gb|KJB64020.1|  hypothetical protein B456_010G029800                    238   2e-74   
ref|XP_006356925.1|  PREDICTED: amino acid permease 3-like              243   2e-74   
emb|CDM85442.1|  unnamed protein product                                243   3e-74   
gb|ABR16450.1|  unknown                                                 243   3e-74   
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              243   4e-74   
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             243   4e-74   
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             243   5e-74   
ref|NP_001140430.1|  hypothetical protein                               243   6e-74   
emb|CAC51423.1|  amino acid permease AAP1                               242   6e-74   
gb|AFK45667.1|  unknown                                                 236   7e-74   
ref|XP_006366236.1|  PREDICTED: amino acid permease 3-like              242   7e-74   
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             243   8e-74   
ref|XP_010500132.1|  PREDICTED: amino acid permease 5-like isofor...    242   9e-74   
emb|CDP00979.1|  unnamed protein product                                241   2e-73   
ref|XP_002510013.1|  amino acid transporter, putative                   241   2e-73   
gb|KDP41551.1|  hypothetical protein JCGZ_15958                         240   4e-73   
ref|XP_008663834.1|  PREDICTED: uncharacterized protein LOC103642302    251   4e-73   
gb|KDO81358.1|  hypothetical protein CISIN_1g011548mg                   234   5e-73   
ref|XP_004502977.1|  PREDICTED: amino acid permease 3-like              239   2e-72   
ref|XP_008789212.1|  PREDICTED: amino acid permease 8-like              239   2e-72   
gb|AAO40029.1|  amino acid transporter AAP4                             231   2e-72   
ref|XP_009335480.1|  PREDICTED: amino acid permease 6-like              238   2e-72   
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              239   2e-72   
gb|ACU18748.1|  unknown                                                 230   2e-72   
ref|XP_008339056.1|  PREDICTED: amino acid permease 6                   238   3e-72   
gb|AFW56250.1|  hypothetical protein ZEAMMB73_465553                    248   3e-72   
gb|KJB14684.1|  hypothetical protein B456_002G137400                    237   6e-72   
gb|KHG24473.1|  Amino acid permease 6 -like protein                     237   8e-72   
gb|KDO81357.1|  hypothetical protein CISIN_1g011548mg                   233   9e-72   
gb|KJB64021.1|  hypothetical protein B456_010G029800                    237   9e-72   
ref|XP_003588450.1|  Amino acid transporter                             236   1e-71   
ref|XP_008219593.1|  PREDICTED: amino acid permease 3-like              236   1e-71   
ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              236   1e-71   
gb|KJB58749.1|  hypothetical protein B456_009G224500                    238   1e-71   
ref|XP_010440833.1|  PREDICTED: amino acid permease 6-like              236   2e-71   
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              236   2e-71   
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   236   2e-71   
ref|XP_010482241.1|  PREDICTED: amino acid permease 6-like isofor...    236   2e-71   
gb|ACJ84392.1|  unknown                                                 233   2e-71   
gb|KJB64022.1|  hypothetical protein B456_010G029800                    237   2e-71   
ref|XP_002301129.2|  amino acid transport protein AAP2                  236   2e-71   
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             235   3e-71   
ref|XP_010051603.1|  PREDICTED: amino acid permease 3-like              236   3e-71   
tpg|DAA38913.1|  TPA: hypothetical protein ZEAMMB73_639977              234   4e-71   
ref|XP_004498452.1|  PREDICTED: amino acid permease 6-like              234   5e-71   
ref|XP_003523211.1|  PREDICTED: amino acid permease 2-like              235   5e-71   
gb|AAG50558.1|AC074228_13  amino acid permease, putative                235   5e-71   
ref|XP_008668462.1|  PREDICTED: uncharacterized protein LOC100383...    234   6e-71   
emb|CAA70968.2|  amino acid transporter                                 234   7e-71   
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              234   7e-71   
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             234   9e-71   
gb|ADB92670.1|  amino acid permease 6                                   234   1e-70   
ref|XP_010915382.1|  PREDICTED: amino acid permease 1-like              234   1e-70   
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              234   1e-70   
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   234   2e-70   
gb|KHN37208.1|  Amino acid permease 6                                   233   2e-70   
ref|XP_003526513.1|  PREDICTED: amino acid permease 6-like              233   2e-70   
ref|XP_003602671.1|  Amino acid permease                                233   2e-70   
gb|KHN09641.1|  Amino acid permease 2                                   233   2e-70   
emb|CAA70969.1|  amino acid transporter                                 230   3e-70   
gb|EMT28481.1|  hypothetical protein F775_18207                         232   3e-70   
gb|KEH36106.1|  transmembrane amino acid transporter family protein     230   3e-70   
ref|XP_003602670.1|  Amino acid permease                                233   3e-70   
ref|NP_176132.1|  amino acid permease 1                                 233   4e-70   
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   233   4e-70   
gb|AAB87674.1|  neutral amino acid transport system II                  233   4e-70   
ref|XP_004973184.1|  PREDICTED: amino acid permease 3-like              233   4e-70   
ref|XP_002865746.1|  hypothetical protein ARALYDRAFT_495022             233   4e-70   
ref|XP_004502980.1|  PREDICTED: amino acid permease 2-like isofor...    232   5e-70   
ref|XP_006472367.1|  PREDICTED: amino acid permease 6-like              232   6e-70   
ref|XP_006433701.1|  hypothetical protein CICLE_v10000981mg             232   6e-70   
gb|KDO81356.1|  hypothetical protein CISIN_1g011548mg                   232   6e-70   
gb|EAY82539.1|  hypothetical protein OsI_37761                          231   1e-69   
gb|KHN08198.1|  Amino acid permease 6                                   231   1e-69   
ref|NP_001242816.1|  uncharacterized protein LOC100777963               231   1e-69   
ref|XP_007018375.1|  Amino acid permease 6                              231   1e-69   
ref|XP_010250334.1|  PREDICTED: amino acid permease 4-like              233   1e-69   
ref|XP_007137276.1|  hypothetical protein PHAVU_009G113800g             231   1e-69   
emb|CAC51424.1|  amino acid permease AAP3                               231   1e-69   
ref|NP_001066354.2|  Os12g0195100                                       231   2e-69   
ref|XP_010104540.1|  hypothetical protein L484_025514                   231   2e-69   
ref|XP_010556498.1|  PREDICTED: amino acid permease 6                   231   2e-69   
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    230   2e-69   
emb|CDP00978.1|  unnamed protein product                                230   3e-69   
ref|XP_008678533.1|  PREDICTED: amino acid permease 4-like              230   3e-69   
gb|AFK42490.1|  unknown                                                 230   3e-69   
emb|CDY46779.1|  BnaCnng14480D                                          230   3e-69   
ref|XP_006280391.1|  hypothetical protein CARUB_v10026318mg             230   3e-69   
ref|XP_010470262.1|  PREDICTED: amino acid permease 1                   230   3e-69   
ref|XP_003603665.1|  Amino acid permease                                230   4e-69   
ref|XP_004501076.1|  PREDICTED: amino acid permease 6-like              230   4e-69   
ref|XP_003638241.1|  Amino acid permease                                233   4e-69   
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              230   4e-69   
gb|KHG12273.1|  Amino acid permease 6 -like protein                     229   4e-69   
ref|XP_004136237.1|  PREDICTED: amino acid permease 6-like              230   4e-69   
ref|XP_009127448.1|  PREDICTED: amino acid permease 6                   230   4e-69   
emb|CAD92450.1|  amino acid permease 6                                  230   4e-69   
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              229   6e-69   
gb|AES94687.2|  transmembrane amino acid transporter family protein     223   7e-69   
ref|XP_010458325.1|  PREDICTED: amino acid permease 8                   229   1e-68   
ref|XP_003550117.1|  PREDICTED: amino acid permease 6                   228   1e-68   
ref|XP_003577747.1|  PREDICTED: amino acid permease 3                   229   1e-68   
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              229   2e-68   
ref|XP_009138576.1|  PREDICTED: amino acid permease 1-like              228   2e-68   
emb|CDY04349.1|  BnaC04g18440D                                          228   3e-68   
ref|NP_172472.1|  amino acid permease 8                                 227   4e-68   
gb|KJB59872.1|  hypothetical protein B456_009G278100                    227   4e-68   
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              227   5e-68   
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   227   5e-68   
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             227   6e-68   
ref|XP_010240058.1|  PREDICTED: amino acid permease 3-like              227   6e-68   
emb|CDY60248.1|  BnaC01g42990D                                          227   8e-68   
emb|CDY44564.1|  BnaA01g21750D                                          227   9e-68   
ref|XP_002444093.1|  hypothetical protein SORBIDRAFT_07g007570          227   9e-68   
gb|EYU36417.1|  hypothetical protein MIMGU_mgv1a005426mg                226   1e-67   
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                226   1e-67   
emb|CDY53793.1|  BnaCnng25620D                                          226   1e-67   
ref|XP_004301080.1|  PREDICTED: amino acid permease 3-like              226   1e-67   
ref|XP_007161529.1|  hypothetical protein PHAVU_001G077000g             226   1e-67   
gb|KDO80519.1|  hypothetical protein CISIN_1g0115801mg                  215   2e-67   
gb|KCW68582.1|  hypothetical protein EUGRSUZ_F02192                     225   2e-67   
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             226   2e-67   
ref|XP_010051604.1|  PREDICTED: amino acid permease 3-like              224   2e-67   
gb|KDO80520.1|  hypothetical protein CISIN_1g0115801mg                  214   3e-67   
emb|CAD92449.1|  amino acid permease 1                                  225   3e-67   
ref|XP_010414737.1|  PREDICTED: amino acid permease 1-like              225   3e-67   
emb|CDY48843.1|  BnaA09g14700D                                          224   4e-67   
gb|ADE75660.1|  unknown                                                 225   5e-67   
ref|XP_002449171.1|  hypothetical protein SORBIDRAFT_05g005980          224   5e-67   
ref|XP_010064702.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    224   6e-67   
gb|ABE65611.1|  amino acid permease                                     215   6e-67   
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              224   6e-67   
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              224   7e-67   
emb|CDY04448.1|  BnaA03g59400D                                          226   7e-67   
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    224   7e-67   
ref|XP_010051607.1|  PREDICTED: amino acid permease 3-like              224   9e-67   
ref|NP_001233983.1|  amino acid transporter                             223   9e-67   
ref|XP_009113317.1|  PREDICTED: amino acid permease 1                   224   1e-66   
ref|XP_009381189.1|  PREDICTED: amino acid permease 3-like              223   1e-66   
emb|CDO97307.1|  unnamed protein product                                221   1e-66   
ref|XP_002889785.1|  hypothetical protein ARALYDRAFT_471112             223   2e-66   
emb|CAA92992.1|  amino acid carrier                                     217   2e-66   
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             223   3e-66   
ref|XP_010490519.1|  PREDICTED: amino acid permease 8-like              222   4e-66   
ref|XP_010051605.1|  PREDICTED: amino acid permease 3-like              222   4e-66   
ref|XP_010668714.1|  PREDICTED: amino acid permease 8-like              222   6e-66   
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             222   6e-66   
ref|NP_001170050.1|  uncharacterized protein LOC100383966               220   9e-66   
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   221   1e-65   
emb|CAH67344.1|  OSIGBa0130B08.4                                        221   1e-65   
gb|KFK43300.1|  hypothetical protein AALP_AA1G106400                    218   1e-65   
emb|CAE01664.2|  OSJNBa0084K20.15                                       221   2e-65   
ref|XP_002516531.1|  amino acid transporter, putative                   221   2e-65   
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              220   2e-65   
ref|XP_009148321.1|  PREDICTED: amino acid permease 8                   220   3e-65   
ref|XP_004290906.1|  PREDICTED: amino acid permease 3-like              219   4e-65   
emb|CDP08191.1|  unnamed protein product                                219   4e-65   
ref|XP_006306441.1|  hypothetical protein CARUB_v10012383mg             219   6e-65   
ref|XP_010668707.1|  PREDICTED: amino acid permease 8-like isofor...    214   1e-64   
ref|XP_002442913.1|  hypothetical protein SORBIDRAFT_08g004810          218   2e-64   
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              217   2e-64   
gb|KFK43301.1|  hypothetical protein AALP_AA1G106500                    217   2e-64   
ref|XP_006596180.1|  PREDICTED: amino acid permease 8-like isofor...    215   3e-64   
ref|XP_003560665.1|  PREDICTED: amino acid permease 1-like              217   3e-64   
ref|XP_002277844.1|  PREDICTED: amino acid permease 8-like              217   3e-64   
emb|CBI20574.3|  unnamed protein product                                217   3e-64   
ref|NP_199774.1|  amino acid permease 6                                 217   3e-64   
emb|CAN69378.1|  hypothetical protein VITISV_008204                     217   4e-64   
ref|XP_010268969.1|  PREDICTED: amino acid permease 6-like isofor...    214   4e-64   
ref|NP_001149517.1|  amino acid permease 1                              216   5e-64   
ref|XP_001784036.1|  predicted protein                                  216   5e-64   
ref|NP_001057853.1|  Os06g0556000                                       216   6e-64   
ref|XP_011078457.1|  PREDICTED: amino acid permease 6-like              216   7e-64   
dbj|BAK07020.1|  predicted protein                                      216   8e-64   
ref|XP_006417504.1|  hypothetical protein EUTSA_v10007516mg             216   8e-64   
ref|XP_003551130.1|  PREDICTED: amino acid permease 8-like isofor...    216   9e-64   
gb|KCW82236.1|  hypothetical protein EUGRSUZ_C03655                     214   2e-63   
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          216   2e-63   
ref|XP_003545599.1|  PREDICTED: amino acid permease 8-like isofor...    215   2e-63   
ref|XP_010268971.1|  PREDICTED: amino acid permease 6-like              214   2e-63   
ref|XP_004965607.1|  PREDICTED: amino acid permease 3-like              214   3e-63   
ref|XP_004965605.1|  PREDICTED: amino acid permease 6-like              215   3e-63   
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    215   3e-63   
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              214   4e-63   
gb|KCW62470.1|  hypothetical protein EUGRSUZ_H05110                     214   4e-63   
ref|XP_010268968.1|  PREDICTED: amino acid permease 6-like isofor...    214   4e-63   
gb|EMT20053.1|  hypothetical protein F775_19561                         214   4e-63   



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 158/190 (83%), Gaps = 1/190 (1%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MQMG++ AAT NH     VSID P   G K  DDDGR  RTGTVWTASAHIITAVIGSGV
Sbjct  1    MQMGDNIAAT-NHHQVFDVSIDVPSQNGSKCFDDDGRLNRTGTVWTASAHIITAVIGSGV  59

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGWVAGP+VM LFS + YYTS+LL DCYR  DPV GKR YTYMDAVRS LG
Sbjct  60   LSLAWAIAQLGWVAGPAVMFLFSFLTYYTSSLLTDCYRTADPVSGKRNYTYMDAVRSILG  119

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +VK CGLIQY NLFGIAIGYTIAASISMMAIKRSNCFHESGG NPCHMSSNPYMI FG
Sbjct  120  GAKVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFG  179

Query  581  IIEIILSQIP  610
            ++EI LSQIP
Sbjct  180  VMEIFLSQIP  189



>ref|XP_011099674.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
 ref|XP_011099676.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
Length=491

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 164/194 (85%), Gaps = 6/194 (3%)
 Frame = +2

Query  47   MGESAAATKNH------RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  208
            MGES A T +H           VS++ PP +  K +DDDGRPQRTGTVWTASAHIITAVI
Sbjct  1    MGESTATTNHHHHHHHGSQVFDVSVNVPPHFCSKVVDDDGRPQRTGTVWTASAHIITAVI  60

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWAI QLGW+AGP+VM +FS V+YYTSTLLADCYR+GD +FGKR YTYMDAVR
Sbjct  61   GSGVLSLAWAIAQLGWIAGPTVMFMFSFVIYYTSTLLADCYRSGDSLFGKRNYTYMDAVR  120

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            SNLGG +VKICG+IQY NLFG+AIGYTIAASISMMAIKRSNCFH SG K+PCHMSSNPYM
Sbjct  121  SNLGGSKVKICGIIQYLNLFGVAIGYTIAASISMMAIKRSNCFHASGEKDPCHMSSNPYM  180

Query  569  IAFGIIEIILSQIP  610
            IAFGI +I+ SQIP
Sbjct  181  IAFGITQILFSQIP  194



>ref|XP_010270272.1| PREDICTED: amino acid permease 3 [Nelumbo nucifera]
Length=483

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 161/190 (85%), Gaps = 3/190 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M MGE A  T+N+  HL  SID  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MTMGEDAV-TRNNNQHL--SIDMLPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  57

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGW+AGP+VM LFS V+YYTS+LL DCYR+GDPV GKR YTY DAVRSNLG
Sbjct  58   LSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLTDCYRSGDPVSGKRNYTYTDAVRSNLG  117

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +VKICG+IQY NLFG+AIGYTIAASISMMAIKRSNCFHESGG NPCH+SSNPYMI FG
Sbjct  118  GVKVKICGIIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESGGDNPCHISSNPYMIIFG  177

Query  581  IIEIILSQIP  610
            + EI+ SQIP
Sbjct  178  VTEILFSQIP  187



>emb|CDY21569.1| BnaC09g47230D [Brassica napus]
Length=485

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MG +AAA  +H+HH    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAANNHHQHHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDAVRS LGG+
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGF  120

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  587  EIILSQIP  610
            EI+LSQ+P
Sbjct  181  EILLSQVP  188



>ref|XP_010674405.1| PREDICTED: amino acid permease 4 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M MG+ AA   NH H   VS D       K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MTMGDGAAKINNH-HVFDVSFDVLGQNPSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  59

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGW+AGP+VM LFS V+YYTSTLLADCYR+GDP  GKR YTYMDAVRSNLG
Sbjct  60   LSLAWAIAQLGWIAGPAVMFLFSFVIYYTSTLLADCYRSGDPDSGKRNYTYMDAVRSNLG  119

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +VK CG+IQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGKNPCHMSSNPYMIAFG
Sbjct  120  GGKVKFCGMIQYLNLFGVAIGYTIAASISMMAIKRSNCFHDSGGKNPCHMSSNPYMIAFG  179

Query  581  IIEIILSQIP  610
            I EI+ SQIP
Sbjct  180  IAEILFSQIP  189



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MG++ AAT NH     VSID P   G K  DDDGR  RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGDNIAAT-NHHQVFDVSIDVPSQNGSKCFDDDGRLNRTGTVWTASAHIITAVIGSGVLS  59

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWAI QLGWVAGP+VM LFS + YYTS+LL DCYR  DPV GKR YTYMDAVRS LGG 
Sbjct  60   LAWAIAQLGWVAGPAVMFLFSFLTYYTSSLLTDCYRTADPVSGKRNYTYMDAVRSILGGA  119

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +VK CGLIQY NLFGIAIGYTIAASISMMAIKRSNCFHESGG NPCHMSSNPYMI FG++
Sbjct  120  KVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFGVM  179

Query  587  EIILSQIP  610
            EI LSQIP
Sbjct  180  EIFLSQIP  187



>ref|XP_007019168.1| Amino acid permease isoform 2 [Theobroma cacao]
 gb|EOY16393.1| Amino acid permease isoform 2 [Theobroma cacao]
Length=488

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  211
            M+M E+ A  KNH  H     +SID  P  G K  D+DGR +RTGTVWTASAHIITAVIG
Sbjct  1    MKMAENGAG-KNHLQHNQVFDLSIDVLPQGGSKCFDEDGRLKRTGTVWTASAHIITAVIG  59

Query  212  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRS  391
            SGVLSLAWA  QLGWVAGP+VM LFS V YYTSTLLA CYR+GDP+ GKR YTYMDAVRS
Sbjct  60   SGVLSLAWATAQLGWVAGPAVMFLFSFVTYYTSTLLAACYRSGDPINGKRNYTYMDAVRS  119

Query  392  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  571
            NLGG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCH++SNPYMI
Sbjct  120  NLGGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHLNSNPYMI  179

Query  572  AFGIIEIILSQIP  610
            AFGI+EII SQIP
Sbjct  180  AFGIVEIIFSQIP  192



>ref|XP_010652912.1| PREDICTED: amino acid permease 3 isoform X1 [Vitis vinifera]
Length=489

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 163/194 (84%), Gaps = 5/194 (3%)
 Frame = +2

Query  41   MQMGESAAATKNHRHH---LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVI  208
            MQMGE+AA TKNH HH     +SID  P     K  DDDGR +RTGTVWTASAHIITAVI
Sbjct  1    MQMGENAA-TKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVI  59

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKR YTYMDAVR
Sbjct  60   GSGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVR  119

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            SNLGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESG KNPCH+SS PYM
Sbjct  120  SNLGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYM  179

Query  569  IAFGIIEIILSQIP  610
            I FGI EI  SQIP
Sbjct  180  IMFGIAEIAFSQIP  193



>ref|XP_008219592.1| PREDICTED: amino acid permease 3-like isoform X2 [Prunus mume]
Length=487

 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGSG
Sbjct  1    MTMGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSG  60

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKR YTYMDAVRSNL
Sbjct  61   VLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNL  120

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIAF
Sbjct  121  GGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAF  180

Query  578  GIIEIILSQIP  610
            GI EII SQIP
Sbjct  181  GITEIIFSQIP  191



>ref|XP_006386354.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|ERP64151.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=487

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M MGE+ +A     H +  VSID  P  G K  DDDGRP+RTG VWTASAHIITAVIGSG
Sbjct  1    MTMGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGNVWTASAHIITAVIGSG  60

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKR YTYMDAVR+NL
Sbjct  61   VLSLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  120

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAF
Sbjct  121  GGGKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAF  180

Query  578  GIIEIILSQIP  610
            GI EI+LSQIP
Sbjct  181  GIAEILLSQIP  191



>ref|XP_011003418.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHR--HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            M+MGE+ A TKNH       VS+D  P    K  DDDGRP+RTG VWTASAH+ITAVIGS
Sbjct  1    MKMGENTA-TKNHLPPQAFSVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHVITAVIGS  59

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKR YTYMDAVR+N
Sbjct  60   GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRAN  119

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120  LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  575  FGIIEIILSQIP  610
            FGI EI+LSQIP
Sbjct  180  FGIAEILLSQIP  191



>ref|XP_006386360.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
 gb|ERP64157.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
Length=485

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            MGE+ +A     H +  VSID  P  G K  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKR YTYMDAVR+NLGG
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
             +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAFGI
Sbjct  121  GKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAFGI  180

Query  584  IEIILSQIP  610
             EI+LSQIP
Sbjct  181  AEILLSQIP  189



>ref|XP_011002450.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHR--HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            M+MGE+ A TKNH       VS+D  P    K  DDDGRP+RTG VWTASAH+ITAVIGS
Sbjct  1    MKMGENTA-TKNHLPPQAFSVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHVITAVIGS  59

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKR YTYMDAVR+N
Sbjct  60   GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRAN  119

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120  LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  575  FGIIEIILSQIP  610
            FGI EI+LSQIP
Sbjct  180  FGIAEILLSQIP  191



>gb|KHG20963.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=486

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 162/191 (85%), Gaps = 4/191 (2%)
 Frame = +2

Query  47   MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            MG+  AA +NH H+     +SID  P  G K  DDDGR +R+GTVWTASAHIITAVIGSG
Sbjct  1    MGDDGAA-RNHLHNNQVFDLSIDVLPQGGTKCYDDDGRLKRSGTVWTASAHIITAVIGSG  59

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA  QLGW+AGP VM+LFS V YYTSTLLA CYR+GDPV GKR YTYMDAVRSNL
Sbjct  60   VLSLAWATAQLGWIAGPIVMILFSFVTYYTSTLLAACYRSGDPVNGKRNYTYMDAVRSNL  119

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCHM+SNPYMIAF
Sbjct  120  GGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHMNSNPYMIAF  179

Query  578  GIIEIILSQIP  610
            GI+EII SQIP
Sbjct  180  GIVEIIFSQIP  190



>ref|XP_008219591.1| PREDICTED: amino acid permease 3-like isoform X1 [Prunus mume]
Length=488

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  44   QMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            +MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGSGV
Sbjct  3    KMGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSGV  62

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKR YTYMDAVRSNLG
Sbjct  63   LSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNLG  122

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIAFG
Sbjct  123  GAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAFG  182

Query  581  IIEIILSQIP  610
            I EII SQIP
Sbjct  183  ITEIIFSQIP  192



>ref|XP_007019167.1| Amino acid permease isoform 1 [Theobroma cacao]
 gb|EOY16392.1| Amino acid permease isoform 1 [Theobroma cacao]
Length=486

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 160/191 (84%), Gaps = 4/191 (2%)
 Frame = +2

Query  47   MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M E+ A  KNH  H     +SID  P  G K  D+DGR +RTGTVWTASAHIITAVIGSG
Sbjct  1    MAENGAG-KNHLQHNQVFDLSIDVLPQGGSKCFDEDGRLKRTGTVWTASAHIITAVIGSG  59

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA  QLGWVAGP+VM LFS V YYTSTLLA CYR+GDP+ GKR YTYMDAVRSNL
Sbjct  60   VLSLAWATAQLGWVAGPAVMFLFSFVTYYTSTLLAACYRSGDPINGKRNYTYMDAVRSNL  119

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCH++SNPYMIAF
Sbjct  120  GGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHLNSNPYMIAF  179

Query  578  GIIEIILSQIP  610
            GI+EII SQIP
Sbjct  180  GIVEIIFSQIP  190



>ref|XP_007222588.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
 gb|EMJ23787.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
Length=485

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGSGVL
Sbjct  1    MGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSGVL  60

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKR YTYMDAVRSNLGG
Sbjct  61   SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNLGG  120

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
             +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIAFGI
Sbjct  121  AKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAFGI  180

Query  584  IEIILSQIP  610
             EII SQIP
Sbjct  181  TEIIFSQIP  189



>emb|CDX69918.1| BnaA10g22670D [Brassica napus]
Length=485

 Score =   296 bits (759),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MG +AAA  +H  H    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAANNHHHGHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDAVRS LGG+
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGF  120

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  587  EIILSQIP  610
            EI+LSQ+P
Sbjct  181  EILLSQVP  188



>emb|CBI21586.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 161/192 (84%), Gaps = 5/192 (3%)
 Frame = +2

Query  47   MGESAAATKNHRHH---LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            MGE+AA TKNH HH     +SID  P     K  DDDGR +RTGTVWTASAHIITAVIGS
Sbjct  1    MGENAA-TKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIGS  59

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKR YTYMDAVRSN
Sbjct  60   GVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRSN  119

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESG KNPCH+SS PYMI 
Sbjct  120  LGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYMIM  179

Query  575  FGIIEIILSQIP  610
            FGI EI  SQIP
Sbjct  180  FGIAEIAFSQIP  191



>ref|XP_002306650.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
 gb|ABK95777.1| unknown [Populus trichocarpa]
 gb|EEE93646.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
Length=487

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHR--HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            M+MGE+ A TKNH      GVS+D  P    K  DDDGRP+RTG VWTASAHIITAVIGS
Sbjct  1    MKMGENTA-TKNHLPPQAFGVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHIITAVIGS  59

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDP  GKR YTYM+AVR+N
Sbjct  60   GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPDNGKRNYTYMEAVRAN  119

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120  LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  575  FGIIEIILSQIP  610
            FGI EI+LSQIP
Sbjct  180  FGIAEILLSQIP  191



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 161/197 (82%), Gaps = 7/197 (4%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHL-------GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIIT  199
            MQMGE+AA+   H +HL        +SID  P  G K  D+DGR +RTGT+WTASAHIIT
Sbjct  1    MQMGENAASKNCHNNHLHSHHQVFDISIDVLPQNGSKCFDEDGRLKRTGTLWTASAHIIT  60

Query  200  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMD  379
            AVIGSGVLSLAWA+ QLGWVAGP+VM LFS V YYTS+LL DCYR GDP  GKR YTYMD
Sbjct  61   AVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMD  120

Query  380  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  559
            AVRS LGG +VK+CG IQY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSN
Sbjct  121  AVRSILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHLSSN  180

Query  560  PYMIAFGIIEIILSQIP  610
            PYMI FGI EI+LSQIP
Sbjct  181  PYMIMFGITEILLSQIP  197



>ref|XP_008338673.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=489

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 158/193 (82%), Gaps = 3/193 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  211
            M MG++ A      HH      S+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIG
Sbjct  1    MTMGDNTATKNQQLHHHQVFDFSVDMPPQGGSKXFDDDGRLKRTGTVWTSSAHIITAVIG  60

Query  212  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRS  391
            SGVLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKR YTYMDAVRS
Sbjct  61   SGVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVXGKRNYTYMDAVRS  120

Query  392  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  571
            NLGG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPC ++SNPYMI
Sbjct  121  NLGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCRINSNPYMI  180

Query  572  AFGIIEIILSQIP  610
            AFG+ EII SQIP
Sbjct  181  AFGVTEIIFSQIP  193



>ref|XP_011027479.1| PREDICTED: amino acid permease 3-like isoform X2 [Populus euphratica]
Length=485

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            MGE+ +A     H +  VSID  P  G +  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAENQLPHQVFSVSIDTHPRSGSEWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKR YTYMDAVR+NLGG
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
             +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PCHM++ PYMIAFGI
Sbjct  121  GKVKICGYVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCHMNAYPYMIAFGI  180

Query  584  IEIILSQIP  610
             EI+LSQIP
Sbjct  181  AEILLSQIP  189



>ref|XP_002302223.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|EEE81496.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=485

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 161/189 (85%), Gaps = 1/189 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            MGE+ +A     H +  VSID  P  G K  DDDGRP+RTG VWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGNVWTASAHIITAVIGSGVL  60

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKR YTYMDAVR+NLGG
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
             +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAFGI
Sbjct  121  GKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAFGI  180

Query  584  IEIILSQIP  610
             EI+LSQIP
Sbjct  181  AEILLSQIP  189



>ref|XP_009339426.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009339427.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009342935.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=489

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 158/193 (82%), Gaps = 3/193 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  211
            M MG++ A      HH      S+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIG
Sbjct  1    MTMGDNTATKNQQLHHDQVFDFSVDMPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIG  60

Query  212  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRS  391
            SGVLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD + GKR YTYMDAVRS
Sbjct  61   SGVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSITGKRNYTYMDAVRS  120

Query  392  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  571
            NLGG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPC ++SNPYMI
Sbjct  121  NLGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCRINSNPYMI  180

Query  572  AFGIIEIILSQIP  610
            AFG+ EII SQIP
Sbjct  181  AFGVTEIIFSQIP  193



>ref|XP_002520322.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42108.1| amino acid transporter, putative [Ricinus communis]
Length=485

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = +2

Query  47   MGESAAATKNH--RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MGE+ A TKNH       V++D PP  G K  DDDG+ +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGENTA-TKNHFPPQVFSVNVDMPPQAGSKWYDDDGKLKRTGTVWTASAHIITAVIGSGV  59

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA+ QLGWVAGP+VM LFS V YYTSTLL+ CYR GDPV GKR YTYMDAVRSNLG
Sbjct  60   LSLAWAVAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRTGDPVNGKRNYTYMDAVRSNLG  119

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G + KICG +QY NL G+AIGYTIA+SISMMA+KRSNCFH+SGGKNPCHM++NPYMIAFG
Sbjct  120  GAKFKICGYVQYVNLIGVAIGYTIASSISMMAVKRSNCFHKSGGKNPCHMNANPYMIAFG  179

Query  581  IIEIILSQIP  610
            ++EII SQIP
Sbjct  180  VVEIIFSQIP  189



>ref|XP_002275881.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
 ref|XP_010652913.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
Length=487

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 161/192 (84%), Gaps = 5/192 (3%)
 Frame = +2

Query  47   MGESAAATKNHRHH---LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            MGE+AA TKNH HH     +SID  P     K  DDDGR +RTGTVWTASAHIITAVIGS
Sbjct  1    MGENAA-TKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIGS  59

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKR YTYMDAVRSN
Sbjct  60   GVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRSN  119

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESG KNPCH+SS PYMI 
Sbjct  120  LGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYMIM  179

Query  575  FGIIEIILSQIP  610
            FGI EI  SQIP
Sbjct  180  FGIAEIAFSQIP  191



>ref|XP_008444195.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=480

 Score =   294 bits (753),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 157/182 (86%), Gaps = 3/182 (2%)
 Frame = +2

Query  74   NHRHHLGVSIDAPPLYGF---KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  244
            N+ HH  ++I APP          DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA  
Sbjct  3    NNHHHHSLNISAPPHAAVGADTAFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATA  62

Query  245  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICG  424
            QLGWVAGP VM+LFS V YYTSTLLA CYR+GD V GKR YTYMDAVR+NLGG++VK+CG
Sbjct  63   QLGWVAGPVVMMLFSFVTYYTSTLLAACYRSGDSVNGKRNYTYMDAVRNNLGGFKVKLCG  122

Query  425  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  604
            L+QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCHM+SNPYMI+FGI+EI LSQ
Sbjct  123  LVQYVNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHMNSNPYMISFGIMEIFLSQ  182

Query  605  IP  610
            IP
Sbjct  183  IP  184



>ref|XP_009122500.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=485

 Score =   294 bits (753),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MG +AA   +H  H    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAVNNHHHGHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD + GKR YTYMDAVRS LGG+
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAISGKRNYTYMDAVRSILGGF  120

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  587  EIILSQIP  610
            EI+LSQ+P
Sbjct  181  EILLSQVP  188



>emb|CAF22024.1| amino acid permease [Brassica napus]
Length=487

 Score =   294 bits (753),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 161/190 (85%), Gaps = 2/190 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MGE+AAA  +H HH     DA  PP   FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANHHHHHHGHQVFDAYVPPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGWVAGP+VML+FS V  Y+STLL+DCYR GD V GKR YTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWVAGPAVMLVFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121  GFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  581  IIEIILSQIP  610
            + EI+LSQ+P
Sbjct  181  VTEILLSQVP  190



>ref|XP_004142635.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 ref|XP_004170719.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 gb|KGN54544.1| Amino acid permease [Cucumis sativus]
Length=480

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 157/182 (86%), Gaps = 3/182 (2%)
 Frame = +2

Query  74   NHRHHLGVSIDAPP---LYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  244
            N+ HH  ++I APP          DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA  
Sbjct  3    NNHHHHSLNISAPPHPASAADTAFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATA  62

Query  245  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICG  424
            QLGWVAGP VM+LFS V YYTSTLLA CYR+GD V GKR YTYMDAVR+NLGG++VK+CG
Sbjct  63   QLGWVAGPVVMMLFSFVTYYTSTLLAACYRSGDSVNGKRNYTYMDAVRNNLGGFKVKLCG  122

Query  425  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  604
            L+QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCHM+SNPYMI+FGI+EI LSQ
Sbjct  123  LVQYVNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHMNSNPYMISFGIMEIFLSQ  182

Query  605  IP  610
            IP
Sbjct  183  IP  184



>ref|XP_011458812.1| PREDICTED: amino acid permease 3-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M MG++      H     VS++ PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MTMGDNKNQMLQHNQVFDVSVNMPPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGWVAGP+VM LFS V YYTSTLL+ CYR+GD   GKR YTYMDAV+SNLG
Sbjct  61   LSLAWAIAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRSGDSDTGKRNYTYMDAVQSNLG  120

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +VKICG +QY NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCH++SNPYMIAFG
Sbjct  121  GVKVKICGYVQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHINSNPYMIAFG  180

Query  581  IIEIILSQIP  610
            I+EII SQIP
Sbjct  181  IVEIIFSQIP  190



>ref|XP_011027478.1| PREDICTED: amino acid permease 3-like isoform X1 [Populus euphratica]
Length=486

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 2/191 (1%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M MGE+ +A     H +  VSID  P  G K  D+D RP+RTGTVWTASAHIITAVIGSG
Sbjct  1    MTMGENTSAKNQLPHQIFSVSIDTNPQSG-KWFDEDHRPKRTGTVWTASAHIITAVIGSG  59

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKR YTYMDAVR+NL
Sbjct  60   VLSLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  119

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PCHM++ PYMIAF
Sbjct  120  GGGKVKICGYVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCHMNAYPYMIAF  179

Query  578  GIIEIILSQIP  610
            GI EI+LSQIP
Sbjct  180  GIAEILLSQIP  190



>ref|XP_002520323.1| amino acid transporter, putative [Ricinus communis]
 emb|CAA07563.1| amino acid carrier [Ricinus communis]
 gb|EEF42109.1| amino acid transporter, putative [Ricinus communis]
Length=486

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 163/190 (86%), Gaps = 3/190 (2%)
 Frame = +2

Query  47   MGESAAATKNHRHHL-GVSID-APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M E+ AA KNH H +  VSI+    + G K LDDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MVENTAA-KNHPHQVFDVSINMQTQVVGSKWLDDDGRTKRTGTVWTASAHIITAVIGSGV  59

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGW+AGP+VM LFS V YYTSTLL+ CYR+GDPV GKR YTYMDAVR+NLG
Sbjct  60   LSLAWAIAQLGWIAGPAVMFLFSLVTYYTSTLLSACYRSGDPVNGKRNYTYMDAVRTNLG  119

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +VK+CG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCH+++NPYMIAFG
Sbjct  120  GAKVKLCGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHINANPYMIAFG  179

Query  581  IIEIILSQIP  610
            I EII SQIP
Sbjct  180  IAEIIFSQIP  189



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   291 bits (746),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 159/190 (84%), Gaps = 3/190 (2%)
 Frame = +2

Query  47   MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MGE+AA TKNH +H    VS+  P   G +  DDDGR +RTGT+WTASAHIITAVIGSGV
Sbjct  1    MGENAA-TKNHDNHQVFDVSLGIPSKGGSECFDDDGRIKRTGTLWTASAHIITAVIGSGV  59

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGW+AGP+VM LFS V  YTS+LL DCYR GDPV GKR YTYMDAVRS LG
Sbjct  60   LSLAWAIAQLGWIAGPAVMFLFSLVTCYTSSLLTDCYRTGDPVSGKRNYTYMDAVRSILG  119

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            GY+VK CGLIQY NL GI++GYTIAAS+SMMAIKRSNCFHESGGKNPCHMSS PYMI FG
Sbjct  120  GYKVKACGLIQYLNLCGISVGYTIAASVSMMAIKRSNCFHESGGKNPCHMSSTPYMIMFG  179

Query  581  IIEIILSQIP  610
            + EI+LSQIP
Sbjct  180  VTEILLSQIP  189



>ref|XP_010452897.1| PREDICTED: amino acid permease 2 [Camelina sativa]
Length=493

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 159/196 (81%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AAA ++            +  S   PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANRHHHNHHHGHQVFDVASSDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  563  YMIAFGIIEIILSQIP  610
            YMI FG+ EI+LSQIP
Sbjct  181  YMIIFGVTEILLSQIP  196



>ref|XP_010095435.1| hypothetical protein L484_013392 [Morus notabilis]
 gb|EXB60127.1| hypothetical protein L484_013392 [Morus notabilis]
Length=482

 Score =   291 bits (745),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 154/188 (82%), Gaps = 3/188 (2%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MGE       HR    VS+D P   G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEQQL---QHRQVFDVSLDVPQQPGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  57

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWA  QLGW+AGP+VM LFS V YYTSTLL+ CYR GDPV GKR YTYMDAVRSNLGG 
Sbjct  58   LAWATAQLGWIAGPAVMFLFSFVTYYTSTLLSACYRTGDPVTGKRNYTYMDAVRSNLGGL  117

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +V+ICGL QY NLFG+AIGYTIA++ISMMAIKRSNCFH+SG K+PCHMSSNPYMIAFG+ 
Sbjct  118  RVRICGLFQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGRKDPCHMSSNPYMIAFGVT  177

Query  587  EIILSQIP  610
            EII SQIP
Sbjct  178  EIIFSQIP  185



>ref|XP_004290907.1| PREDICTED: amino acid permease 3-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=484

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MG++      H     VS++ PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGDNKNQMLQHNQVFDVSVNMPPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWAI QLGWVAGP+VM LFS V YYTSTLL+ CYR+GD   GKR YTYMDAV+SNLGG 
Sbjct  61   LAWAIAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRSGDSDTGKRNYTYMDAVQSNLGGV  120

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +VKICG +QY NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCH++SNPYMIAFGI+
Sbjct  121  KVKICGYVQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHINSNPYMIAFGIV  180

Query  587  EIILSQIP  610
            EII SQIP
Sbjct  181  EIIFSQIP  188



>ref|XP_006399392.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
 gb|ESQ40845.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
Length=492

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 163/195 (84%), Gaps = 7/195 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSI-DA------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  205
            MGE+AAA  +H HH G  + DA      PP   FK  DDDGR +RTGTVWTASAHI+TAV
Sbjct  1    MGETAAAKNHHHHHHGHQVFDAAIHDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIVTAV  60

Query  206  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAV  385
            IGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDAV
Sbjct  61   IGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAV  120

Query  386  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  565
            RS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPY
Sbjct  121  RSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPY  180

Query  566  MIAFGIIEIILSQIP  610
            MI FG+ EI+LSQIP
Sbjct  181  MIIFGVTEILLSQIP  195



>ref|XP_010491540.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 159/196 (81%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AAAT++            +  +   PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAATRHHHNHHHGHQVFDVASNEVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGW+AGP+VM+LFS V  Y+STLL+DCYR GD V GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  563  YMIAFGIIEIILSQIP  610
            YMI FG+ EI LSQ+P
Sbjct  181  YMIIFGVTEIFLSQVP  196



>ref|XP_010546306.1| PREDICTED: amino acid permease 4 isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW+AGP+VMLLFS 
Sbjct  10   PQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSF  69

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGIA+GYTI
Sbjct  70   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAVGYTI  129

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            AASISMMAIKRSNCFH+SGGKNPCHMSSNPYMI FG+ EI+LSQIP
Sbjct  130  AASISMMAIKRSNCFHKSGGKNPCHMSSNPYMIMFGLTEILLSQIP  175



>emb|CDX81121.1| BnaC03g03750D [Brassica napus]
Length=487

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 160/190 (84%), Gaps = 2/190 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANHHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121  GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  581  IIEIILSQIP  610
            + EI+LSQ+P
Sbjct  181  VTEILLSQVP  190



>ref|XP_006434261.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
 gb|ESR47501.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
Length=480

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 154/182 (85%), Gaps = 3/182 (2%)
 Frame = +2

Query  65   ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  244
            A KN      VS+   P  G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWA  
Sbjct  6    AAKNQHQVFDVSL---PESGPKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATA  62

Query  245  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICG  424
            QLGW+AGPSVM LFS V YYTSTLLA CYR+GDPV GKR YTY+DAVRSNLGG+QVKICG
Sbjct  63   QLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICG  122

Query  425  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  604
            L+QY NLFG+AIGYTIA+SISMMAI+RSNCFH  G KNPCHM+SNPYMIAFGI+EI+LSQ
Sbjct  123  LVQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQ  182

Query  605  IP  610
            IP
Sbjct  183  IP  184



>ref|XP_002302224.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
 gb|EEE81497.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
Length=485

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            MGE+ +A     H +  VSID  P  G +  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAENQLPHQVFSVSIDTNPRSGSEWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWAIGQLGW+AGP+VMLLFS V YYTSTLL+ CYR+GDP+ GKR YTYMD VR+NLG 
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSTLLSACYRSGDPITGKRNYTYMDVVRANLGD  120

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
             +VKICG + Y N FG+A GYTIA+SISMMAIKRSNCFH+SGGKNPC M++NPYMI FGI
Sbjct  121  VKVKICGFVLYLNPFGVATGYTIASSISMMAIKRSNCFHKSGGKNPCRMNANPYMIGFGI  180

Query  584  IEIILSQIP  610
             EI+LSQIP
Sbjct  181  TEILLSQIP  189



>gb|AAO40028.1| amino acid transporter AAP2 [Brassica napus]
Length=186

 Score =   280 bits (715),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  110  PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFS  289
            PP   FK  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VML+FS
Sbjct  5    PPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLVFS  64

Query  290  CVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYT  469
             V  Y+STLL+DCYR GD V GKR YTYM AVRS LGG++ KICGLIQY NLFGIA+GYT
Sbjct  65   LVTLYSSTLLSDCYRTGDAVSGKRNYTYMGAVRSILGGFKFKICGLIQYLNLFGIAVGYT  124

Query  470  IAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            IAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ EI+LSQ+P
Sbjct  125  IAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTEILLSQVP  171



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
             +    +SID  P  G +  DDDGR +RTGT WTASAHI+TAVIGSGVLSLAWAI QLGW
Sbjct  3    EKQVFDLSIDVSPQGGSECFDDDGRLKRTGTFWTASAHIVTAVIGSGVLSLAWAIAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            +AGP++M+LFS V+YYTS+LLADCYR+GDPV GKR YTYMDAVRSNLGG +VKICG+IQY
Sbjct  63   IAGPAMMILFSFVIYYTSSLLADCYRSGDPVSGKRNYTYMDAVRSNLGGVKVKICGVIQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
             NLFG++IGYTIAASISMMAI+RSNCFHESGGKN CH+SSNPYMI FG+ EI+LSQIP
Sbjct  123  LNLFGVSIGYTIAASISMMAIRRSNCFHESGGKNSCHVSSNPYMIIFGVTEILLSQIP  180



>ref|XP_002871360.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47619.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 158/196 (81%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AAA  +            +      PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANNHRHHHHHGHQVFDVASHDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  563  YMIAFGIIEIILSQIP  610
            YMIAFG+ EI+LSQ+P
Sbjct  181  YMIAFGVAEILLSQVP  196



>ref|XP_010423021.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 158/196 (81%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AAA ++            +  +   PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANRHHHTHHHGHQVFDVASNDAVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  563  YMIAFGIIEIILSQIP  610
            YMI FG+ EI+ SQIP
Sbjct  181  YMIIFGVTEILFSQIP  196



>gb|AAM13223.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AAO30058.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>ref|NP_201190.1| amino acid permease 4 [Arabidopsis thaliana]
 sp|Q9FN04.1|AAP4_ARATH RecName: Full=Amino acid permease 4; AltName: Full=Amino acid 
transporter AAP4 [Arabidopsis thaliana]
 dbj|BAB11033.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AED97804.1| amino acid permease 4 [Arabidopsis thaliana]
Length=466

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>emb|CAA54631.1| amino acid transporter [Arabidopsis thaliana]
Length=466

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>ref|XP_010484145.1| PREDICTED: amino acid permease 4 [Camelina sativa]
Length=466

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>ref|NP_196484.1| amino acid permease 2 [Arabidopsis thaliana]
 sp|Q38967.1|AAP2_ARATH RecName: Full=Amino acid permease 2; AltName: Full=Amino acid 
transporter AAP2 [Arabidopsis thaliana]
 emb|CAA50672.1| amine acid permease [Arabidopsis thaliana]
 emb|CAC05448.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
 gb|AAL91247.1| AT5g09220/T5E8_20 [Arabidopsis thaliana]
 gb|AED91352.1| amino acid permease 2 [Arabidopsis thaliana]
Length=493

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 157/196 (80%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AAA  +            +      PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANNHRHHHHHGHQVFDVASHDFVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  563  YMIAFGIIEIILSQIP  610
            YMI FG+ EI+LSQ+P
Sbjct  181  YMIVFGVAEILLSQVP  196



>ref|XP_006279782.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
 gb|EOA12680.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
Length=466

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PQPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMILFGVTEILLSQI  168



>ref|XP_006390096.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
 gb|ESQ27382.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
Length=476

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +2

Query  74   NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  253
            NH      ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  2    NHNQQAAFAVDMPQPGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLG  61

Query  254  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQ  433
            W+AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKR YTYMDAVRSNLGG +VK+CG++Q
Sbjct  62   WLAGPVVMLLFSVVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQ  121

Query  434  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            Y NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP
Sbjct  122  YLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIP  180



>ref|XP_010444306.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFG+ IGYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGVTIGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>ref|XP_007213109.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
 gb|EMJ14308.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
Length=480

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +2

Query  65   ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  241
            +  N++    +SID  P + G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2    SENNNQQVFDISIDVVPKINGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  242  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKIC  421
             QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKR YTY+DAVRS LGG +VK C
Sbjct  62   AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122  GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  602  QIP  610
            QIP
Sbjct  182  QIP  184



>ref|XP_011074825.1| PREDICTED: amino acid permease 3-like [Sesamum indicum]
Length=484

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            M ESA + + H     +S++ P   G K  DDDGR +R+GT+WTASAHIITAVIGSGVLS
Sbjct  1    MSESAGSRQAHNQVFDISVNVPNQGGSKCFDDDGRLKRSGTLWTASAHIITAVIGSGVLS  60

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWA  QLGWVAGPSVM +FS V YYTSTLLA CYR+GDP  GKR YTYMDAVR+NLGG+
Sbjct  61   LAWATAQLGWVAGPSVMFMFSIVTYYTSTLLAACYRSGDPDTGKRNYTYMDAVRANLGGF  120

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            QVK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG++
Sbjct  121  QVKLCGAIQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDDSPCRVSSNPYMIAFGVV  180

Query  587  EIILSQIP  610
            EIILSQIP
Sbjct  181  EIILSQIP  188



>gb|AAM61320.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMXLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>ref|XP_002864872.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41131.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GT+WTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTIWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>gb|AFK34945.1| unknown [Lotus japonicus]
Length=213

 Score =   277 bits (709),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 153/191 (80%), Gaps = 1/191 (1%)
 Frame = +2

Query  41   MQMGESAAATKNHRHH-LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M+M E   +  NH H    VS+D     G K  DDDGR +RTG VWTASAHIITAVIGSG
Sbjct  1    MKMNEKNGSKNNHHHQAFDVSLDMQQQGGSKCFDDDGRLKRTGAVWTASAHIITAVIGSG  60

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAW I QLGWVAGP+VM+LFS V YYTS LL  CYR GDPV GKR YTYMD V SN+
Sbjct  61   VLSLAWTIAQLGWVAGPAVMILFSLVTYYTSILLCACYRNGDPVNGKRNYTYMDVVHSNM  120

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG QVK+CG++QY NLFG+AIGYTIA+SISM+AI+RSNCFH++ GK+PCHM+ N YMI+F
Sbjct  121  GGIQVKLCGIVQYLNLFGVAIGYTIASSISMIAIERSNCFHKNEGKDPCHMNGNIYMISF  180

Query  578  GIIEIILSQIP  610
            G++EI+LSQIP
Sbjct  181  GLVEIVLSQIP  191



>emb|CAN65437.1| hypothetical protein VITISV_038918 [Vitis vinifera]
Length=487

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 160/193 (83%), Gaps = 6/193 (3%)
 Frame = +2

Query  47   MGESAAATKNHR----HHLGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIG  211
            MGE+AA TKNH         +SID  P     K  DDDGR +RTGTVWTASAHIITAVIG
Sbjct  1    MGENAA-TKNHHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIG  59

Query  212  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRS  391
            SGVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKR YTYMDAVRS
Sbjct  60   SGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRS  119

Query  392  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  571
            NLGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESGGKNPCH+SS PYMI
Sbjct  120  NLGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGGKNPCHISSYPYMI  179

Query  572  AFGIIEIILSQIP  610
             FGI EI  SQIP
Sbjct  180  MFGIAEIAFSQIP  192



>ref|XP_008227519.1| PREDICTED: amino acid permease 4 isoform X2 [Prunus mume]
Length=482

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = +2

Query  65   ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  241
            +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2    SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  242  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKIC  421
             QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKR YTY+DAVRS LGG +VK C
Sbjct  62   AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122  GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  602  QIP  610
            QIP
Sbjct  182  QIP  184



>ref|XP_008227520.1| PREDICTED: amino acid permease 4 isoform X3 [Prunus mume]
Length=481

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = +2

Query  65   ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  241
            +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2    SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  242  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKIC  421
             QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKR YTY+DAVRS LGG +VK C
Sbjct  62   AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122  GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  602  QIP  610
            QIP
Sbjct  182  QIP  184



>ref|XP_008227518.1| PREDICTED: amino acid permease 4 isoform X1 [Prunus mume]
Length=480

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = +2

Query  65   ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  241
            +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2    SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  242  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKIC  421
             QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKR YTY+DAVRS LGG +VK C
Sbjct  62   AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122  GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  602  QIP  610
            QIP
Sbjct  182  QIP  184



>gb|AAM61227.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
Length=493

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 156/196 (80%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AAA  +            +      PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANNHRHHHHHGHQVFDVASHDFVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            VRS LGG++ KICGLIQY NLF IAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFVIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  563  YMIAFGIIEIILSQIP  610
            YMI FG+ EI+LSQ+P
Sbjct  181  YMIVFGVAEILLSQVP  196



>ref|XP_009131105.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=487

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 160/190 (84%), Gaps = 2/190 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANNHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121  GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  581  IIEIILSQIP  610
            + EI+LSQ+P
Sbjct  181  VTEILLSQVP  190



>emb|CDX78353.1| BnaA03g02650D [Brassica napus]
Length=487

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 160/190 (84%), Gaps = 2/190 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANNHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121  GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  581  IIEIILSQIP  610
            + EI+LSQ+P
Sbjct  181  VTEILLSQVP  190



>ref|XP_010461080.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDG+ +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP VM LFS 
Sbjct  4    PRPAFKCFDDDGKLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPVVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY STLL+DCYR GDPV GKR YTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64   VTYYCSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>emb|CDX88365.1| BnaC06g38090D [Brassica napus]
Length=476

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
                   S+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNQQEAFSVDMPRTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKR YTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIP  180



>emb|CDX88364.1| BnaC06g38080D [Brassica napus]
Length=476

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
                   S+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNQQEAFSVDMPRTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKR YTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIP  180



>ref|XP_008219594.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=484

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 155/189 (82%), Gaps = 3/189 (2%)
 Frame = +2

Query  44   QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            +MG++     NH     VS+D PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL
Sbjct  3    KMGDNQL---NHHQVFDVSVDVPPEGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWA  QLGWVAGPSVMLLFS V YYTSTLLA CYR GDP+ GKR YTY DAVRSNLGG
Sbjct  60   SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLAACYRTGDPLTGKRNYTYTDAVRSNLGG  119

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
            ++ KICG +QY NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFGI
Sbjct  120  FKEKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGI  179

Query  584  IEIILSQIP  610
             EII SQIP
Sbjct  180  AEIIFSQIP  188



>gb|KJB59301.1| hypothetical protein B456_009G248600 [Gossypium raimondii]
Length=468

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  104  DAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLL  283
            +  P  G K  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWA  QLGWVAGP VM+L
Sbjct  4    EVLPQGGTKCYDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPLVMIL  63

Query  284  FSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIG  463
            FS V Y+TSTLLA CYR+GDPV GKR YTYMDAVRSNLGG++VKICG +QY NLFG+AIG
Sbjct  64   FSFVTYFTSTLLAACYRSGDPVNGKRNYTYMDAVRSNLGGFKVKICGWVQYLNLFGVAIG  123

Query  464  YTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            YTIA+SISMMAIKRSNCFH SGGKNPCHM+SNPYMIAFGI+EII SQIP
Sbjct  124  YTIASSISMMAIKRSNCFHASGGKNPCHMNSNPYMIAFGIVEIIFSQIP  172



>ref|XP_009106399.1| PREDICTED: amino acid permease 3 [Brassica rapa]
Length=476

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
                   ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNQQEAFAVDMPQTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKR YTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIP  180



>gb|KFK42132.1| hypothetical protein AALP_AA2G215300 [Arabis alpina]
Length=476

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
            H      ++D P     K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    HNKQTSFAVDLPQTGDSKCYDDDGRTKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKR YTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIP  180



>ref|XP_006856752.1| hypothetical protein AMTR_s00055p00034230 [Amborella trichopoda]
 gb|ERN18219.1| hypothetical protein AMTR_s00055p00034230 [Amborella trichopoda]
Length=305

 Score =   278 bits (711),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
            +  + V  D P     KGLDDDGRP+RTG VWT+S+HIITAVIGSGVLSLAWAI QLGW+
Sbjct  20   QQQIDVEQDTPQPGYLKGLDDDGRPKRTGNVWTSSSHIITAVIGSGVLSLAWAIAQLGWI  79

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP+VM+LF+ V +YTS LLA CYR+GDP+ GKR YTYMDAVR+NLGG +VK+CG IQY 
Sbjct  80   AGPAVMVLFALVNFYTSNLLAGCYRSGDPISGKRNYTYMDAVRANLGGSKVKLCGAIQYI  139

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NL G+AIGYTIAASISMMAIKRSNCFH S GK+PCHMSSN YMI FG+ EI  SQIP
Sbjct  140  NLLGVAIGYTIAASISMMAIKRSNCFHRSKGKDPCHMSSNGYMIMFGVTEIFFSQIP  196



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   284 bits (726),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 159/198 (80%), Gaps = 8/198 (4%)
 Frame = +2

Query  41   MQMGESAAA--------TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  196
            MQMGE+AA+          NH     VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1    MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCFDDDGRLKRTGTLWTASSHII  60

Query  197  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYM  376
            TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  GKR YTYM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYM  120

Query  377  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  556
            DAV+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121  DAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  180

Query  557  NPYMIAFGIIEIILSQIP  610
            NPYMI FGI EI+LSQIP
Sbjct  181  NPYMIIFGITEILLSQIP  198



>ref|XP_007222611.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
 gb|EMJ23810.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
Length=484

 Score =   284 bits (726),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 154/189 (81%), Gaps = 3/189 (2%)
 Frame = +2

Query  44   QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            +MG++      H     VS+D PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL
Sbjct  3    KMGDNQL---THHQVFDVSVDVPPEGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWA  QLGWVAGPSVMLLFS V YYTSTLLA CYR GDPV GKR YTY DAVRSNLGG
Sbjct  60   SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLAACYRTGDPVTGKRNYTYTDAVRSNLGG  119

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
            ++ KICG +QY NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFGI
Sbjct  120  FKEKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGI  179

Query  584  IEIILSQIP  610
             EII SQIP
Sbjct  180  AEIIFSQIP  188



>emb|CDX87522.1| BnaA07g33510D [Brassica napus]
Length=476

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
                   ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNQQEAFAVDMPQSGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKR YTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIP  180



>emb|CDY39844.1| BnaC02g42740D [Brassica napus]
Length=466

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  122  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  301
             FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7    AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  302  YTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  481
            ++STLL+DCYR GDPV GKR YTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67   FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  482  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  127  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>ref|XP_009130275.1| PREDICTED: amino acid permease 4 [Brassica rapa]
 ref|XP_009130276.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  122  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  301
             FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7    AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  302  YTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  481
            ++STLL+DCYR GDPV GKR YTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67   FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  482  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  127  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>gb|KJB75356.1| hypothetical protein B456_012G038000 [Gossypium raimondii]
Length=519

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 156/191 (82%), Gaps = 6/191 (3%)
 Frame = +2

Query  38   IMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            + +MG+      N R    VS+  P     + +DDDGR +RTGT+ TA+AHIITAVIGSG
Sbjct  38   VAEMGD------NQRQVFDVSMAIPSHNVSECVDDDGRLKRTGTICTATAHIITAVIGSG  91

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWAI QLGW+AGP+VMLLFS V YYTS+LL DCYR GDPV GKR YTY DAVRS L
Sbjct  92   VLSLAWAIAQLGWIAGPAVMLLFSFVTYYTSSLLTDCYRTGDPVSGKRNYTYTDAVRSIL  151

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GGY+VK CGLIQY NLFGI+IGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI F
Sbjct  152  GGYKVKACGLIQYLNLFGISIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMF  211

Query  578  GIIEIILSQIP  610
            G+ EI+LSQIP
Sbjct  212  GVTEILLSQIP  222



>ref|XP_010537371.1| PREDICTED: amino acid permease 3 [Tarenaya hassleriana]
Length=480

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 1/182 (1%)
 Frame = +2

Query  65   ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  244
            + K+H      ++D PP  G +  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  
Sbjct  4    SAKSHDRQ-AFAVDMPPSGGSEIFDDDGRHKRTGSVWTASAHIITAVIGSGVLSLAWATA  62

Query  245  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICG  424
            QLGWVAGP+ MLLFS V Y+TSTLL+ CYR+GDP+ GKR YTYMDAVRSNLGG +VK+CG
Sbjct  63   QLGWVAGPAAMLLFSAVTYFTSTLLSSCYRSGDPLSGKRNYTYMDAVRSNLGGVKVKLCG  122

Query  425  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  604
            L+QY NLFG+AIGYTIA++ SMMAIKRSNCFH+S GKNPC M+SNPYMIAFG++EII SQ
Sbjct  123  LVQYLNLFGVAIGYTIASATSMMAIKRSNCFHKSRGKNPCRMNSNPYMIAFGVVEIIFSQ  182

Query  605  IP  610
            IP
Sbjct  183  IP  184



>emb|CDY31348.1| BnaA02g33930D [Brassica napus]
Length=466

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  122  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  301
             FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7    AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  302  YTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  481
            ++STLL+DCYR GDPV GKR YTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67   FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  482  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  127  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>ref|XP_011027477.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=480

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +2

Query  71   KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  250
            +NH+  L +SID     G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQL
Sbjct  6    RNHQV-LDISIDTHQQGGSKWFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  64

Query  251  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLI  430
            GW+AGP+VM LFS V  YTSTLL+ CYR+GDP+ GKR YTYMDAVRSNLGG +VKICG +
Sbjct  65   GWIAGPAVMFLFSFVTCYTSTLLSACYRSGDPITGKRNYTYMDAVRSNLGGVKVKICGFV  124

Query  431  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            QY NLFG+AIGYTIA+SISMMAIKRSNCF++SGGKNPC M++NPYMI FGI EI+LSQIP
Sbjct  125  QYLNLFGVAIGYTIASSISMMAIKRSNCFYKSGGKNPCRMNANPYMIGFGIAEILLSQIP  184



>ref|XP_006394236.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 ref|XP_006394237.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31522.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31523.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
Length=466

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY+STLL+DCYR GD V GKR YTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDHVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            AA+ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI
Sbjct  124  AAAISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQI  168



>emb|CDP10973.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = +2

Query  47   MGESAAATK---NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M ES A  +   NH    GVS++ PP  G K  DDDG+ +RTG+VWTASAHIITAVIGSG
Sbjct  1    MVESTAPKQGPQNHHQVFGVSVNVPPQGGSKCFDDDGKLKRTGSVWTASAHIITAVIGSG  60

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA  QLGW+AGP+V+LLF+ V YYTS LLA CYR+GDP  GKR YTYMDAVR+NL
Sbjct  61   VLSLAWATAQLGWIAGPTVLLLFAFVTYYTSVLLAACYRSGDPDGGKRNYTYMDAVRANL  120

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG+QVK+CG IQY NLFG+AIGYTIAASISM AIK+SNCFH SGGK+PC +SS PYMI F
Sbjct  121  GGFQVKVCGAIQYMNLFGVAIGYTIAASISMTAIKKSNCFHSSGGKDPCKVSSTPYMIIF  180

Query  578  GIIEIILSQIP  610
            G++EI+ SQIP
Sbjct  181  GVVEILFSQIP  191



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 156/196 (80%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAA--------TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AA+          NH     +SID  P  G K  DDDGR +RTGT+WTASAHIITA
Sbjct  1    MGENAASKNCHNNHHLHNHHQVFDISIDVLPQNGSKCFDDDGRLKRTGTLWTASAHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWA+ QLGWVAGP+VM LFS V YYTS+LL DCYR GDP  GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            V S LGG +VK+CG IQY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSNP
Sbjct  121  VESILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHLSSNP  180

Query  563  YMIAFGIIEIILSQIP  610
            YMI FGI EI+LSQIP
Sbjct  181  YMIMFGITEILLSQIP  196



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 159/198 (80%), Gaps = 8/198 (4%)
 Frame = +2

Query  41   MQMGESAAA--------TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  196
            MQMGE+AA+          NH     VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1    MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCYDDDGRLKRTGTLWTASSHII  60

Query  197  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYM  376
            TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  G+R YTYM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPYTGERNYTYM  120

Query  377  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  556
            DAV+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121  DAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  180

Query  557  NPYMIAFGIIEIILSQIP  610
            NPYMI FGI EI+LSQIP
Sbjct  181  NPYMIMFGITEILLSQIP  198



>ref|XP_010025744.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 ref|XP_010025745.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW62473.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
 gb|KCW62474.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
Length=494

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  125  FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYY  304
            F   DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YY
Sbjct  37   FDSFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVSYY  96

Query  305  TSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASI  484
            TS LL+DCYRAGDPV GKR YTYMD+VRS LGG +VK CG IQYFNLFGIAIGYTIAASI
Sbjct  97   TSCLLSDCYRAGDPVSGKRNYTYMDSVRSILGGAKVKACGFIQYFNLFGIAIGYTIAASI  156

Query  485  SMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            SMMAIKRSNCFHES G+NPCHMSS PYMI FGI EI+LSQIP
Sbjct  157  SMMAIKRSNCFHESNGENPCHMSSTPYMIMFGITEILLSQIP  198



>ref|XP_006287587.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
 gb|EOA20485.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
Length=493

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 156/196 (80%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AAA  +            +  +   P    FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANHHRHQHHHGHQVFDVASNDVVPTQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            VRS LGG++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSN 
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNS  180

Query  563  YMIAFGIIEIILSQIP  610
            YMI FG+ EI+LSQ+P
Sbjct  181  YMIVFGVTEILLSQVP  196



>ref|NP_177862.1| amino acid permease 3 [Arabidopsis thaliana]
 sp|Q39134.2|AAP3_ARATH RecName: Full=Amino acid permease 3; AltName: Full=Amino acid 
transporter AAP3 [Arabidopsis thaliana]
 gb|AAG29203.1|AC078898_13 amino acid carrier, putative [Arabidopsis thaliana]
 emb|CAA54630.1| amino acid permease [Arabidopsis thaliana]
 gb|AAM20639.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AAM91305.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AEE35971.1| amino acid permease 3 [Arabidopsis thaliana]
Length=476

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
              H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNHQTVLAVDMPQTGGSKYLDDDGKNKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            +AGP VMLLFS V Y+TS+LLA CYR+GDP+ GKR YTYMDAVRSNLGG +V +CG++QY
Sbjct  63   LAGPVVMLLFSAVTYFTSSLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
             N+FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIP
Sbjct  123  LNIFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIP  180



>gb|AAM62803.1| amino acid carrier, putative [Arabidopsis thaliana]
Length=476

 Score =   281 bits (719),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
              H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNHQTVLAVDMPQTGGSKYLDDDGKNKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            +AGP VMLLFS V Y+TS+LLA CYR+GDP+ GKR YTYMDAVRSNLGG +V +CG++QY
Sbjct  63   LAGPVVMLLFSVVTYFTSSLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
             N+FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIP
Sbjct  123  LNIFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIP  180



>gb|KDP32820.1| hypothetical protein JCGZ_12112 [Jatropha curcas]
Length=487

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 155/184 (84%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   KNHRHH----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWA  238
            ++H HH    + +++      G K LDDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA
Sbjct  8    RSHSHHQVFDVSINMHTQMSNGSKLLDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  67

Query  239  IGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKI  418
            I QLGW+AGP+VM LFS V YYTSTLL+ CYR+GD V GKR YTYMD +RSNLGG +VKI
Sbjct  68   IAQLGWIAGPAVMFLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDVIRSNLGGAKVKI  127

Query  419  CGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  598
            CG++QY NLFG+AIGYTIA+SISMMA+KRSNCFH+SGGKNPC M++NPYMIAFGI EII 
Sbjct  128  CGIVQYLNLFGVAIGYTIASSISMMAVKRSNCFHKSGGKNPCKMNANPYMIAFGIAEIIF  187

Query  599  SQIP  610
            SQIP
Sbjct  188  SQIP  191



>ref|XP_011102302.1| PREDICTED: amino acid permease 3 isoform X2 [Sesamum indicum]
Length=486

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M M ES  + +       VSI+ P   G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MTMSESTGSRQYQHQVFDVSINVPNQGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA+ QLGW+AGP+VM LFS V YYTS LL+ CYR+GDP  GKR YTYMDAVR+NLG
Sbjct  61   LSLAWAVAQLGWIAGPTVMFLFSFVTYYTSALLSTCYRSGDPDTGKRNYTYMDAVRANLG  120

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G++VK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG
Sbjct  121  GFKVKLCGAIQYVNLFGVAIGYTIASSISMMAIERSNCFHSKGDSSPCRVSSNPYMIAFG  180

Query  581  IIEIILSQIP  610
            +IEII SQIP
Sbjct  181  VIEIIFSQIP  190



>ref|XP_003634405.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
Length=483

 Score =   281 bits (719),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  53   ESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  232
            + ++A K+ + H    ID  P    K  DDDGR +RTGT WTASAHIITAVIGSGVLSLA
Sbjct  2    KMSSAPKDLQPHQVFDIDGVPQGASKCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLA  61

Query  233  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQV  412
            WA  QLGW+AGP+V+ LFS V YYTS LL+ CYR GD V GKR YTYMDAVRSNLGG ++
Sbjct  62   WATAQLGWIAGPAVLFLFSFVTYYTSVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKM  121

Query  413  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  592
            KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFHES  KNPCH+SSNPYMI FGI EI
Sbjct  122  KICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEI  181

Query  593  ILSQIP  610
            ILSQIP
Sbjct  182  ILSQIP  187



>emb|CAN61092.1| hypothetical protein VITISV_005276 [Vitis vinifera]
 emb|CBI18979.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +2

Query  59   AAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWA  238
            ++A K+ + H    ID  P    K  DDDGR +RTGT WTASAHIITAVIGSGVLSLAWA
Sbjct  2    SSAPKDLQPHQVFDIDGVPQGASKCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWA  61

Query  239  IGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKI  418
              QLGW+AGP+V+ LFS V YYTS LL+ CYR GD V GKR YTYMDAVRSNLGG ++KI
Sbjct  62   TAQLGWIAGPAVLFLFSFVTYYTSVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKMKI  121

Query  419  CGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  598
            CGLIQY NLFG+AIGYTIAASISMMAIKRSNCFHES  KNPCH+SSNPYMI FGI EIIL
Sbjct  122  CGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEIIL  181

Query  599  SQIP  610
            SQIP
Sbjct  182  SQIP  185



>ref|XP_003522571.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006578960.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=487

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 2/183 (1%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            +K H+  L  SID       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI Q
Sbjct  9    SKYHQQTLNFSIDIHQQGISKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAIAQ  68

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG--GYQVKIC  421
            LGW+AGP VM+LFS + YYTSTLL+DCYR GDPV GKR YTYMDA++SN G  G++VK+C
Sbjct  69   LGWIAGPIVMVLFSAITYYTSTLLSDCYRTGDPVTGKRNYTYMDAIQSNFGGNGFKVKLC  128

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            GL+QY NLFG+AIGYTIAAS SMMAI+RSNC+H+SGGK+PCHM+SN YMI+FGI+EII S
Sbjct  129  GLVQYINLFGVAIGYTIAASTSMMAIERSNCYHKSGGKDPCHMNSNMYMISFGIVEIIFS  188

Query  602  QIP  610
            QIP
Sbjct  189  QIP  191



>ref|XP_006386355.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
 gb|ERP64152.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
Length=480

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = +2

Query  71   KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  250
            +NH+    +SID     G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQL
Sbjct  6    RNHQV-FDISIDTHQQGGSKWFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  64

Query  251  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLI  430
            GW+AGP+VM LFS V  YTSTLL+ CYR+GDP+ GKR YTYMDAVRSNLGG +VKICG +
Sbjct  65   GWIAGPAVMFLFSFVTCYTSTLLSACYRSGDPITGKRNYTYMDAVRSNLGGVKVKICGFV  124

Query  431  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMI FGI EI+LSQIP
Sbjct  125  QYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGQDPCHMNAYPYMIGFGIAEILLSQIP  184



>ref|XP_009377726.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009343981.1| PREDICTED: amino acid permease 3 [Pyrus x bretschneideri]
Length=484

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +2

Query  74   NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  253
            N R    +S+  PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ QLG
Sbjct  10   NPRQGFELSVPMPPEVGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLG  69

Query  254  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQ  433
            WVAGP+VMLLFS V YYTSTLL+ CYR+GDPV GKR YTY +AVRSNLGG++VKICG +Q
Sbjct  70   WVAGPAVMLLFSFVTYYTSTLLSACYRSGDPVTGKRNYTYTNAVRSNLGGFKVKICGFVQ  129

Query  434  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            Y NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFG+ EII SQIP
Sbjct  130  YLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGVAEIIFSQIP  188



>ref|XP_008338672.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +2

Query  74   NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  253
            N R    +S+  PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ QLG
Sbjct  10   NPRQGFELSVPMPPEVGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLG  69

Query  254  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQ  433
            WVAGP+VMLLFS V  YTSTLL+ CYR+GDPV GKR YTY DAVRSNLGG++VKICG +Q
Sbjct  70   WVAGPAVMLLFSFVTXYTSTLLSACYRSGDPVIGKRNYTYTDAVRSNLGGFKVKICGFVQ  129

Query  434  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            Y NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFG+ EII SQIP
Sbjct  130  YLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGVAEIIFSQIP  188



>ref|XP_007137459.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
 gb|ESW09453.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
Length=487

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 155/190 (82%), Gaps = 2/190 (1%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            +G     ++  +    VS+D       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLS
Sbjct  2    VGMDGHGSRYDQQTFNVSLDMHEQGDSKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLS  61

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG--  400
            LAWAI QLGW+AGP+VMLLFS + Y+TS LL DCYR GDP+ GKR YTYMDA+RSN G  
Sbjct  62   LAWAIAQLGWIAGPAVMLLFSAITYFTSLLLTDCYRTGDPLTGKRNYTYMDAIRSNFGGN  121

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G++VK+CGL+QY NLFGI+IGYTIAASISMMAI+RSNCFH+SGGKNPC M+SN YMI+FG
Sbjct  122  GFKVKMCGLVQYVNLFGISIGYTIAASISMMAIERSNCFHKSGGKNPCRMNSNMYMISFG  181

Query  581  IIEIILSQIP  610
            I+EII SQIP
Sbjct  182  IVEIIFSQIP  191



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 157/196 (80%), Gaps = 8/196 (4%)
 Frame = +2

Query  47   MGESAAA--------TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  202
            MGE+AA+          NH     VS+D  P  G K  DDDGR +RTGT+WTAS+HIITA
Sbjct  1    MGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCFDDDGRLKRTGTLWTASSHIITA  60

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  GKR YTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMDA  120

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            V+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSNP
Sbjct  121  VQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISSNP  180

Query  563  YMIAFGIIEIILSQIP  610
            YMI FGI EI+LSQIP
Sbjct  181  YMIIFGITEILLSQIP  196



>gb|KJB16325.1| hypothetical protein B456_002G223200 [Gossypium raimondii]
Length=477

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 151/188 (80%), Gaps = 7/188 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MGE  A    +R H  +  D P      G DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEKGAV--KNRLHNNLVFDHP-----IGFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  53

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWA  QLGW+AGP+V+ LFS V YYTSTLLA CYR  DPV GKR YTYM+AVR+NLGG+
Sbjct  54   LAWATAQLGWIAGPAVIFLFSFVTYYTSTLLAACYRCDDPVNGKRNYTYMEAVRANLGGF  113

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH S GKNPCHM+SNPYMI FGI 
Sbjct  114  EVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASRGKNPCHMNSNPYMIGFGIA  173

Query  587  EIILSQIP  610
            EII SQIP
Sbjct  174  EIIFSQIP  181



>emb|CDY43761.1| BnaA06g22970D [Brassica napus]
Length=466

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAI QLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY++TLL+DCYR GDPV GKR YTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64   VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            A+SISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LS I
Sbjct  124  ASSISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSTI  168



>ref|XP_009150448.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   278 bits (712),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAI QLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY++TLL+DCYR GDPV GKR YTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64   VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            A+SISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LS I
Sbjct  124  ASSISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSTI  168



>ref|XP_004290905.1| PREDICTED: amino acid permease 3-like [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   279 bits (713),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
                  VS+D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL+LAWA  QLGW
Sbjct  7    QHQAFDVSVDVQPQSGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLALAWATAQLGW  66

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            VAGP+VMLLF+ V YYTSTLL+ CYR GDPV GKR YTY DAVRSNLGGY+VKICG +QY
Sbjct  67   VAGPAVMLLFAFVTYYTSTLLSFCYRTGDPVTGKRNYTYTDAVRSNLGGYKVKICGFVQY  126

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
             NLFG+AIGYTIA+SISM+AIKRSNCFH S GK+ CH++SNPYMIAFGI EII SQI
Sbjct  127  LNLFGVAIGYTIASSISMVAIKRSNCFHSSDGKDECHVNSNPYMIAFGIAEIIFSQI  183



>ref|XP_011102300.1| PREDICTED: amino acid permease 3 isoform X1 [Sesamum indicum]
Length=491

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            M ES  + +       VSI+ P   G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  8    MSESTGSRQYQHQVFDVSINVPNQGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLS  67

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWA+ QLGW+AGP+VM LFS V YYTS LL+ CYR+GDP  GKR YTYMDAVR+NLGG+
Sbjct  68   LAWAVAQLGWIAGPTVMFLFSFVTYYTSALLSTCYRSGDPDTGKRNYTYMDAVRANLGGF  127

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +VK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG+I
Sbjct  128  KVKLCGAIQYVNLFGVAIGYTIASSISMMAIERSNCFHSKGDSSPCRVSSNPYMIAFGVI  187

Query  587  EIILSQIP  610
            EII SQIP
Sbjct  188  EIIFSQIP  195



>emb|CDX84450.1| BnaC03g50500D [Brassica napus]
Length=466

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            V YY++TLL+DCYR GDPV GKR YTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64   VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            A+SISMMAIKRSNCFHESGGKN CHMSSNPYMI FG+IEI+LS I
Sbjct  124  ASSISMMAIKRSNCFHESGGKNLCHMSSNPYMIMFGVIEILLSTI  168



>ref|XP_010912574.1| PREDICTED: amino acid permease 3-like [Elaeis guineensis]
Length=488

 Score =   278 bits (712),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 159/192 (83%), Gaps = 5/192 (3%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            MGE+ AA K ++H + VSI+         G K  DDDGR +RTGT WTASAHIITAVIGS
Sbjct  1    MGENGAA-KYYQHPMEVSIELGHQQQQQGGSKFHDDDGRLKRTGTFWTASAHIITAVIGS  59

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTLLADCYR+ DP+ G R YTYMDAV + 
Sbjct  60   GVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTLLADCYRSEDPITGPRNYTYMDAVHAY  119

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG +VK+CG IQY NLFG+AIGYTIAASISMMAI+RSNCFHE G KNPCH++SNPYMIA
Sbjct  120  LGGLKVKMCGFIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKNPCHVNSNPYMIA  179

Query  575  FGIIEIILSQIP  610
            FG++EII SQIP
Sbjct  180  FGVLEIIFSQIP  191



>ref|XP_002889140.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65399.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   278 bits (711),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  83   HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVA  262
            H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+A
Sbjct  5    HQTVLAVDMPQTGGSKYLDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  263  GPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFN  442
            GP VMLLFS V Y+TS+LLA CYR+G+P+ GKR YTYMDAVRSNLGG +V +CG++QY N
Sbjct  65   GPVVMLLFSAVTYFTSSLLAACYRSGNPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLN  124

Query  443  LFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            +FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIP
Sbjct  125  IFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIP  180



>gb|EYU23867.1| hypothetical protein MIMGU_mgv1a005496mg [Erythranthe guttata]
Length=481

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +2

Query  95   VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  274
            VSI+ PP    K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP+V
Sbjct  15   VSINVPPQLPSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTV  74

Query  275  MLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  454
            M LFS V YYTSTLLA CYR+GDP  GKR YTYMDAVRSNLGG+QVK+CG IQY NLFG+
Sbjct  75   MFLFSFVTYYTSTLLAACYRSGDPDSGKRNYTYMDAVRSNLGGFQVKLCGAIQYLNLFGV  134

Query  455  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            AIGYTIA+SISMMAI RSNCFH  G ++PC +SSNPYMIAFG++EI+ SQIP
Sbjct  135  AIGYTIASSISMMAIDRSNCFHSKGHESPCRVSSNPYMIAFGVVEIVFSQIP  186



>ref|XP_010063420.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70648.1| hypothetical protein EUGRSUZ_F03820 [Eucalyptus grandis]
Length=480

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 157/190 (83%), Gaps = 5/190 (3%)
 Frame = +2

Query  47   MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MG ++A    H ++    VSI+ PP  G K  DDDGR +RTGTVWTAS+HIITAVIGSGV
Sbjct  1    MGVNSAVKNQHPNNQVFDVSINIPPQGGSKCFDDDGRLKRTGTVWTASSHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA  QLGW+AGP+VMLLF+ V YYTSTLLA CYR+GD   GKR YTYMDAV +NLG
Sbjct  61   LSLAWATAQLGWIAGPAVMLLFALVTYYTSTLLAACYRSGD---GKRNYTYMDAVSANLG  117

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G++VK+CGL+QY NLFG+AIGYTIA+SISMMAI RSNCFH++G K+PCH +S PYMIAFG
Sbjct  118  GFKVKLCGLVQYVNLFGVAIGYTIASSISMMAISRSNCFHKNGEKSPCHFNSTPYMIAFG  177

Query  581  IIEIILSQIP  610
            IIEII SQIP
Sbjct  178  IIEIIFSQIP  187



>gb|EYU32509.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=492

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 156/192 (81%), Gaps = 5/192 (3%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHL-GVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            M M ESAA T   RH +  VS++ P   G  K  DDDGR +RTGTVWTASAHIITAVIGS
Sbjct  1    MTMSESAAGT---RHQVFDVSVNMPSQTGGSKCYDDDGRLKRTGTVWTASAHIITAVIGS  57

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWA  QLGWVAGP+++ LFS V YYTS+LLA CYR GDP  GKR YTYMDAVR+N
Sbjct  58   GVLSLAWATAQLGWVAGPTMLFLFSFVTYYTSSLLATCYRTGDPDTGKRNYTYMDAVRAN  117

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG+QVK+CG IQY NLFG+AIGYTIAASIS+MAI+RSNCFH  G  +PC +SSNPYMIA
Sbjct  118  LGGFQVKVCGAIQYMNLFGVAIGYTIAASISLMAIERSNCFHSKGDNSPCRVSSNPYMIA  177

Query  575  FGIIEIILSQIP  610
            FG++EI+ SQIP
Sbjct  178  FGVVEIVFSQIP  189



>gb|KHN44307.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            +K H+  L  SID       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI Q
Sbjct  9    SKYHQQTLNFSIDIHQQGISKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAIAQ  68

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG--GYQVKIC  421
            LGW+AGP VM+LFS + YYTSTLL+DCYR GDPV GKR YTYM A++SN G  G++VK+C
Sbjct  69   LGWIAGPIVMVLFSAITYYTSTLLSDCYRTGDPVTGKRNYTYMGAIQSNFGGNGFKVKLC  128

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            GL+QY NLFG+AIGYTIAAS SMMAI+RSNC+H+SGGK+PCHM+SN YMI+FGI+EII S
Sbjct  129  GLVQYINLFGVAIGYTIAASTSMMAIERSNCYHKSGGKDPCHMNSNMYMISFGIVEIIFS  188

Query  602  QIP  610
            QIP
Sbjct  189  QIP  191



>gb|KDP32819.1| hypothetical protein JCGZ_12111 [Jatropha curcas]
Length=482

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  83   HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVA  262
                VS+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA+ QLGW+A
Sbjct  10   QPFNVSVDMPNQAGSKWYDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIA  69

Query  263  GPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFN  442
            GP+VM LFS V YYTSTLL+ CYR GD V GKR YTYMDAVRSNLGG +VKICG +QY N
Sbjct  70   GPAVMFLFSIVTYYTSTLLSACYRTGDSVNGKRNYTYMDAVRSNLGGAKVKICGYVQYLN  129

Query  443  LFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            L G+AIGYTIA+SISMMA+KRSNCFH++GGK+PCHM++NPYMIAFGI EII SQI
Sbjct  130  LLGVAIGYTIASSISMMAVKRSNCFHKTGGKDPCHMNANPYMIAFGIAEIIFSQI  184



>gb|KJB33339.1| hypothetical protein B456_006G007300 [Gossypium raimondii]
Length=476

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = +2

Query  71   KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  250
            +NHR    V ID P L   +  DDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QL
Sbjct  3    ENHR----VFIDNPSLNDSQCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWAIAQL  58

Query  251  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLI  430
            GW+AGP+VMLLFS + +YTS LL DCYR GDPV GKR YTY  AV S LGGY+VK+CG I
Sbjct  59   GWIAGPAVMLLFSIITFYTSCLLTDCYRTGDPVSGKRNYTYTQAVGSLLGGYKVKVCGFI  118

Query  431  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            QY NLFG++IGYTIAASISMMAIKRSNCFH SGGKNPCHMSS+PYM+ FG+ EI+LSQIP
Sbjct  119  QYVNLFGVSIGYTIAASISMMAIKRSNCFHNSGGKNPCHMSSSPYMMMFGVAEILLSQIP  178



>gb|KHG16478.1| Amino acid permease 2 -like protein [Gossypium arboreum]
Length=476

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = +2

Query  71   KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  250
            +NHR    V ID P L   +  DDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QL
Sbjct  3    ENHR----VFIDNPSLNDSQCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWAIAQL  58

Query  251  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLI  430
            GW+AGP+VMLLFS + +YTS LL DCYR GDPV GKR YTY  AV S LGGY+VK+CG I
Sbjct  59   GWIAGPAVMLLFSIITFYTSCLLTDCYRTGDPVSGKRNYTYTQAVGSLLGGYKVKVCGFI  118

Query  431  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            QY NLFG++IGYTIAASISMMAIKRSNCFH SGGKNPCHMSS+PYM+ FG+ EI+LSQIP
Sbjct  119  QYVNLFGVSIGYTIAASISMMAIKRSNCFHNSGGKNPCHMSSSPYMMMFGVAEILLSQIP  178



>emb|CBI21597.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K LDDDGRP+RTGTVWTASAHIIT++IGSGVLSLAWA+ QLGW+ GP+V+L+F+ V+ YT
Sbjct  15   KCLDDDGRPKRTGTVWTASAHIITSIIGSGVLSLAWAVAQLGWIGGPTVILMFAVVICYT  74

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S+LLADCYR+GDP+ GKR YTYM+ V+SNLGG +VKICGLIQY NLFGI +GYTIA S+S
Sbjct  75   SSLLADCYRSGDPISGKRNYTYMEVVQSNLGGAKVKICGLIQYCNLFGITVGYTIATSVS  134

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            MMA+ RSNCFH SG KNPCH SSNPYMI FGIIEI+LSQIP
Sbjct  135  MMAVMRSNCFHRSGNKNPCHESSNPYMIMFGIIEIVLSQIP  175



>ref|XP_003527948.1| PREDICTED: amino acid permease 3 [Glycine max]
 gb|KHN46995.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   276 bits (707),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = +2

Query  53   ESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  232
            +    +K  +  L VSID       K  DDDGRP+RTGTVWT+SAHIITAVIGSGVLSLA
Sbjct  4    KDGVGSKYLQQTLNVSIDMHQHGISKCFDDDGRPKRTGTVWTSSAHIITAVIGSGVLSLA  63

Query  233  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG--GY  406
            WAI QLGW+AGP VM++FS + YYTSTLLADCYR GDPV GKR YTYMDA++SN G  G+
Sbjct  64   WAIAQLGWIAGPIVMVIFSAITYYTSTLLADCYRTGDPVTGKRNYTYMDAIQSNFGGNGF  123

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +VK+CGL+QY NLFG+AIGYTIAAS SMMAI+RSNCFH+SGGK+PCH++SN YMI+FGI+
Sbjct  124  KVKLCGLVQYVNLFGVAIGYTIAASTSMMAIERSNCFHKSGGKDPCHINSNMYMISFGIV  183

Query  587  EIILSQIP  610
            EI+ SQIP
Sbjct  184  EILFSQIP  191



>ref|XP_006383588.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
 gb|ERP61385.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
Length=484

 Score =   276 bits (706),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MGE+   +        VSI        K  DDDGR +R GTVWTASAHIITAVIGSGVLS
Sbjct  1    MGETENTSAERHQVFDVSIGMHQQGSSKWFDDDGRQKRAGTVWTASAHIITAVIGSGVLS  60

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKR YTYMDAVRSNLGG 
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPITGKRNYTYMDAVRSNLGGV  120

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +VKICG +QY NLFG+A+GYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI FGI 
Sbjct  121  KVKICGFVQYLNLFGVAVGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIGFGIA  180

Query  587  EIILSQIP  610
            EI+LSQIP
Sbjct  181  EILLSQIP  188



>ref|XP_004149429.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
Length=478

 Score =   276 bits (705),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 155/189 (82%), Gaps = 8/189 (4%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M+MGE+ A         G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MKMGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  52

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA  QLGWVAGP+VM LFS V YYTS LL+ CYR+GDPV GKR YTYMDAV++NLG
Sbjct  53   LSLAWATAQLGWVAGPAVMFLFSMVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLG  112

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G+ VK+CG++QY N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMIAFG
Sbjct  113  GWNVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIAFG  172

Query  581  IIEIILSQI  607
            ++EI+ SQI
Sbjct  173  VVEIVFSQI  181



>ref|XP_008781630.1| PREDICTED: amino acid permease 3 [Phoenix dactylifera]
Length=492

 Score =   276 bits (706),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 157/195 (81%), Gaps = 7/195 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHH---LGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  205
            MGE+ A   N +     + VSI+      P  G K  DDD R +RTGT+WTASAHIITAV
Sbjct  1    MGENGAEKHNQQASFPAMEVSIELGHHQQPQGGSKFYDDDQRLKRTGTLWTASAHIITAV  60

Query  206  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAV  385
            IGSGVLSLAWAI QLGWVAGP+VMLLFS V+YYTS+LLADCYR GDP+ GKR YTYMDAV
Sbjct  61   IGSGVLSLAWAIAQLGWVAGPAVMLLFSFVIYYTSSLLADCYRFGDPITGKRNYTYMDAV  120

Query  386  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  565
             + LGG++VK CG+IQY NLFG+AIGYTIAASISMMAI+RS+CFHE G K+PCH+SSNPY
Sbjct  121  HAYLGGFKVKFCGVIQYANLFGVAIGYTIAASISMMAIRRSDCFHEKGDKSPCHISSNPY  180

Query  566  MIAFGIIEIILSQIP  610
            MI FG+ EII SQIP
Sbjct  181  MIIFGVSEIIFSQIP  195



>ref|XP_008799058.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=492

 Score =   276 bits (706),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 160/196 (82%), Gaps = 9/196 (5%)
 Frame = +2

Query  47   MGESAAATKNHRHH----LGVSIDAPPLYGFKG----LDDDGRPQRTGTVWTASAHIITA  202
            MGE+ A TK H+      + VSI+       +G     DDDGR +RTGT+WTASAHIITA
Sbjct  1    MGENGA-TKYHQQAGIPPMEVSIELGHQKQLQGGSKCYDDDGRLKRTGTLWTASAHIITA  59

Query  203  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDA  382
            VIGSGVLSLAWAI QLGWVAGP+VM LFS V++YTSTLLADCYR+GDP+ GKR YTYMDA
Sbjct  60   VIGSGVLSLAWAIAQLGWVAGPAVMFLFSFVIFYTSTLLADCYRSGDPITGKRNYTYMDA  119

Query  383  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  562
            V + LGG +VK+CG IQY NLFG+AIGYTIAASISMMAI+RSNCFHE G K+PCH+SSNP
Sbjct  120  VHAYLGGLKVKMCGYIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKSPCHVSSNP  179

Query  563  YMIAFGIIEIILSQIP  610
            YMIAFG++EII SQIP
Sbjct  180  YMIAFGVLEIIFSQIP  195



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 158/198 (80%), Gaps = 9/198 (5%)
 Frame = +2

Query  41   MQMGESAAA--------TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  196
            MQMGE+AA+          NH     VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1    MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCYDDDGRLKRTGTLWTASSHII  60

Query  197  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYM  376
            TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  G+R YTYM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPYTGERNYTYM  120

Query  377  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  556
            DAV+S L G +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121  DAVQSIL-GVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  179

Query  557  NPYMIAFGIIEIILSQIP  610
            NPYMI FGI EI+LSQIP
Sbjct  180  NPYMIMFGITEILLSQIP  197



>ref|XP_004498350.1| PREDICTED: amino acid permease 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498351.1| PREDICTED: amino acid permease 3-like isoform X2 [Cicer arietinum]
Length=487

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 153/192 (80%), Gaps = 6/192 (3%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            M     + KNH+     SID     P   G K  DDDGR +R+G  WTASAHIITAVIGS
Sbjct  1    MTMEKDSNKNHQQPFEFSIDNLQQGPA--GSKCFDDDGRLKRSGNTWTASAHIITAVIGS  58

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAI QLGWVAGPS+MLLFS V YYTSTLL+ CYR+GD + GKR YTY DAVR+ 
Sbjct  59   GVLSLAWAIAQLGWVAGPSMMLLFSFVTYYTSTLLSVCYRSGDQLNGKRNYTYTDAVRAY  118

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG++VKICG +QY NLFG+AIGYTIAASISMMAIKRSNCFH SGGKNPCHM+SN YMI+
Sbjct  119  LGGFKVKICGFVQYANLFGVAIGYTIAASISMMAIKRSNCFHSSGGKNPCHMNSNVYMIS  178

Query  575  FGIIEIILSQIP  610
            FGI+EII SQIP
Sbjct  179  FGIVEIIFSQIP  190



>ref|XP_010653015.1| PREDICTED: amino acid permease 4-like [Vitis vinifera]
Length=504

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 159/197 (81%), Gaps = 6/197 (3%)
 Frame = +2

Query  20   GIGGSKIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIIT  199
            G  G+ ++Q+ E     K H+  L +  D  P    K LDDDGRP+RTGTVWTASAHIIT
Sbjct  30   GKAGTTMLQVDE-----KPHQM-LHLPSDVLPHDISKCLDDDGRPKRTGTVWTASAHIIT  83

Query  200  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMD  379
            ++IGSGVLSLAWA+ QLGW+ GP+V+L+F+ V+ YTS+LLADCYR+GDP+ GKR YTYM+
Sbjct  84   SIIGSGVLSLAWAVAQLGWIGGPTVILMFAVVICYTSSLLADCYRSGDPISGKRNYTYME  143

Query  380  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  559
             V+SNLGG +VKICGLIQY NLFGI +GYTIA S+SMMA+ RSNCFH SG KNPCH SSN
Sbjct  144  VVQSNLGGAKVKICGLIQYCNLFGITVGYTIATSVSMMAVMRSNCFHRSGNKNPCHESSN  203

Query  560  PYMIAFGIIEIILSQIP  610
            PYMI FGIIEI+LSQIP
Sbjct  204  PYMIMFGIIEIVLSQIP  220



>ref|XP_008466753.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=478

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 154/189 (81%), Gaps = 8/189 (4%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M+MGE+ A         G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MKMGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  52

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA  QLGWVAGP+VM LFS V YYTS LL+ CYR+GDPV GKR YTYMDAV++NLG
Sbjct  53   LSLAWATAQLGWVAGPAVMFLFSLVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLG  112

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G+ VK+CG++QY N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMI FG
Sbjct  113  GWNVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIGFG  172

Query  581  IIEIILSQI  607
            I+EII SQI
Sbjct  173  IVEIIFSQI  181



>ref|XP_009379863.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=495

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 156/198 (79%), Gaps = 7/198 (4%)
 Frame = +2

Query  38   IMQMGESAAATKNHRHH---LGVSIDAPPLYGFKGL----DDDGRPQRTGTVWTASAHII  196
            + +MGE+ AA  N R     + VS++       +GL    DDDGR +R+GT WTASAHI+
Sbjct  1    MQKMGENGAAKYNQRPTFTPMEVSVELSHGNQLQGLGKCYDDDGRLKRSGTFWTASAHIV  60

Query  197  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYM  376
            TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP  GKR Y YM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPDTGKRNYNYM  120

Query  377  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  556
            DAV + LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G KNPCH SS
Sbjct  121  DAVHAYLGGLKVKLCGCIQYANLFGVAVGYTIAASISMMAIRRSNCFHEKGHKNPCHTSS  180

Query  557  NPYMIAFGIIEIILSQIP  610
            NPYMI FG++EI LSQIP
Sbjct  181  NPYMIMFGVVEIFLSQIP  198



>gb|EYU32508.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=490

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 155/190 (82%), Gaps = 5/190 (3%)
 Frame = +2

Query  47   MGESAAATKNHRHHL-GVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M ESAA T   RH +  VS++ P   G  K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MSESAAGT---RHQVFDVSVNMPSQTGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGV  57

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA  QLGWVAGP+++ LFS V YYTS+LLA CYR GDP  GKR YTYMDAVR+NLG
Sbjct  58   LSLAWATAQLGWVAGPTMLFLFSFVTYYTSSLLATCYRTGDPDTGKRNYTYMDAVRANLG  117

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G+QVK+CG IQY NLFG+AIGYTIAASIS+MAI+RSNCFH  G  +PC +SSNPYMIAFG
Sbjct  118  GFQVKVCGAIQYMNLFGVAIGYTIAASISLMAIERSNCFHSKGDNSPCRVSSNPYMIAFG  177

Query  581  IIEIILSQIP  610
            ++EI+ SQIP
Sbjct  178  VVEIVFSQIP  187



>ref|XP_010684694.1| PREDICTED: amino acid permease 3-like [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 153/195 (78%), Gaps = 2/195 (1%)
 Frame = +2

Query  29   GSKIMQMGESAAATKNHRHHLGV-SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  205
            GSK ++  E      N   HL    +D+    G K  DDDGR +R GT+WTASAHIITAV
Sbjct  4    GSKQLK-NEYNFDNGNQSFHLTTFDVDSATGSGSKLFDDDGRLKRRGTMWTASAHIITAV  62

Query  206  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAV  385
            IGSGVLSLAWA  QLGWVAGP VMLLFS V YYTS LLADCYR+GDPV GKR YTYMDAV
Sbjct  63   IGSGVLSLAWATAQLGWVAGPIVMLLFSIVTYYTSVLLADCYRSGDPVSGKRNYTYMDAV  122

Query  386  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  565
            ++NLGG QVKICGLIQY NLFG+AIGYTIAASISM AIKRSNCFHE G K+ C +S+NPY
Sbjct  123  QANLGGLQVKICGLIQYLNLFGVAIGYTIAASISMTAIKRSNCFHEKGEKSKCDISTNPY  182

Query  566  MIAFGIIEIILSQIP  610
            MIAFG+ EII SQIP
Sbjct  183  MIAFGVAEIIFSQIP  197



>ref|XP_003524313.1| PREDICTED: amino acid permease 2-like [Glycine max]
 gb|KHN17398.1| Amino acid permease 2 [Glycine soja]
Length=484

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 149/191 (78%), Gaps = 3/191 (2%)
 Frame = +2

Query  47   MGESAAATK-NHRHHLGVSIDAPP--LYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M E+AA T  NH    G+  D P       K  DDDGR +RTG VWTAS+HIITAVIGSG
Sbjct  1    MPENAATTNLNHLQVFGIEDDVPSHSQNNSKCYDDDGRLKRTGNVWTASSHIITAVIGSG  60

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWAI QLGW+AGP+VM LFS V +YTS+LLADCYRAGDP  GKR YTYMDAVRS L
Sbjct  61   VLSLAWAIAQLGWIAGPTVMFLFSLVTFYTSSLLADCYRAGDPNSGKRNYTYMDAVRSIL  120

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG  V +CG+ QY NL GI IGYTIAASISMMAIKRSNCFH+SGGKNPCHMSSN YMI F
Sbjct  121  GGANVTLCGIFQYLNLLGIVIGYTIAASISMMAIKRSNCFHKSGGKNPCHMSSNVYMIIF  180

Query  578  GIIEIILSQIP  610
            G  EI LSQIP
Sbjct  181  GATEIFLSQIP  191



>ref|XP_009389175.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 152/191 (80%), Gaps = 10/191 (5%)
 Frame = +2

Query  68   TKNHRHHLGVSIDA----------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            ++N R +L V              P +   K  DDDGR +RTGTVWTA++HIITAVIGSG
Sbjct  20   SRNERAYLQVETQPKIQEDTESLNPQVAHSKCFDDDGRLKRTGTVWTATSHIITAVIGSG  79

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWAI QLGW+AGP VM+LF+ V+YYTS LL+DCYR+GDPV G+R YTY DAVRSNL
Sbjct  80   VLSLAWAIAQLGWIAGPIVMILFAFVIYYTSNLLSDCYRSGDPVTGRRNYTYTDAVRSNL  139

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG +VKICG IQY NLFG+AIGYTIAASISMMAIKRSNCFH SGGK+PCHMSSN YMI F
Sbjct  140  GGAKVKICGAIQYVNLFGVAIGYTIAASISMMAIKRSNCFHASGGKDPCHMSSNMYMIIF  199

Query  578  GIIEIILSQIP  610
            GI EI+ SQIP
Sbjct  200  GITEIVFSQIP  210



>gb|KGN47695.1| hypothetical protein Csa_6G381850 [Cucumis sativus]
Length=476

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +2

Query  77   HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  256
                 G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    ENQAFGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  257  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQY  436
            VAGP+VM LFS V YYTS LL+ CYR+GDPV GKR YTYMDAV++NLGG+ VK+CG++QY
Sbjct  63   VAGPAVMFLFSMVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLGGWNVKLCGVVQY  122

Query  437  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
             N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMIAFG++EI+ SQI
Sbjct  123  ANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIAFGVVEIVFSQI  179



>emb|CDO96925.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 154/190 (81%), Gaps = 10/190 (5%)
 Frame = +2

Query  71   KNHRHHLGVSIDAPPLYGFKGL----------DDDGRPQRTGTVWTASAHIITAVIGSGV  220
            ++ RH+L V +   P    + +          DDDGR +RTGT+WTA++HIITAVIGSGV
Sbjct  21   QDFRHYLQVEVQPKPQQEAEAINLQANYSKCFDDDGRLKRTGTLWTATSHIITAVIGSGV  80

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAIGQLGWVAGP+VMLLF+ V+ YTS LL+ CYR+G+PV G R YTYMDAV++ LG
Sbjct  81   LSLAWAIGQLGWVAGPTVMLLFAFVILYTSNLLSQCYRSGNPVTGPRNYTYMDAVKATLG  140

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +VKICGLIQY NLFG+AIGYTIAAS+SMMA+KRSNCFHES GK+PCHM+SN YMI FG
Sbjct  141  GRKVKICGLIQYINLFGVAIGYTIAASVSMMAVKRSNCFHESNGKDPCHMTSNGYMITFG  200

Query  581  IIEIILSQIP  610
            IIEII SQIP
Sbjct  201  IIEIIFSQIP  210



>ref|XP_010063423.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70652.1| hypothetical protein EUGRSUZ_F03827 [Eucalyptus grandis]
Length=483

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 157/193 (81%), Gaps = 8/193 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQR---TGTVWTASAHIITAVIG  211
            MG ++A    H ++    VSI+ PP  G K  DDDGR +R   TGTVWTAS+HIITAVIG
Sbjct  1    MGVNSAVKNQHPNNQVFDVSINIPPQGGSKCFDDDGRLKRLKRTGTVWTASSHIITAVIG  60

Query  212  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRS  391
            SGVLSLAWA  QLGW+AGP+VMLLF+ V YYTSTLLA CYR+GD   GKR YTYMDAV +
Sbjct  61   SGVLSLAWATAQLGWIAGPAVMLLFALVTYYTSTLLAACYRSGD---GKRNYTYMDAVSA  117

Query  392  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  571
            NLGG++VK+CGL+QY NLFG+AIGYTIA+SISMMAI RSNCFH++G K+PCH +S PYMI
Sbjct  118  NLGGFKVKLCGLVQYVNLFGVAIGYTIASSISMMAISRSNCFHKNGEKSPCHFNSTPYMI  177

Query  572  AFGIIEIILSQIP  610
            AFGIIEII SQIP
Sbjct  178  AFGIIEIIFSQIP  190



>ref|XP_009414606.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 157/194 (81%), Gaps = 6/194 (3%)
 Frame = +2

Query  44   QMGESAAATKNHRHHLGVSIDAPPLYGF-----KGLDDDGRPQRTGTVWTASAHIITAVI  208
            +MGE+ AA   H+H     ++     GF     K  DDDGR +RTGTVWTASAHIITAVI
Sbjct  3    KMGENGAA-NCHQHVALAPVEVSVELGFQHGASKCFDDDGRLKRTGTVWTASAHIITAVI  61

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWAIGQLGWVAGP+VMLLFS V +YTS LLADCYR+GDPV G+R YTYMDAV+
Sbjct  62   GSGVLSLAWAIGQLGWVAGPAVMLLFSFVTFYTSALLADCYRSGDPVTGRRNYTYMDAVQ  121

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            +NL G +VKICG +QY N+ G+AIGYTIAASISM+AIKRSNCF++ G  +PCH++SNPYM
Sbjct  122  ANLNGIKVKICGYLQYLNIVGVAIGYTIAASISMVAIKRSNCFNKEGDDSPCHVNSNPYM  181

Query  569  IAFGIIEIILSQIP  610
            I FG+ EI+LSQIP
Sbjct  182  IMFGVAEIVLSQIP  195



>ref|XP_009390075.1| PREDICTED: amino acid permease 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 155/202 (77%), Gaps = 15/202 (7%)
 Frame = +2

Query  38   IMQMGESAAATKNHRHH-------LGVSIDAPPLY----GFKGLDDDGRPQRTGTVWTAS  184
            + QMGE    T N +H+       + VSI+    +     F+  DDDGR +RTGTVWTAS
Sbjct  1    MQQMGE----TGNAKHYQQPAVVPMNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTAS  56

Query  185  AHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRK  364
            AHI+TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP+ GKR 
Sbjct  57   AHIVTAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRN  116

Query  365  YTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPC  544
            Y Y DAV S LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G  NPC
Sbjct  117  YKYTDAVHSYLGGLKVKLCGFIQYANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNPC  176

Query  545  HMSSNPYMIAFGIIEIILSQIP  610
            H SSNPYMI FG+ EI LSQIP
Sbjct  177  HTSSNPYMIMFGVAEIFLSQIP  198



>ref|XP_010920126.1| PREDICTED: amino acid permease 4-like [Elaeis guineensis]
Length=513

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 152/190 (80%), Gaps = 10/190 (5%)
 Frame = +2

Query  71   KNHRHHLGVSIDAPPLYGFKG----------LDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            ++ R +L V     PL   +            DDDGR +RTGTVWTAS+HIITAVIGSGV
Sbjct  21   RDVRAYLQVETQPKPLKDIEATSARPEYSKLFDDDGRLKRTGTVWTASSHIITAVIGSGV  80

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAIGQLGW+AGP+VM+LF+ V+YYTS LL+DCYR GDPV GKR YTYMDAV +NLG
Sbjct  81   LSLAWAIGQLGWIAGPAVMILFAFVIYYTSNLLSDCYRIGDPVTGKRNYTYMDAVGANLG  140

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +VKICG IQY NLFG+AIGYTIAASISM AIKRSNCFH SGGK+PCH+SSN YMI FG
Sbjct  141  GAKVKICGAIQYVNLFGVAIGYTIAASISMTAIKRSNCFHASGGKDPCHISSNMYMIIFG  200

Query  581  IIEIILSQIP  610
            I+E+I SQIP
Sbjct  201  IMEVIFSQIP  210



>gb|KCW70650.1| hypothetical protein EUGRSUZ_F03824 [Eucalyptus grandis]
Length=464

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
                G+S+D P     K LDDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA  QLGW+
Sbjct  8    NQAFGLSLDIPRQGSSKSLDDDGRVKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWI  67

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP VM LF+ V YYTSTLLA CYR+GDP+ G+R YTYMDAV +NLGG++VK+CGL+QY 
Sbjct  68   AGPIVMFLFASVTYYTSTLLAACYRSGDPITGRRNYTYMDAVNANLGGFKVKLCGLVQYL  127

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NLFG+AIGYT+A+S SMMAI RSNCFH+ G KNPCH +  PYMIAFGI EII SQIP
Sbjct  128  NLFGVAIGYTMASSFSMMAIDRSNCFHKKGEKNPCHANGYPYMIAFGITEIIFSQIP  184



>ref|XP_010911278.1| PREDICTED: amino acid permease 3-like isoform X1 [Elaeis guineensis]
Length=492

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 158/194 (81%), Gaps = 6/194 (3%)
 Frame = +2

Query  44   QMGESAAATKNHRHH----LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVI  208
            +MGE+ AA K H+H     + V+I+     G  K  D+DGR +RTGTVWTAS+HIITAVI
Sbjct  3    KMGENGAA-KYHQHANFTPMEVAIELGHQQGSSKCFDNDGRLKRTGTVWTASSHIITAVI  61

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWAIGQLGWVAGP+ MLLFS V YYTS LL+DCYR+GDP+ GKR YTYMDAV 
Sbjct  62   GSGVLSLAWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVH  121

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            +NL G++VKICG +QY N+FG++IGYTIAASISM+AIKRSNCFHE G KNPC  SSNPYM
Sbjct  122  ANLNGFKVKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNPCQASSNPYM  181

Query  569  IAFGIIEIILSQIP  610
            I FG+ EI+ SQIP
Sbjct  182  IMFGVAEILFSQIP  195



>ref|XP_011002449.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MGE    +        VSI        +  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEPENTSAEKHQVFDVSIAMHQQGSSEWFDDDGRQKRTGTVWTASAHIITAVIGSGVLS  60

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKR YTYMDAVRSNLGG 
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPLTGKRNYTYMDAVRSNLGGV  120

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKN C M++NPYMI FGI 
Sbjct  121  KVKICGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNSCRMNANPYMIGFGIA  180

Query  587  EIILSQIP  610
            E +LSQIP
Sbjct  181  ETLLSQIP  188



>ref|XP_006662801.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=475

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  137  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  316
            DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  27   DDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  86

Query  317  LADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  496
            LA+CYR+GDP  GKR YTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  87   LAECYRSGDPCSGKRNYTYMDAVRANLGGAKVRLCGVIQYANLFGVAIGYTIAASISMLA  146

Query  497  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            IKR++CFHE G KN C  SSNPYMI FG +EI+ SQIP
Sbjct  147  IKRADCFHEKGHKNACRSSSNPYMILFGAVEIVFSQIP  184



>ref|XP_010063933.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW71231.1| hypothetical protein EUGRSUZ_F04329 [Eucalyptus grandis]
Length=478

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 148/173 (86%), Gaps = 1/173 (1%)
 Frame = +2

Query  95   VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  271
            V++D P   G  K  DDDGR +RTGTVWTAS+HIITAVIGSGVLSLAWA  QLGW+AGP+
Sbjct  10   VALDLPQQGGGSKCFDDDGRLKRTGTVWTASSHIITAVIGSGVLSLAWATAQLGWIAGPA  69

Query  272  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFG  451
            VM LFS V YYTS+LLA CYR+GDPV GKR YTYMDAV SNLGG +VK+CG++QY NLFG
Sbjct  70   VMFLFSFVTYYTSSLLAACYRSGDPVTGKRNYTYMDAVHSNLGGAKVKLCGMVQYLNLFG  129

Query  452  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            +AIGYTIA+SISMMAI RSNCFH++G  +PCH SSNPYMIAFG+IEI LSQIP
Sbjct  130  VAIGYTIASSISMMAIARSNCFHKNGDDSPCHTSSNPYMIAFGVIEIFLSQIP  182



>ref|XP_009801366.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=481

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 152/190 (80%), Gaps = 4/190 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M+MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGV
Sbjct  1    MKMGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGV  56

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKR YTYMDAV++NLG
Sbjct  57   LSLAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLG  116

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYMI FG
Sbjct  117  GLQVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMIMFG  176

Query  581  IIEIILSQIP  610
            IIEII SQIP
Sbjct  177  IIEIIFSQIP  186



>ref|XP_010911284.1| PREDICTED: amino acid permease 3-like isoform X2 [Elaeis guineensis]
Length=489

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 157/193 (81%), Gaps = 6/193 (3%)
 Frame = +2

Query  47   MGESAAATKNHRHH----LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIG  211
            MGE+ AA K H+H     + V+I+     G  K  D+DGR +RTGTVWTAS+HIITAVIG
Sbjct  1    MGENGAA-KYHQHANFTPMEVAIELGHQQGSSKCFDNDGRLKRTGTVWTASSHIITAVIG  59

Query  212  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRS  391
            SGVLSLAWAIGQLGWVAGP+ MLLFS V YYTS LL+DCYR+GDP+ GKR YTYMDAV +
Sbjct  60   SGVLSLAWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVHA  119

Query  392  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  571
            NL G++VKICG +QY N+FG++IGYTIAASISM+AIKRSNCFHE G KNPC  SSNPYMI
Sbjct  120  NLNGFKVKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNPCQASSNPYMI  179

Query  572  AFGIIEIILSQIP  610
             FG+ EI+ SQIP
Sbjct  180  MFGVAEILFSQIP  192



>ref|XP_007137460.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
 gb|ESW09454.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
Length=487

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 153/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            +K+ +    VS+D       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI Q
Sbjct  9    SKSDQETFSVSLDMHEQGDSKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAIAQ  68

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG--YQVKIC  421
            LGW+AGP+VMLLFS + Y+TS LL DCYR GDP+ GKR YTYMDA+RSN GG  ++VK+C
Sbjct  69   LGWIAGPAVMLLFSAITYFTSLLLTDCYRTGDPLTGKRNYTYMDAIRSNFGGNDFKVKMC  128

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            GL+QY NLFGI+IGYTIAASISMMAI+RS+CFH++GGK+ C M+SN YMI+FGI+E+I S
Sbjct  129  GLVQYVNLFGISIGYTIAASISMMAIERSDCFHKNGGKSHCRMNSNMYMISFGIVEMIFS  188

Query  602  QIP  610
            QIP
Sbjct  189  QIP  191



>ref|XP_008788441.1| PREDICTED: amino acid permease 4-like [Phoenix dactylifera]
Length=514

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  107  APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLF  286
            A P Y  K  DDDGR +RTGT WTAS+HIITAVIGSGVLSLAW +GQLGW+AGP+VM+LF
Sbjct  45   AQPEYS-KLFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWGVGQLGWIAGPAVMILF  103

Query  287  SCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGY  466
            + V+ YTS LL+DCYR GDPV GKR YTYMDAV +NLGG +VKICG IQY NLFG+AIGY
Sbjct  104  AFVIQYTSNLLSDCYRTGDPVTGKRNYTYMDAVGANLGGAKVKICGAIQYVNLFGVAIGY  163

Query  467  TIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            TIAASISMMAIKRSNCFH SGGK+PCH+SSN YMI FGIIE+ILSQIP
Sbjct  164  TIAASISMMAIKRSNCFHASGGKDPCHVSSNIYMIIFGIIEVILSQIP  211



>gb|EEC81839.1| hypothetical protein OsI_25597 [Oryza sativa Indica Group]
Length=451

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  137  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  316
            DDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  28   DDDGRARRTGTAWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  87

Query  317  LADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  496
            LA+CYR+GDP  GKR YTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  88   LAECYRSGDPCTGKRNYTYMDAVRANLGGAKVRLCGVIQYANLFGVAIGYTIAASISMLA  147

Query  497  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            IKR++CFHE G KNPC  SSNPYMI FG+++I+ SQIP
Sbjct  148  IKRADCFHEKGHKNPCRSSSNPYMILFGVVQIVFSQIP  185



>ref|XP_009609434.1| PREDICTED: amino acid permease 3-like [Nicotiana tomentosiformis]
Length=482

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 152/190 (80%), Gaps = 4/190 (2%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M+MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGV
Sbjct  1    MKMGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGV  56

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKR YTYMDAV++NLG
Sbjct  57   LSLAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLG  116

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYMI FG
Sbjct  117  GLQVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMIMFG  176

Query  581  IIEIILSQIP  610
            I+EII SQIP
Sbjct  177  IVEIIFSQIP  186



>ref|XP_006300985.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
 gb|EOA33883.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
Length=475

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  95   VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  274
            +++  P   G K  DDDG+ +RTG+ WTASAHIITAVIGSGVLSLAWA  QLGW+AGP V
Sbjct  8    LAVIMPQTAGSKCFDDDGKIKRTGSAWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVV  67

Query  275  MLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  454
            MLLFS V Y+TS+LLA CYR+GDP+ GKR YTYMDAVRSNLGG +V +CG++QY N+FG+
Sbjct  68   MLLFSIVTYFTSSLLASCYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLNIFGV  127

Query  455  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            AIGYTIA++ISMMAIKRSNCFH+SGGK+ CHM+SNPYMIAFG+++I+ SQIP
Sbjct  128  AIGYTIASAISMMAIKRSNCFHKSGGKDACHMNSNPYMIAFGLVQILFSQIP  179



>gb|EEE52230.1| hypothetical protein OsJ_34158 [Oryza sativa Japonica Group]
Length=451

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  137  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  316
            DDDGR +R GTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  28   DDDGRARRMGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  87

Query  317  LADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  496
            LA+CYR+GDP  GKR YTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  88   LAECYRSGDPCTGKRNYTYMDAVRANLGGSKVRLCGVIQYANLFGVAIGYTIAASISMLA  147

Query  497  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            IKR++CFHE G KNPC  SSNPYMI FG+++I+ SQIP
Sbjct  148  IKRADCFHEKGHKNPCRSSSNPYMILFGVVQIVFSQIP  185



>emb|CAN77083.1| hypothetical protein VITISV_003992 [Vitis vinifera]
Length=546

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 155/195 (79%), Gaps = 1/195 (1%)
 Frame = +2

Query  26   GGSKIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  205
            GG     M ++    K H+  L +  D  P    K LDDDG P+RTGTVWTASAHIIT++
Sbjct  57   GGKAGTTMLQTKVDEKPHQM-LHLPSDVLPHDISKCLDDDGXPKRTGTVWTASAHIITSI  115

Query  206  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAV  385
            IGSGVLSLAWA+ QLGW+ GP+V+L+F+ V+ YTS+LLADCYR+GDP+ GKR YTYM+ V
Sbjct  116  IGSGVLSLAWAVAQLGWIGGPTVILMFAVVICYTSSLLADCYRSGDPISGKRNYTYMEVV  175

Query  386  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  565
            +SNLGG +VKICGLIQY NLFGI +GYTIA S+SMMA+ RSNCFH SG KNPCH SSNPY
Sbjct  176  QSNLGGAKVKICGLIQYCNLFGITVGYTIATSVSMMAVMRSNCFHRSGNKNPCHESSNPY  235

Query  566  MIAFGIIEIILSQIP  610
            MI FGIIEI+LSQIP
Sbjct  236  MIMFGIIEIVLSQIP  250



>ref|XP_011003419.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MGE    +        VSI        +  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEPENTSAEKHQVFDVSIAMHQQGSSEWFDDDGRQKRTGTVWTASAHIITAVIGSGVLS  60

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKR YTYMDAVRSNLGG 
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPLTGKRNYTYMDAVRSNLGGV  120

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            +VKICG +QY NLFG+A GYTIA+SISMMAIKRSNCFH+SGGKN C M++NPYMI FGI 
Sbjct  121  KVKICGFVQYLNLFGVAFGYTIASSISMMAIKRSNCFHKSGGKNSCRMNANPYMIGFGIA  180

Query  587  EIILSQIP  610
            E +LSQIP
Sbjct  181  ETLLSQIP  188



>ref|XP_009390074.1| PREDICTED: amino acid permease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 154/200 (77%), Gaps = 15/200 (8%)
 Frame = +2

Query  44   QMGESAAATKNHRHH-------LGVSIDAPPLY----GFKGLDDDGRPQRTGTVWTASAH  190
            +MGE    T N +H+       + VSI+    +     F+  DDDGR +RTGTVWTASAH
Sbjct  17   KMGE----TGNAKHYQQPAVVPMNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTASAH  72

Query  191  IITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYT  370
            I+TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP+ GKR Y 
Sbjct  73   IVTAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRNYK  132

Query  371  YMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHM  550
            Y DAV S LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G  NPCH 
Sbjct  133  YTDAVHSYLGGLKVKLCGFIQYANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNPCHT  192

Query  551  SSNPYMIAFGIIEIILSQIP  610
            SSNPYMI FG+ EI LSQIP
Sbjct  193  SSNPYMIMFGVAEIFLSQIP  212



>gb|KEH35329.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=409

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            + NH     VSID      F   DDDGR +RTGT WTASAH+ITAVIGSGVLSLAWAI Q
Sbjct  7    STNHHQTFDVSIDQQRDSKF--FDDDGRVKRTGTAWTASAHVITAVIGSGVLSLAWAIAQ  64

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGL  427
            LGW+AGP VM+LF+ V YYTS LL +CYR GDP+ GKR YTYMD V SNLGG+QV +CG+
Sbjct  65   LGWIAGPIVMILFAWVTYYTSILLCECYRTGDPISGKRNYTYMDVVHSNLGGFQVTLCGI  124

Query  428  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            +QY NL G+AIGYTIA++ISMMAI+RSNCFH SGGK+PCHM+SN YMI+FG ++II SQI
Sbjct  125  VQYLNLVGVAIGYTIASAISMMAIERSNCFHRSGGKDPCHMNSNIYMISFGAVQIIFSQI  184

Query  608  P  610
            P
Sbjct  185  P  185



>gb|KDP29639.1| hypothetical protein JCGZ_18801 [Jatropha curcas]
Length=522

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 152/192 (79%), Gaps = 1/192 (1%)
 Frame = +2

Query  35   KIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            ++  + +S     N   +   +I+  P Y  K  DDDGR +RTGT WTA++HIITAVIGS
Sbjct  30   EVQPVAKSTRNNPNPNENGSEAINPQPNYS-KCFDDDGRLKRTGTFWTAASHIITAVIGS  88

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAIGQLGWVAGP+VMLLF+ V  YTS LLA CYR GDPV G R YTYMDAV++N
Sbjct  89   GVLSLAWAIGQLGWVAGPAVMLLFAFVNLYTSNLLAQCYRTGDPVKGHRNYTYMDAVKAN  148

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LGG +V  CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH SGGK+PCHMSSN YMIA
Sbjct  149  LGGKKVFFCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHASGGKDPCHMSSNGYMIA  208

Query  575  FGIIEIILSQIP  610
            FGI E+I SQIP
Sbjct  209  FGITEVIFSQIP  220



>ref|NP_001067425.1| Os11g0195600 [Oryza sativa Japonica Group]
 gb|AAX96051.1| Transmembrane amino acid transporter protein [Oryza sativa Japonica 
Group]
 gb|ABA91874.1| amino acid carrier, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27788.1| Os11g0195600 [Oryza sativa Japonica Group]
 dbj|BAG90706.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96629.1| unnamed protein product [Oryza sativa Japonica Group]
Length=476

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  137  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  316
            DDDGR +R GTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  28   DDDGRARRMGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  87

Query  317  LADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  496
            LA+CYR+GDP  GKR YTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  88   LAECYRSGDPCTGKRNYTYMDAVRANLGGSKVRLCGVIQYANLFGVAIGYTIAASISMLA  147

Query  497  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            IKR++CFHE G KNPC  SSNPYMI FG+++I+ SQIP
Sbjct  148  IKRADCFHEKGHKNPCRSSSNPYMILFGVVQIVFSQIP  185



>ref|XP_010527720.1| PREDICTED: amino acid permease 5-like isoform X2 [Tarenaya hassleriana]
Length=480

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            T N     GVS+D  P       DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4    TVNGTQSFGVSMDVLPKNRSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQ  63

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGL  427
            LGWVAGP+VM LFS V YYTS LL  CYR+GD V GKR YTYMDAV++NLGG +VK+CGL
Sbjct  64   LGWVAGPAVMFLFSLVTYYTSILLCSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGL  123

Query  428  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            +QY NLFG AIGYTIA+++SM+AI+RSNC H+S GK+PCH++ NPYMIAFG+ +I+ SQI
Sbjct  124  VQYLNLFGTAIGYTIASAVSMIAIQRSNCHHKSHGKDPCHINGNPYMIAFGVAQIVFSQI  183

Query  608  P  610
            P
Sbjct  184  P  184



>gb|AAX56951.1| amino acid transporter [Pisum sativum]
Length=482

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 149/183 (81%), Gaps = 3/183 (2%)
 Frame = +2

Query  65   ATKNHRHH-LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  241
            A+KNH H    VSID       K  DDDGR +RTGT WTASAH+ITAVIGSGVLSLAWAI
Sbjct  7    ASKNHHHQTFDVSIDQQ--LDSKFFDDDGRVKRTGTSWTASAHVITAVIGSGVLSLAWAI  64

Query  242  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKIC  421
             QLGW+AGP VM+LF+ V YYTS LLA+CYR GDPV GKR YTYM+ V SNLGG QV+ C
Sbjct  65   AQLGWIAGPVVMILFAWVTYYTSVLLAECYRNGDPVNGKRNYTYMEVVHSNLGGLQVQFC  124

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            G IQY NL G+AIGYT+A++ISMMAI+RSNC+H SGGK+PCHM+SN YMIAFG ++II+S
Sbjct  125  GFIQYLNLIGVAIGYTVASAISMMAIERSNCYHRSGGKDPCHMNSNAYMIAFGAVQIIVS  184

Query  602  QIP  610
            QIP
Sbjct  185  QIP  187



>dbj|BAO45885.1| amino acid permease [Acacia mangium]
Length=486

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = +2

Query  95   VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  274
            V I+  P    K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW+AGP+V
Sbjct  12   VDIEVAPQGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAV  71

Query  275  MLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  454
            M+LFS V YYTS+LLA CYR+GDP+ GKR YTYMDAVRSNLGG++VKICGLIQY NLFG+
Sbjct  72   MILFSLVTYYTSSLLAACYRSGDPLTGKRNYTYMDAVRSNLGGFKVKICGLIQYVNLFGV  131

Query  455  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            AIGYTIAASISMMA+++SNC H++G K+ C M+ + Y+IAFGI+EII SQIP
Sbjct  132  AIGYTIAASISMMAVQKSNCIHKTGSKDECKMNGDIYIIAFGIVEIIFSQIP  183



>ref|XP_009390766.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390767.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 148/185 (80%), Gaps = 8/185 (4%)
 Frame = +2

Query  56   SAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAW  235
            S +   +H H L  +        F+  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAW
Sbjct  19   SVSVEVSHAHKLQEA--------FECYDDDGRAKRTGTLWTASAHIVTAVIGSGVLSLAW  70

Query  236  AIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVK  415
            AI QLGWVAGP VMLLFS V +YTSTLLADCYR+GDP+ GKR Y+Y DAV + LGG +VK
Sbjct  71   AIAQLGWVAGPVVMLLFSFVTHYTSTLLADCYRSGDPIAGKRNYSYTDAVHAYLGGLKVK  130

Query  416  ICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEII  595
            +CG IQY NLFG+AIGYTIA+SISMMAIKRSNCFHE G +NPCH SSNPYMI FGI EI 
Sbjct  131  LCGFIQYANLFGVAIGYTIASSISMMAIKRSNCFHERGHENPCHASSNPYMIMFGIAEIF  190

Query  596  LSQIP  610
            LSQIP
Sbjct  191  LSQIP  195



>ref|XP_010530203.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
 ref|XP_010530205.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
Length=480

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            T  +     VSID  P       DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4    TVKNTQSFVVSIDVLPKSSSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAMAQ  63

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGL  427
            LGWVAGP+VM LFS V YYTS LL+ CYR+GD V GKR YTYMDAV++NLGG +VK+CGL
Sbjct  64   LGWVAGPAVMFLFSLVTYYTSILLSSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGL  123

Query  428  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            +QY NLFG AIGYTIA++ISM+AI+RSNC H S GK+PCH++ NPYMIAFG+ +I+ SQI
Sbjct  124  VQYLNLFGTAIGYTIASAISMIAIQRSNCHHRSHGKDPCHINGNPYMIAFGVAQIVFSQI  183

Query  608  P  610
            P
Sbjct  184  P  184



>ref|XP_010416679.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 149/173 (86%), Gaps = 1/173 (1%)
 Frame = +2

Query  95   VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  271
            ++ID PP  G  K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP 
Sbjct  9    LAIDMPPQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPV  68

Query  272  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFG  451
             MLLFS V Y+TS+LLA CYR+GDP+ GKR YTYM AVRSNLGG +V +CG++QY N+FG
Sbjct  69   AMLLFSVVTYFTSSLLATCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFG  128

Query  452  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            +AIGYTIA++ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIP
Sbjct  129  VAIGYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIP  181



>gb|KEH40510.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=483

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 149/189 (79%), Gaps = 4/189 (2%)
 Frame = +2

Query  47   MGESAAATKNHRHH-LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            M     +  NH+     VSID     G K  DDDGR +RTG  WTASAHIITAVIGSGVL
Sbjct  1    MTVEKGSNMNHQQQPFEVSIDTA---GSKCFDDDGRLKRTGNEWTASAHIITAVIGSGVL  57

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWAI QLGW+AGPS+MLLFS V YYTSTLL+ CYR GD + GKR YTY DAVR+ LGG
Sbjct  58   SLAWAIAQLGWIAGPSMMLLFSFVTYYTSTLLSVCYRTGDQLNGKRNYTYTDAVRAYLGG  117

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
            ++ KICG++QY NLFG+AIGYTIAASISMMAIKRSNCFH SGGKNPCHM+ N YMI+FGI
Sbjct  118  FKYKICGVVQYANLFGVAIGYTIAASISMMAIKRSNCFHSSGGKNPCHMNGNIYMISFGI  177

Query  584  IEIILSQIP  610
            +EI  SQIP
Sbjct  178  VEIFFSQIP  186



>emb|CDY71454.1| BnaAnng37520D, partial [Brassica napus]
Length=280

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  268
            LGVS+D  P       D+DGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GWV GP
Sbjct  11   LGVSMDVLPRNSSDLFDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGP  70

Query  269  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLF  448
            +VM+LFS V YYTS LL  CYR+GD V GKR YTYMDA+ SNLGG +VKICG++QY NLF
Sbjct  71   TVMMLFSLVTYYTSILLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLF  130

Query  449  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            G AIGYTIA+++SM+AI+R++C   +G K+PCH++ NPYMIAFG+I+I+ SQIP
Sbjct  131  GTAIGYTIASAVSMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGVIQIVFSQIP  184



>emb|CAC51425.1| amino acid permease AAP4 [Vicia faba var. minor]
Length=481

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +2

Query  65   ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  244
            A+ NH     VSID       K  DDDGR +RTGT WTASAH+ITAVIGSGVLSLAWAI 
Sbjct  7    ASNNHHQTFYVSIDQQ--IDSKFFDDDGRVKRTGTSWTASAHVITAVIGSGVLSLAWAIA  64

Query  245  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICG  424
            QLGW+AGP VM LF+ V YYTS LL +CYR GDPV GKR YTYM+ V SNLGG+QV++CG
Sbjct  65   QLGWIAGPIVMFLFAWVTYYTSVLLCECYRNGDPVNGKRNYTYMEVVHSNLGGFQVQLCG  124

Query  425  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  604
            LIQY NL G+AIGYT+A++ISMMAI RSNCFH SGGK+PCHM+SN YMIAFG ++II SQ
Sbjct  125  LIQYLNLVGVAIGYTVASAISMMAIVRSNCFHRSGGKDPCHMNSNIYMIAFGAVQIIFSQ  184

Query  605  IP  610
            IP
Sbjct  185  IP  186



>ref|XP_008236004.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=511

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 154/194 (79%), Gaps = 11/194 (6%)
 Frame = +2

Query  62   AATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  208
            A  + H  RH+L V +           P     K  DDDGR +RTGT WT+++HIITAVI
Sbjct  16   AVEERHDIRHYLQVEVQPKVTESEAINPQSSYIKCFDDDGRLKRTGTFWTSASHIITAVI  75

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWAI QLGWVAGPSV+LLF+ V  YTS LLA CYR+GDPV G+R YTYMDA++
Sbjct  76   GSGVLSLAWAIAQLGWVAGPSVLLLFALVNLYTSNLLAMCYRSGDPVTGQRNYTYMDAIK  135

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            +NLGG +V +CGL+QYFNLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN YM
Sbjct  136  ANLGGRKVMLCGLVQYFNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSNGYM  195

Query  569  IAFGIIEIILSQIP  610
            I FGIIE+I SQIP
Sbjct  196  ITFGIIEVIFSQIP  209



>ref|XP_008810907.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=468

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  122  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  301
            G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+ MLLFS V Y
Sbjct  9    GSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAAMLLFSYVTY  68

Query  302  YTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  481
            YTS LLADCYR+ DP+ GKR YTYMDAV++NL G++VK+CG IQY N+FG++IGYTIAA+
Sbjct  69   YTSALLADCYRSCDPINGKRNYTYMDAVQANLNGFKVKLCGFIQYANIFGVSIGYTIAAA  128

Query  482  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            ISM AIKRSNCFHE G  NPC +SSNPYMI FG+ EI LSQIP
Sbjct  129  ISMTAIKRSNCFHEKGHSNPCQVSSNPYMIIFGVAEIFLSQIP  171



>ref|XP_010428816.1| PREDICTED: amino acid permease 3 [Camelina sativa]
Length=477

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 149/173 (86%), Gaps = 1/173 (1%)
 Frame = +2

Query  95   VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  271
            ++ID P   G  K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP 
Sbjct  9    LAIDMPQQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPV  68

Query  272  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFG  451
            VMLLFS V Y+TS+LLA CYR+GDP+ GKR YTYM AVRSNLGG +V +CG++QY N+FG
Sbjct  69   VMLLFSVVTYFTSSLLASCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFG  128

Query  452  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            +AIGYTIA++ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIP
Sbjct  129  VAIGYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIP  181



>ref|XP_006473027.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=479

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 147/184 (80%), Gaps = 6/184 (3%)
 Frame = +2

Query  62   AATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  241
             A KN      VS+   P  G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWA 
Sbjct  5    TAAKNQHQVFDVSL---PQSGSKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAT  61

Query  242  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKIC  421
             QLGW+AGPSVM LFS V YYTSTLLA CYR+GDPV GKR YTY+DAVRSNLGG+QVKIC
Sbjct  62   AQLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKIC  121

Query  422  GLIQYFNLFGIAIG-YTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  598
            GL+QY NLFG+A   Y+  +SI   AI+RSNCFH  G KNPCHM+SNPYMIAFGI+EI+L
Sbjct  122  GLVQYLNLFGVAFTRYSFFSSIR--AIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVL  179

Query  599  SQIP  610
            SQIP
Sbjct  180  SQIP  183



>ref|XP_008679681.1| PREDICTED: amino acid permease 3-like [Zea mays]
 gb|AFW65568.1| hypothetical protein ZEAMMB73_193502 [Zea mays]
Length=472

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  122  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  301
             + G DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP+VMLLF+ V+Y
Sbjct  19   AYGGRDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGPAVMLLFAVVIY  78

Query  302  YTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  481
            YTSTLLA+CYR+GDPV GKR YTYMDAVR++LGG +V++CG IQY NLFG+AIGYTIAAS
Sbjct  79   YTSTLLAECYRSGDPVAGKRNYTYMDAVRASLGGAKVRLCGAIQYANLFGVAIGYTIAAS  138

Query  482  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            ISM+AIKR++CFH  G K+ C  SSNPYMI FG+ E++ SQIP
Sbjct  139  ISMLAIKRADCFHAKGHKHACRSSSNPYMILFGVAEVVFSQIP  181



>ref|XP_004978920.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=473

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = +2

Query  89   LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  268
            L VS++A        LDDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP
Sbjct  8    LEVSVEAGNGRDGAWLDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGP  67

Query  269  SVMLLFSCVVYYTSTLLADCYRAG-DPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNL  445
            +VMLLF+ V+YYTSTLLA+CYR+G DPV GKR YTYMDAVR++LGG +V++CG IQY NL
Sbjct  68   AVMLLFAFVIYYTSTLLAECYRSGGDPVAGKRNYTYMDAVRASLGGAKVRLCGAIQYANL  127

Query  446  FGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            FG+AIGYTIAASISM+AIKR++CFH  G +NPC  SSNPYMI FG+ E++ SQIP
Sbjct  128  FGVAIGYTIAASISMLAIKRADCFHAKGHRNPCRSSSNPYMILFGVAEVVFSQIP  182



>ref|XP_002449174.1| hypothetical protein SORBIDRAFT_05g006010 [Sorghum bicolor]
 gb|EES08162.1| hypothetical protein SORBIDRAFT_05g006010 [Sorghum bicolor]
Length=481

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  137  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  316
            DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP+VM+LF+ V+YYTSTL
Sbjct  32   DDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGPAVMILFAVVIYYTSTL  91

Query  317  LADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  496
            LA+CYR+GDPV GKR YTYMDAVRS+LGG +V +CG IQY NLFG+AIGYTIAASISM+A
Sbjct  92   LAECYRSGDPVAGKRNYTYMDAVRSSLGGAKVTLCGSIQYANLFGVAIGYTIAASISMLA  151

Query  497  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            IKR++CFH  G +NPC  SSNPYMI FG+ E++ SQIP
Sbjct  152  IKRADCFHVKGHRNPCRSSSNPYMILFGVAEVVFSQIP  189



>ref|XP_010471931.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   265 bits (678),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  122  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  301
            G K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VMLLFS V Y
Sbjct  19   GSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVVMLLFSVVTY  78

Query  302  YTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  481
            +TS+LLA CYR+GDP+ GKR YTYM AVRSNLGG +V +CG++QY N+FG+AIGYTIA++
Sbjct  79   FTSSLLASCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFGVAIGYTIASA  138

Query  482  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIP
Sbjct  139  ISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIP  181



>ref|XP_006847199.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
 gb|ERN08780.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
Length=497

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  122  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  301
            G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLA+AIGQLGWVAGP+VM+LFS V Y
Sbjct  31   GSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAFAIGQLGWVAGPTVMVLFSFVTY  90

Query  302  YTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  481
            YTSTLL+DCYR+GDP+ GKR YTY+DAVR+N+  + V++CG +QY  L G+AIGYTIA+S
Sbjct  91   YTSTLLSDCYRSGDPLTGKRNYTYVDAVRANMSEFNVRLCGWLQYAGLVGVAIGYTIASS  150

Query  482  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            ISMMAIKRSNCFHE+ GKNPCH+SSNPYMI FGI EI+LSQIP
Sbjct  151  ISMMAIKRSNCFHETRGKNPCHVSSNPYMIMFGITEIVLSQIP  193



>ref|XP_010028716.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW55513.1| hypothetical protein EUGRSUZ_I01405 [Eucalyptus grandis]
Length=512

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTGT WTAS+HIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LF+ V +YT
Sbjct  50   KCFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWAIGQLGWVAGPTVMVLFAFVNFYT  109

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            + LL+ CYR+GDP+ G+R YTYMD V++NLGG +V +CGLIQY NLFG+AIGYTIAAS+S
Sbjct  110  TNLLSQCYRSGDPITGQRNYTYMDVVKANLGGKRVMLCGLIQYLNLFGVAIGYTIAASVS  169

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            MMAIKRSNCFH+SGGK+PCHMSSN +MI FG++EI LSQIP
Sbjct  170  MMAIKRSNCFHKSGGKDPCHMSSNGFMITFGVMEIFLSQIP  210



>ref|XP_009411897.1| PREDICTED: amino acid permease 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   265 bits (678),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LFS V YYT
Sbjct  22   KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFSFVTYYT  81

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LLADCYR+GDPV GKR YTYMDAVR+NL G++V++CG +QY N+ G+AIGYTIAASIS
Sbjct  82   SALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVAIGYTIAASIS  141

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+AIKRSNCFHE+G  +PC ++SNPY+I FG+ EI+ SQIP
Sbjct  142  MVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIP  182



>ref|XP_009411898.1| PREDICTED: amino acid permease 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LFS V YYT
Sbjct  15   KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFSFVTYYT  74

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LLADCYR+GDPV GKR YTYMDAVR+NL G++V++CG +QY N+ G+AIGYTIAASIS
Sbjct  75   SALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVAIGYTIAASIS  134

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+AIKRSNCFHE+G  +PC ++SNPY+I FG+ EI+ SQIP
Sbjct  135  MVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIP  175



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  18   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  77

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LL+DCYR GDPV GKR YTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIAASIS
Sbjct  78   SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIAASIS  137

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+A+ RSNCFH+ G +  C++SS PYMI FG++EII SQIP
Sbjct  138  MVAVNRSNCFHKQGHRAACNVSSTPYMIIFGVMEIIFSQIP  178



>ref|XP_008442173.1| PREDICTED: amino acid permease 4-like [Cucumis melo]
Length=466

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P+      DDDGRP+RTGT WTASAHIITAVIGSGVLSLAWAI QLGW+AGPSVMLLFS 
Sbjct  5    PVNDSASFDDDGRPKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMLLFSF  64

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            + YYTS LLADCYR+GDPV GKR  TYM AVRS LG   +  CG++QY NL GI IGYTI
Sbjct  65   IGYYTSCLLADCYRSGDPVSGKRNPTYMHAVRSLLGETHMVACGIMQYINLIGITIGYTI  124

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FGI+EIILSQIP
Sbjct  125  ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMLSFGIVEIILSQIP  170



>ref|XP_003542145.1| PREDICTED: amino acid permease 3 isoform X1 [Glycine max]
 ref|XP_006593825.1| PREDICTED: amino acid permease 3 isoform X2 [Glycine max]
 ref|XP_006593826.1| PREDICTED: amino acid permease 3 isoform X3 [Glycine max]
 gb|KHN05187.1| Amino acid permease 2 [Glycine soja]
Length=479

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
            +    VS D     G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAI QLGW+
Sbjct  7    KQTFEVSNDTLQRVGSKSFDDDGRLKRTGTIWTASAHIITAVIGSGVLSLAWAIAQLGWI  66

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP VM+LFS V YYTSTLLA CYR+GD + GKR YTY  AVRS LGG+ VK CG +QY 
Sbjct  67   AGPVVMILFSIVTYYTSTLLATCYRSGDQLSGKRNYTYTQAVRSYLGGFSVKFCGWVQYA  126

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NLFG+AIGYTIAASISMMAIKRSNC+H SGGKNPC M+SN YMI++G+ EII SQIP
Sbjct  127  NLFGVAIGYTIAASISMMAIKRSNCYHSSGGKNPCKMNSNWYMISYGVSEIIFSQIP  183



>gb|EPS59884.1| hypothetical protein M569_14923, partial [Genlisea aurea]
Length=237

 Score =   256 bits (654),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  137  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  316
            DDDGRP+RTG++WTASAHIITAVIGSGVLSLAWA+ QLGW+AGP VMLLFS V YYTS L
Sbjct  1    DDDGRPKRTGSLWTASAHIITAVIGSGVLSLAWAMAQLGWIAGPVVMLLFSFVTYYTSVL  60

Query  317  LADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  496
            LA CYR G+P  GKR YTY+DAVRSNLG   VK+CG IQY NLFG+AIGYTIA++ISMMA
Sbjct  61   LAACYRTGNPDTGKRNYTYVDAVRSNLGELHVKLCGGIQYLNLFGVAIGYTIASAISMMA  120

Query  497  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            ++RSNCFH  G  +PC  SSNPYMIAFG +EI+ SQIP
Sbjct  121  VERSNCFHAKGDDSPCKASSNPYMIAFGAVEILFSQIP  158



>ref|XP_007198986.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
 gb|EMJ00185.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
Length=511

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 153/194 (79%), Gaps = 11/194 (6%)
 Frame = +2

Query  62   AATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  208
            A  + H  RH+L V +           P     K  DDDGR +RTG  WT+++HIITAVI
Sbjct  16   AVEERHDIRHYLQVEVQPKVTESEAINPQSSYSKCFDDDGRLKRTGNFWTSASHIITAVI  75

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWAI QLGWVAGPSV+LLF+ V  YTS LLA CYR+GDPV G+R YTYMDA++
Sbjct  76   GSGVLSLAWAIAQLGWVAGPSVLLLFALVNLYTSNLLAMCYRSGDPVTGQRNYTYMDAIK  135

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            +NLGG +V +CGL+QYFNLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN YM
Sbjct  136  ANLGGRKVMLCGLVQYFNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSNGYM  195

Query  569  IAFGIIEIILSQIP  610
            I FGIIE+I SQIP
Sbjct  196  ITFGIIEVIFSQIP  209



>gb|AIL30502.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGVLS
Sbjct  1    MGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLS  56

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKR YTYMDAV++NLGG 
Sbjct  57   LAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGL  116

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYM+ FGII
Sbjct  117  QVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGII  176

Query  587  EIILSQIP  610
             II SQIP
Sbjct  177  AIIFSQIP  184



>gb|AIS71894.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGVLS
Sbjct  1    MGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLS  56

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKR YTYMDAV++NLGG 
Sbjct  57   LAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGL  116

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
            QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYM+ FGII
Sbjct  117  QVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGII  176

Query  587  EIILSQIP  610
             II SQIP
Sbjct  177  AIIFSQIP  184



>gb|AII99817.1| amino acid transporter [Nicotiana tabacum]
Length=479

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 153/191 (80%), Gaps = 9/191 (5%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M MG++     NH     VS +    YG  K  DDDGR +R+G+VWTASAHIITAVIGSG
Sbjct  1    MTMGDN-----NHHQVFDVSANG---YGESKCFDDDGRLKRSGSVWTASAHIITAVIGSG  52

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA  QLGW+AGP+V+LLFS V YYTS LLADCYR+GD V GKR YTYMDAVR+NL
Sbjct  53   VLSLAWATAQLGWIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANL  112

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG QVKICG+IQY NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI F
Sbjct  113  GGLQVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMF  172

Query  578  GIIEIILSQIP  610
            GIIEII SQIP
Sbjct  173  GIIEIIFSQIP  183



>ref|XP_006351135.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=479

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 152/189 (80%), Gaps = 6/189 (3%)
 Frame = +2

Query  47   MGESAA-ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            MG+S   A+K+    + V++        K  DDDGR +RTG+VWTASAHIITAVIGSGVL
Sbjct  1    MGDSTNFASKHQLFDVSVNVTES-----KRFDDDGRIKRTGSVWTASAHIITAVIGSGVL  55

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWA+ QLGW+AGP VMLLFS V YYTS+LL+DCYR+GDP+ GKR YTYMDAV++NLGG
Sbjct  56   SLAWAVAQLGWIAGPIVMLLFSFVTYYTSSLLSDCYRSGDPLSGKRNYTYMDAVQANLGG  115

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
             QVKICG IQY NLFG+AIGYTIA+SISMMA+KRS+CFH+ G K PC   + PYMI FG+
Sbjct  116  LQVKICGWIQYVNLFGVAIGYTIASSISMMAVKRSDCFHKHGHKAPCLEPNTPYMIIFGV  175

Query  584  IEIILSQIP  610
            IEI+ SQIP
Sbjct  176  IEIVFSQIP  184



>gb|KEH35328.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=479

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            +KNH     VSID       K  DDDGR +RTGT WTASAH+ITAV+GSGVLSL+WAI Q
Sbjct  7    SKNHHQTFDVSIDQQR--DSKYFDDDGRIKRTGTAWTASAHVITAVVGSGVLSLSWAIAQ  64

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGL  427
            LGW+AGP VM+LF+ V YYTS LL +CYR  DP+ GKR YTYMDAV SNLGG+QV +CG+
Sbjct  65   LGWIAGPIVMILFAWVTYYTSILLCECYRNDDPINGKRNYTYMDAVHSNLGGFQVTLCGI  124

Query  428  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            +QY NL G AIGYTIA++ISMMAI+RSNCFH SGGK+PCHM+SN YMI+FG ++II SQI
Sbjct  125  VQYLNLAGAAIGYTIASAISMMAIERSNCFHRSGGKDPCHMNSNIYMISFGAVQIIFSQI  184

Query  608  P  610
            P
Sbjct  185  P  185



>ref|XP_009404321.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404322.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTGTVWTA+AHI+TAVIGSGVLSLAW I QLGWVAGP VM LFS V YYT
Sbjct  28   KSYDDDGRLKRTGTVWTATAHIVTAVIGSGVLSLAWTIAQLGWVAGPVVMFLFSFVTYYT  87

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            STLLADCYR+GDP+ GKR Y Y DAV + LGG +VK+CG IQY NLFG+AIGYTIAASIS
Sbjct  88   STLLADCYRSGDPINGKRNYNYTDAVHAYLGGLKVKLCGFIQYANLFGVAIGYTIAASIS  147

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            MMAIKRS+CFHE G KNPC  SSNPYMI FG+ EI LSQIP
Sbjct  148  MMAIKRSDCFHEKGHKNPCLTSSNPYMIMFGVAEIFLSQIP  188



>gb|AFW56243.1| hypothetical protein ZEAMMB73_107595, partial [Zea mays]
Length=250

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  268
            L VS++A      + LDDDGRP+RTGT WTASAHI+TAVIGSGVLSLAWAI QLGWVAGP
Sbjct  16   LEVSVEAGNGGAAEWLDDDGRPRRTGTFWTASAHIVTAVIGSGVLSLAWAIAQLGWVAGP  75

Query  269  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLF  448
            + MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLGG +V  CG+IQY NL 
Sbjct  76   AAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVAFCGVIQYANLV  135

Query  449  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            G+AIGYTIAASISM A++R+ CFH  G  +PC+ SS PYMI FG+++I+ SQIP
Sbjct  136  GVAIGYTIAASISMKAVRRAGCFHAHGHADPCNSSSTPYMILFGVVQILFSQIP  189



>ref|NP_001234606.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13689.1|AF013280_1 amino acid transporter [Solanum lycopersicum]
Length=471

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  16   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  75

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LL+DCYR GDPV GKR YTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIA+SIS
Sbjct  76   SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIASSIS  135

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+A+ RSNCFH+ G    C++SS PYMI FG++EII SQIP
Sbjct  136  MVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIP  176



>ref|XP_010322323.1| PREDICTED: amino acid transporter isoform X1 [Solanum lycopersicum]
Length=473

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  18   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  77

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LL+DCYR GDPV GKR YTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIA+SIS
Sbjct  78   SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIASSIS  137

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+A+ RSNCFH+ G    C++SS PYMI FG++EII SQIP
Sbjct  138  MVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIP  178



>ref|XP_008368062.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 149/192 (78%), Gaps = 8/192 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHH----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  214
            M E+ A     + H      VS++     G K +DDDGRP+RTGTVWTAS+HIITA+IGS
Sbjct  1    MSENTATRNQLQLHYNPVFDVSLNVQG--GSKYIDDDGRPKRTGTVWTASSHIITAIIGS  58

Query  215  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSN  394
            GVLSLAWAI QLGW+AGP+ M +FS + YYTSTLLA CYR  DPV GKR Y+Y DAVRSN
Sbjct  59   GVLSLAWAIAQLGWIAGPAAMAIFSFITYYTSTLLASCYR--DPVTGKRNYSYSDAVRSN  116

Query  395  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  574
            LG + VK CG +Q  NLFGI IGYT+AASISMMAIKRSNCFH SGGK+PCH++ NPYMIA
Sbjct  117  LGEFLVKXCGFVQQLNLFGITIGYTVAASISMMAIKRSNCFHNSGGKDPCHINYNPYMIA  176

Query  575  FGIIEIILSQIP  610
            FG  EIILSQIP
Sbjct  177  FGTSEIILSQIP  188



>gb|KEH35330.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=480

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 145/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            + NH     VSID       K  DDDGR +RTGTVWTASAH+ITAV+GSGVLSLAWAI Q
Sbjct  7    STNHHQTFDVSIDQQR--DSKYFDDDGRVKRTGTVWTASAHVITAVVGSGVLSLAWAIAQ  64

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGL  427
            LGW+AGP VM+LF+ V YYT+ LL +CYR  DP+ GKR YTYMD V SNLGG+QV +CG+
Sbjct  65   LGWIAGPIVMILFAWVTYYTAILLCECYRNDDPINGKRNYTYMDVVHSNLGGFQVTLCGI  124

Query  428  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            +QY NL G+AIGYTIA++ISMMAI+RSNCFH SGGK+PCHM SN YMI+FG ++II SQI
Sbjct  125  VQYLNLVGVAIGYTIASAISMMAIERSNCFHRSGGKDPCHMKSNIYMISFGAVQIIFSQI  184

Query  608  P  610
            P
Sbjct  185  P  185



>ref|XP_004503904.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=486

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTG+VWTAS+HIITAVIGSGVLSLAWAI QLGW+AGP+VM+LFS V  YT
Sbjct  33   KSYDDDGRLKRTGSVWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMILFSMVTIYT  92

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S+ LADCYR+GD   GKR YTYMDAVRS LGG  V  CG+ QY NLFGI IGYTIAASIS
Sbjct  93   SSFLADCYRSGDLNSGKRNYTYMDAVRSILGGVNVTFCGIFQYLNLFGIVIGYTIAASIS  152

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M AIKRSNCFH+SGGKNPCHMSSN YMI FGI EI LSQIP
Sbjct  153  MTAIKRSNCFHQSGGKNPCHMSSNQYMIIFGITEIFLSQIP  193



>ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
 emb|CBI37884.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 12/191 (6%)
 Frame = +2

Query  71   KNHRHHLGVSIDAPPLYG-----------FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            ++ RH+L V +   P +G            K  DDDGR +RTGT WTAS+HIITAVIGSG
Sbjct  21   QDIRHYLQVEVQPKP-HGESEAINPQANYSKCFDDDGRLKRTGTFWTASSHIITAVIGSG  79

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWAIGQLGWVAGP VM+LF+ V  Y+S LLA CYR+GDP+ G+R YTYM+AV++NL
Sbjct  80   VLSLAWAIGQLGWVAGPIVMILFAFVNLYSSNLLAQCYRSGDPLTGQRNYTYMEAVKANL  139

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG +V  CG IQY NLFG AIGYTIAAS+SMMAIKRSNCFH+SGGK+PCHMSSN YMI F
Sbjct  140  GGKKVLACGWIQYLNLFGTAIGYTIAASVSMMAIKRSNCFHKSGGKDPCHMSSNGYMITF  199

Query  578  GIIEIILSQIP  610
            GIIEII SQIP
Sbjct  200  GIIEIIFSQIP  210



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 153/191 (80%), Gaps = 9/191 (5%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M MG++     NH     VS +    YG  K  DDDGR +R+G+VWTASAHIITAVIGSG
Sbjct  1    MTMGDN-----NHHQVFDVSANG---YGESKCFDDDGRLKRSGSVWTASAHIITAVIGSG  52

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA  QLGWVAGP+V+LLFS V YYTS LLADCYR+GD V GKR YTYMDAVR+NL
Sbjct  53   VLSLAWATAQLGWVAGPAVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANL  112

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG QVKICG+IQY NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI F
Sbjct  113  GGLQVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMF  172

Query  578  GIIEIILSQIP  610
            G++EI+ SQIP
Sbjct  173  GVMEILFSQIP  183



>ref|XP_009596721.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +2

Query  74   NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  253
            ++ HH    + A      K  DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  3    DNNHHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLG  62

Query  254  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQ  433
            W+AGP+V+LLFS V YYTS LLADCYR+GD V GKR YTYMDAVR+NLGG QVKICG+IQ
Sbjct  63   WIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQ  122

Query  434  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            Y NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI FGI+EI+ SQIP
Sbjct  123  YVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIMEILFSQIP  181



>ref|XP_009596720.1| PREDICTED: amino acid permease 3-like isoform X1 [Nicotiana tomentosiformis]
Length=480

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 153/191 (80%), Gaps = 9/191 (5%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            M MG++     NH     VS +    YG  K  DDDGR +R+G+VWTASAHIITAVIGSG
Sbjct  1    MTMGDN-----NHHQVFDVSANG---YGESKCFDDDGRLKRSGSVWTASAHIITAVIGSG  52

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA  QLGW+AGP+V+LLFS V YYTS LLADCYR+GD V GKR YTYMDAVR+NL
Sbjct  53   VLSLAWATAQLGWIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANL  112

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG QVKICG+IQY NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI F
Sbjct  113  GGLQVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMF  172

Query  578  GIIEIILSQIP  610
            GI+EI+ SQIP
Sbjct  173  GIMEILFSQIP  183



>ref|XP_004151465.1| PREDICTED: amino acid permease 4-like [Cucumis sativus]
Length=418

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P+      DDDG P+RTGT WTASAHIITAVIGSGVLSLAWAI QLGW+AGPSVM+LF+ 
Sbjct  5    PVNDSASFDDDGCPKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMILFAF  64

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            + YYTS LLADCYR+GDPV GKR  TYM AVRS LG   +  CG++QY NL GI IGYTI
Sbjct  65   IGYYTSCLLADCYRSGDPVNGKRNPTYMHAVRSLLGETHMVACGIMQYINLIGITIGYTI  124

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FGI+EIILSQIP
Sbjct  125  ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMLSFGIVEIILSQIP  170



>ref|NP_001233979.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13687.1|AF013278_1 amino acid transporter [Solanum lycopersicum]
Length=476

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 146/177 (82%), Gaps = 5/177 (3%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
            +H + ++I    L+     DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA+ QLGW+
Sbjct  10   KHPVSINITESKLF-----DDDGRIKRSGSVWTASAHIITAVIGSGVLSLAWAVAQLGWI  64

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP VMLLFS V YYTS+LL+DCYR+GDP+FGKR YTYMD V++NL G QVKICG IQY 
Sbjct  65   AGPIVMLLFSFVTYYTSSLLSDCYRSGDPLFGKRNYTYMDVVQANLSGLQVKICGWIQYV  124

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NLFG+AIGYTIA+SIS+MA+KRS+CFH+ G K PC   + PYMI FG+IEII SQIP
Sbjct  125  NLFGVAIGYTIASSISLMAVKRSDCFHKHGHKAPCLQPNTPYMIIFGVIEIIFSQIP  181



>gb|EYU37943.1| hypothetical protein MIMGU_mgv1a004721mg [Erythranthe guttata]
Length=513

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 150/191 (79%), Gaps = 11/191 (6%)
 Frame = +2

Query  71   KNHRHHLGVSIDAPPLYGF-----------KGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            ++ RH+L V     P               K  DDDGR +RTGT+WTA++HIITAVIGSG
Sbjct  21   QDVRHYLQVETQPKPQETESRAINLQENYSKCFDDDGRLKRTGTLWTATSHIITAVIGSG  80

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA+GQLGWVAGP VM+LF+ V  YTS LL+ CYR+GDPV G+R YTYMDAV++NL
Sbjct  81   VLSLAWAVGQLGWVAGPIVMILFAFVNLYTSDLLSKCYRSGDPVVGQRNYTYMDAVKANL  140

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            GG +VKICGLIQY NLFG+AIGYTIAAS+SM+AIKRSNCFH++  K+ CHMSSN YMI F
Sbjct  141  GGVKVKICGLIQYINLFGVAIGYTIAASVSMLAIKRSNCFHKTHKKSRCHMSSNGYMITF  200

Query  578  GIIEIILSQIP  610
            GIIEI+ SQIP
Sbjct  201  GIIEILFSQIP  211



>gb|KJB15783.1| hypothetical protein B456_002G196200 [Gossypium raimondii]
Length=512

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTGT WTA++HIITAVIGSGVLSLAWAI QLGWVAGP+V++LF+ V  YT
Sbjct  50   KCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLAWAIAQLGWVAGPTVLVLFAFVNLYT  109

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LLA+CYR+GD V G+R YTYM+AV+++LGG++VK+CG IQY NLFG+AIGYTIAAS+S
Sbjct  110  SNLLAECYRSGDLVTGQRNYTYMEAVKAHLGGWKVKLCGWIQYLNLFGVAIGYTIAASVS  169

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            MMAIKRSNCFH+SGGK+PCHMSSN YMI+FGI E+I SQIP
Sbjct  170  MMAIKRSNCFHKSGGKDPCHMSSNGYMISFGIAEVIFSQIP  210



>ref|XP_009388107.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  MLLFS V YYT
Sbjct  15   KCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPIAMLLFSFVTYYT  74

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LLADCYR+GDP  GKR YTYMD VR+NL G++VK+CG +QY N+ G+AIGYTIAASIS
Sbjct  75   SALLADCYRSGDPNTGKRNYTYMDTVRANLDGFKVKLCGYLQYLNIVGVAIGYTIAASIS  134

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+AI+RSNCFH++G  +PC ++SNPYMI FG+ EII SQIP
Sbjct  135  MVAIERSNCFHKNGDDSPCQVNSNPYMIMFGVAEIIFSQIP  175



>ref|XP_004156002.1| PREDICTED: amino acid permease 4-like [Cucumis sativus]
Length=467

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P+      DDDG P+RTGT WTASAHIITAVIGSGVLSLAWAI QLGW+AGPSVM+LF+ 
Sbjct  5    PVNDSASFDDDGCPKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMILFAF  64

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            + YYTS LLADCYR+GDPV GKR  TYM AVRS LG   +  CG++QY NL GI IGYTI
Sbjct  65   IGYYTSCLLADCYRSGDPVNGKRNPTYMHAVRSLLGETHMVACGIMQYINLIGITIGYTI  124

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FGI+EIILSQIP
Sbjct  125  ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMLSFGIVEIILSQIP  170



>ref|XP_011046334.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
 ref|XP_011046342.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=511

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 146/186 (78%), Gaps = 9/186 (5%)
 Frame = +2

Query  80   RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  232
            RH+L V +           P     K  DDDGR +RTG  WT+S+HIITAVIGSGVLSLA
Sbjct  24   RHYLEVEVQPKVSESEAINPQSNYSKCFDDDGRLKRTGNFWTSSSHIITAVIGSGVLSLA  83

Query  233  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQV  412
            WAI QLGWVAGP+VM+LF+ V  YTS LLA CYR+GDPV G+R YTYMDAV+S LGG +V
Sbjct  84   WAIAQLGWVAGPAVMVLFAFVNLYTSNLLAQCYRSGDPVTGQRNYTYMDAVKSYLGGRKV  143

Query  413  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  592
             +CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH SGGK+PCHMS N +MI FGIIEI
Sbjct  144  MLCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHSSGGKDPCHMSCNGFMITFGIIEI  203

Query  593  ILSQIP  610
            + SQIP
Sbjct  204  LFSQIP  209



>ref|XP_004289864.1| PREDICTED: amino acid permease 4-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 151/193 (78%), Gaps = 11/193 (6%)
 Frame = +2

Query  62   AATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  208
            A  + H  RH+L V +           P     K  DDDGR +RTGT WT+++HIITAVI
Sbjct  16   AVEERHDVRHYLQVEVQPKVGESEAINPQSNYSKCFDDDGRLKRTGTFWTSTSHIITAVI  75

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWAI QLGWVAGP+V+ LF+ V  YTS LLA CYRAGDPV G+R YTYMDAV+
Sbjct  76   GSGVLSLAWAIAQLGWVAGPTVLALFAIVNLYTSNLLAMCYRAGDPVTGQRNYTYMDAVK  135

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            +NLGG +V +CGL+QY NLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN YM
Sbjct  136  ANLGGRRVMLCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSNGYM  195

Query  569  IAFGIIEIILSQI  607
            I FGIIE+I SQI
Sbjct  196  ITFGIIEVIFSQI  208



>gb|KHN19623.1| Amino acid permease 3 [Glycine soja]
Length=478

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
            +    VS D     G K  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAWAI QLGW+
Sbjct  6    KQTFEVSNDTLQQGGSKSFDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWL  65

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP VM+LFS V YYTSTLLA CYR+GD + GKR YTY  AVRSNLGG  V  CG +QY 
Sbjct  66   AGPIVMILFSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYA  125

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NLFG+AIGYTIAASISMMA+KRSNC+H SGGKNPC M+SN YMI++G+ EII SQIP
Sbjct  126  NLFGVAIGYTIAASISMMAVKRSNCYHSSGGKNPCKMNSNWYMISYGVAEIIFSQIP  182



>ref|XP_006596218.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006596219.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=479

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
            +    VS D     G K  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAWAI QLGW+
Sbjct  7    KQTFEVSNDTLQQGGSKSFDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWL  66

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP VM+LFS V YYTSTLLA CYR+GD + GKR YTY  AVRSNLGG  V  CG +QY 
Sbjct  67   AGPIVMILFSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYA  126

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NLFG+AIGYTIAASISMMA+KRSNC+H SGGKNPC M+SN YMI++G+ EII SQIP
Sbjct  127  NLFGVAIGYTIAASISMMAVKRSNCYHSSGGKNPCKMNSNWYMISYGVAEIIFSQIP  183



>ref|XP_009145052.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145053.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145054.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 emb|CDY43854.1| BnaA05g18660D [Brassica napus]
Length=487

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  268
            LGVS+D  P       D+DGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GWV GP
Sbjct  11   LGVSMDVLPRNSSDLFDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGP  70

Query  269  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLF  448
            +VM+LFS V YYTS LL  CYR+GD V GKR YTYMDA+ SNLGG +VKICG++QY NLF
Sbjct  71   AVMILFSLVTYYTSILLCTCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLF  130

Query  449  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            G AIGYTIA+++SM+AI+R++C   +G K+PCH++ NPYMIAFG+I+I+ SQIP
Sbjct  131  GTAIGYTIASAVSMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGVIQIVFSQIP  184



>ref|XP_007224395.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
 gb|EMJ25594.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
Length=483

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 149/191 (78%), Gaps = 7/191 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            MG+         HH     VS++     G K +DDDGRP+RTGTVWT+SAHIITAVIGSG
Sbjct  1    MGDHTTTRNLQLHHNPVFDVSLNVRG--GSKYIDDDGRPKRTGTVWTSSAHIITAVIGSG  58

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWAI QLGW+AGP VM+LFS + YYTSTLLA CYR  DPV GKR YTY DAVRSNL
Sbjct  59   VLSLAWAIAQLGWIAGPVVMVLFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNL  116

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            G  QVK C  +Q   L G+ IGYTIAA+ISM+AIKRSNC+H+SGGKNPCH+++NPYMIAF
Sbjct  117  GELQVKFCASVQNVVLIGVTIGYTIAAAISMVAIKRSNCYHKSGGKNPCHINNNPYMIAF  176

Query  578  GIIEIILSQIP  610
            GI EI+LSQIP
Sbjct  177  GISEIVLSQIP  187



>ref|XP_006646758.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=508

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +2

Query  137  DDDGR-PQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTST  313
            DDDGR P+RTGTVWTA++HIITAVIGSGVLSLAWAI QLGWV GP+VMLLF+ V+Y+TS 
Sbjct  48   DDDGRAPRRTGTVWTAASHIITAVIGSGVLSLAWAIAQLGWVVGPAVMLLFALVIYFTSN  107

Query  314  LLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMM  493
            LLADCYR GDP  G+R YTYMDAV++NLGG +VK+CG IQY NL G+AIGYTIAASISMM
Sbjct  108  LLADCYRTGDPATGRRNYTYMDAVKANLGGAKVKVCGCIQYLNLLGVAIGYTIAASISMM  167

Query  494  AIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            A++RSNCFH  G K+PCH SSN YMI FGI+++  SQIP
Sbjct  168  AMERSNCFHAKGAKDPCHASSNVYMIVFGIVQVFFSQIP  206



>ref|XP_008377748.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=514

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 153/195 (78%), Gaps = 13/195 (7%)
 Frame = +2

Query  62   AATKNH--RHHLGVSIDAPPLYGFKGL----------DDDGRPQRTGTVWTASAHIITAV  205
            A  + H  RH+L V +  P +   K +          DDDGR +RTGT WT+++HIITAV
Sbjct  19   AVEERHDIRHYLQVEVQ-PKVSESKAINPQSNYSTCFDDDGRLKRTGTFWTSASHIITAV  77

Query  206  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAV  385
            IGSGVLSLAWAI QLGWVAGP+V+LLF+ V  YTS LLA CYR G+P+ G+R YTYMDAV
Sbjct  78   IGSGVLSLAWAIAQLGWVAGPTVLLLFAFVNLYTSNLLAMCYRTGNPITGQRNYTYMDAV  137

Query  386  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  565
            ++NLGG +V +CGL+QY NLFG+AIGYTIA+S+SMMAIKRSNC+H SGG++PCHMSSN Y
Sbjct  138  KANLGGRKVMMCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHRSGGRDPCHMSSNGY  197

Query  566  MIAFGIIEIILSQIP  610
            MI FGIIE+I SQIP
Sbjct  198  MITFGIIEVIFSQIP  212



>gb|EEC68963.1| hypothetical protein OsI_37697 [Oryza sativa Indica Group]
Length=482

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = +2

Query  44   QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
             M     A +     + VS++A        LDDDGR +RTGT WTASAHIITAVIGSGVL
Sbjct  3    DMASGQKAKQQVMKPMEVSVEAGNAGDAAWLDDDGRARRTGTFWTASAHIITAVIGSGVL  62

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWAI QLGWVAGP+VMLLF+ V+YYTSTLLA+CYR GDP  GKR YTYMDAVR+NLGG
Sbjct  63   SLAWAIAQLGWVAGPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGG  122

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
             +V  CG+IQY NL G+AIGYTIA+SISM AI+R+ CFH +G  +PC  SSNPYMI FG+
Sbjct  123  AKVTFCGVIQYANLVGVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGV  182

Query  584  IEIILSQIP  610
            ++I+ SQIP
Sbjct  183  VQIVFSQIP  191



>ref|XP_008219720.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=483

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 151/190 (79%), Gaps = 5/190 (3%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLY--GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            MG+    T+N + H     D   +   G K +DDDGRP+RTGTVWT+SAHIITAVIGSGV
Sbjct  1    MGDHTT-TRNLQLHHNPVFDVSLIVQGGSKYIDDDGRPKRTGTVWTSSAHIITAVIGSGV  59

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWA+ QLGW+AGP VM++FS + YYTSTLLA CYR  DPV GKR YTY DAVRSNLG
Sbjct  60   LSLAWAVAQLGWIAGPVVMVMFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNLG  117

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
              QVK CG +Q   L G+ IGYTIAA+ISM+AIKRSNC+H+SGGKNPCH+++NPYMIAFG
Sbjct  118  ELQVKFCGSVQNVVLTGVTIGYTIAAAISMVAIKRSNCYHKSGGKNPCHINNNPYMIAFG  177

Query  581  IIEIILSQIP  610
            I EI+LSQIP
Sbjct  178  ISEILLSQIP  187



>ref|XP_004977213.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=477

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = +2

Query  74   NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  253
            NH   + VS++A      + LDDDGRP+RTGT WTAS+HIITAVIGSGVLSLAWAI QLG
Sbjct  8    NHVAPMEVSVEAGNAGAAEWLDDDGRPRRTGTFWTASSHIITAVIGSGVLSLAWAIAQLG  67

Query  254  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQ  433
            WVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLGG +V  CG+IQ
Sbjct  68   WVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVVFCGVIQ  127

Query  434  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            Y NL G+AIGYTIA+SISM AI+R++CFH +G  +PC  SS PYMI FG+++I+ SQIP
Sbjct  128  YANLVGVAIGYTIASSISMRAIRRADCFHTNGHADPCKSSSTPYMILFGVVQILFSQIP  186



>ref|XP_006422618.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
 gb|ESR35858.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
Length=512

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
            + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34   KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+R YTYMDAV++NLGG +V  CGLIQY 
Sbjct  94   AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIP
Sbjct  154  NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIP  210



>ref|XP_004977210.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=480

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 146/182 (80%), Gaps = 3/182 (2%)
 Frame = +2

Query  74   NHRHHLG---VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  244
            N+ H +    VS++A      + LDDDGRP+RTGT WTASAHIITAVIGSGVLSLAWAI 
Sbjct  8    NNMHEVAPMEVSVEAGNFQDAERLDDDGRPRRTGTFWTASAHIITAVIGSGVLSLAWAIA  67

Query  245  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICG  424
            QLGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLGG +V  CG
Sbjct  68   QLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVVFCG  127

Query  425  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  604
            +IQY NL G+AIGYTIA+SISM AI+R++CFH +G  +PC  SS PYMI FG+++I+ SQ
Sbjct  128  VIQYANLVGVAIGYTIASSISMRAIRRADCFHTNGHADPCKSSSTPYMILFGVVQILFSQ  187

Query  605  IP  610
            IP
Sbjct  188  IP  189



>gb|KDO68035.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=512

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
            + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34   KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+R YTYMDAV++NLGG +V  CGLIQY 
Sbjct  94   AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIP
Sbjct  154  NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIP  210



>ref|XP_006486755.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=512

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +2

Query  80   RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  259
            + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34   KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  260  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYF  439
            AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+R YTYMDAV++NLGG +V  CGLIQY 
Sbjct  94   AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  440  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIP
Sbjct  154  NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIP  210



>ref|XP_003578826.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
Length=479

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   AATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  241
            AA K     + VS++A        LDDDGRP+R+GT WTASAHIITAVIGSGVLSLAWAI
Sbjct  2    AAGKKLVSPMEVSVEAGNADQASWLDDDGRPRRSGTFWTASAHIITAVIGSGVLSLAWAI  61

Query  242  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKIC  421
             QLGWVAGP+VMLLF+ V+YYTSTLLA+CYR GDP  GKR YTYMDAVR+NLGG +V  C
Sbjct  62   AQLGWVAGPAVMLLFAAVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGGRVVFC  121

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            G+IQY NL G+AIGYTIA+SISM AI+R+ CFH +G   PC  SSNPYMI FG+++I+ S
Sbjct  122  GVIQYANLVGVAIGYTIASSISMRAIRRAGCFHANGHGVPCKSSSNPYMILFGLVQIVFS  181

Query  602  QIP  610
            QIP
Sbjct  182  QIP  184



>emb|CDY36017.1| BnaA08g04440D [Brassica napus]
Length=481

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +2

Query  74   NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  253
             +R  LG+SID  P       D+DGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+G
Sbjct  6    KNRQELGISIDVLPRNSSDLFDEDGRVKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIG  65

Query  254  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQ  433
            WV GP VM+LFS V YYTS LL  CYR+GD V GKR YTYMDA+ SNLGG +VK+CG++Q
Sbjct  66   WVGGPVVMILFSLVTYYTSILLCACYRSGDSVTGKRNYTYMDAIHSNLGGIKVKLCGVVQ  125

Query  434  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            Y NLFG AIGYTIA++ISM+AI+R++C   +G K+PCH++ NPYMIAFG I+II SQIP
Sbjct  126  YVNLFGTAIGYTIASAISMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGAIQIIFSQIP  184



>dbj|BAK02045.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91867.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  134  LDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTST  313
            +DDDGRP+R+GT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTST
Sbjct  30   MDDDGRPRRSGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAAVIYYTST  89

Query  314  LLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMM  493
            LLA+CYR GDP  GKR YTYMDAVRSNLGG +V  CG+IQY NL G+AIGYTIA+SISM 
Sbjct  90   LLAECYRTGDPATGKRNYTYMDAVRSNLGGPKVIFCGVIQYANLVGVAIGYTIASSISMR  149

Query  494  AIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            AI+R++CFH +G  +PC  SSNPYMI FG+++I+ SQIP
Sbjct  150  AIRRADCFHANGHADPCKSSSNPYMILFGLVQIVFSQIP  188



>gb|KHG27248.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=468

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 142/188 (76%), Gaps = 16/188 (9%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  226
            MGE  A  KNH H+  +  D P      G DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEKGAV-KNHLHN-NLVFDHP-----IGFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  53

Query  227  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGY  406
            LAWA  QLGW+A P+VM LFS V  YTSTLLA CYR  DPV GKR YTYMDA        
Sbjct  54   LAWATAQLGWIASPAVMFLFSFVTDYTSTLLAACYRCDDPVNGKRNYTYMDA--------  105

Query  407  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  586
             VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH S GKNPCHM+SNPYMI FGI 
Sbjct  106  -VKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASRGKNPCHMNSNPYMIGFGIA  164

Query  587  EIILSQIP  610
            EII SQIP
Sbjct  165  EIIFSQIP  172



>ref|XP_003578825.1| PREDICTED: amino acid permease 4-like [Brachypodium distachyon]
Length=479

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +2

Query  62   AATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  241
            AA K     + VS++A        LDDDGRP+R+GT WTASAHIITAVIGSGVLSLAWAI
Sbjct  2    AAGKKLVSPMEVSVEAGNADQASWLDDDGRPRRSGTFWTASAHIITAVIGSGVLSLAWAI  61

Query  242  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKIC  421
             QLGWVAGP+VMLLF+ V+YYTSTLLA+CYR GDP  GKR YTYMDAVR+NLGG +V  C
Sbjct  62   AQLGWVAGPAVMLLFAAVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGGRVVFC  121

Query  422  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  601
            G+IQY NL G+AIGYTIA+SISM AI+R+ CFH +G   PC  SSNPYMI FG+++I+ S
Sbjct  122  GVIQYANLVGVAIGYTIASSISMRAIRRAGCFHANGHGVPCKSSSNPYMILFGLVQIVFS  181

Query  602  QIP  610
            QIP
Sbjct  182  QIP  184



>ref|XP_007041865.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007041866.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97696.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97697.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=512

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 149/187 (80%), Gaps = 10/187 (5%)
 Frame = +2

Query  80   RHHLGVSIDA----------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSL  229
            RH+L V +            P     K  DDDGR +RTGT WTA++HIITAVIGSGVLSL
Sbjct  24   RHYLQVEVQPKAQNESEAMDPQANHSKCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSL  83

Query  230  AWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQ  409
            AWAI QLGWVAGP+V++LF+ V  YTS LL +CYR+GDP+ G+R YTYM+AV+++LGG++
Sbjct  84   AWAIAQLGWVAGPTVLVLFAFVNLYTSNLLTECYRSGDPITGQRNYTYMEAVKAHLGGWK  143

Query  410  VKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIE  589
            VK+CG IQY NLFG+A+GYTIAAS+SMMAIKR+NC H+SGG +PCHMSSN YMI+FGI E
Sbjct  144  VKLCGWIQYLNLFGVAVGYTIAASVSMMAIKRANCLHKSGGTDPCHMSSNGYMISFGIAE  203

Query  590  IILSQIP  610
            +I SQIP
Sbjct  204  VIFSQIP  210



>ref|XP_009339433.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=484

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 152/195 (78%), Gaps = 14/195 (7%)
 Frame = +2

Query  47   MGESAAATKNHR--HH-----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  205
            M E+ A T+N    HH     + +++D     G K +DDDGRP+RTGTVWTAS+HIITAV
Sbjct  1    MSENTA-TRNQLQLHHNPVFDVSLNVDG----GSKYIDDDGRPKRTGTVWTASSHIITAV  55

Query  206  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAV  385
            IGSGVLSLAWAI QLGW+AGP+ M +FS + YYTSTLL  CYR  DPV GKR Y+Y DAV
Sbjct  56   IGSGVLSLAWAIAQLGWIAGPAAMAIFSFITYYTSTLLTSCYR--DPVTGKRNYSYSDAV  113

Query  386  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  565
            +S LG +QVK+CG +Q  NLFGI IGYT+AA+ISMMAIKRSN FH SGGK+PCH++ NPY
Sbjct  114  QSTLGEFQVKMCGFVQQLNLFGITIGYTVAAAISMMAIKRSNYFHNSGGKDPCHINYNPY  173

Query  566  MIAFGIIEIILSQIP  610
            MIAFG  EIILSQIP
Sbjct  174  MIAFGTSEIILSQIP  188



>ref|XP_008442267.1| PREDICTED: amino acid permease 4-like [Cucumis melo]
Length=466

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  113  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  292
            P+     LDDDG P+RTGT WTASAHIIT VIGSGVLSLAWAI QLGW+ GPSVMLLF+ 
Sbjct  5    PVNDSASLDDDGHPKRTGTFWTASAHIITTVIGSGVLSLAWAIAQLGWIVGPSVMLLFAF  64

Query  293  VVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  472
            + YYTS LLADCYR+GDP+ GKR +TYM AVRS LG   +  CG++Q  NL GI IGYTI
Sbjct  65   IGYYTSCLLADCYRSGDPLNGKRNHTYMHAVRSLLGEAHMVACGVMQNINLIGITIGYTI  124

Query  473  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FG++EIILSQIP
Sbjct  125  ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMVSFGVLEIILSQIP  170



>ref|XP_004977211.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=477

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +2

Query  74   NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  253
             H   + VS++A      + LDDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLG
Sbjct  8    KHVAPMEVSVEAGNGGAAEWLDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLG  67

Query  254  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQ  433
            WVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLGG +V  CG+IQ
Sbjct  68   WVAGPAAMLLFAFVTYYTATLLAECYRTGDPDTGKRNYTYMDAVRSNLGGAKVAFCGIIQ  127

Query  434  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            Y NL G+AIGYTIA+SISM AI+R+ CFH++G   PC  SSNPYMI FGI +I+ SQIP
Sbjct  128  YANLVGVAIGYTIASSISMQAIRRAGCFHKNGHGVPCKSSSNPYMILFGITQILFSQIP  186



>ref|NP_001066316.1| Os12g0181500 [Oryza sativa Japonica Group]
 gb|ABA95951.1| amino acid transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29335.1| Os12g0181500 [Oryza sativa Japonica Group]
 gb|EAZ19852.1| hypothetical protein OsJ_35437 [Oryza sativa Japonica Group]
 dbj|BAG87933.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93965.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  268
            + VS++A        LDDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP
Sbjct  11   MEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  70

Query  269  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLF  448
            +VMLLF+ V+YYTSTLLA+CYR GDP  GKR YTYMDAVR+NLGG +V  CG+IQY NL 
Sbjct  71   AVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYANLV  130

Query  449  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            G+AIGYTIA+SISM AI+R+ CFH +G  +PC  SSNPYMI FG+++I+ SQIP
Sbjct  131  GVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGVVQIVFSQIP  184



>ref|XP_009604405.1| PREDICTED: amino acid permease 4-like [Nicotiana tomentosiformis]
Length=512

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTGT WTA++HIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LF+ V+ YT
Sbjct  50   KCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFAFVILYT  109

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LL+ CYR GDP  G R +TYM+AV+  LGG +VK+CGLIQY NLFG+AIGYTIAAS+S
Sbjct  110  SNLLSQCYRTGDPANGPRNHTYMEAVKGILGGKKVKVCGLIQYLNLFGVAIGYTIAASVS  169

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+AIKRSNCFH+S  ++PCHMSSN YMIAFG+IEI+ SQIP
Sbjct  170  MLAIKRSNCFHKSHRRDPCHMSSNGYMIAFGVIEILFSQIP  210



>gb|EAY82481.1| hypothetical protein OsI_37698 [Oryza sativa Indica Group]
Length=475

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  268
            + VS++A        LDDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP
Sbjct  11   MEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  70

Query  269  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLF  448
            +VMLLF+ V+YYTSTLLA+CYR GDP  GKR YTYMDAVR+NLGG +V  CG+IQY NL 
Sbjct  71   AVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYANLV  130

Query  449  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            G+AIGYTIA+SISM AI+R+ CFH +G  +PC  SSNPYMI FG+++I+ SQIP
Sbjct  131  GVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGVVQIVFSQIP  184



>ref|XP_004977212.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=481

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 147/190 (77%), Gaps = 2/190 (1%)
 Frame = +2

Query  47   MGESAAATKNHR--HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M   +    NH     + VS++A      + LDDDGRP+RTGT WTAS+HIITAVIGSGV
Sbjct  1    MAAHSGLNSNHAVVAPMEVSVEAGNAGAAEWLDDDGRPRRTGTFWTASSHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLG
Sbjct  61   LSLAWAIAQLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLG  120

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +V  CG+IQY NL G+AIGYTIA+SISM AI+R++CFH++G  +PC  SS PYMI FG
Sbjct  121  GAKVVFCGIIQYANLVGVAIGYTIASSISMKAIRRADCFHKNGHGDPCESSSTPYMILFG  180

Query  581  IIEIILSQIP  610
            I EI+ SQIP
Sbjct  181  ITEILFSQIP  190



>ref|XP_002442926.1| hypothetical protein SORBIDRAFT_08g005000 [Sorghum bicolor]
 gb|EES16764.1| hypothetical protein SORBIDRAFT_08g005000 [Sorghum bicolor]
Length=482

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  268
            + VS++A        LDDDGRP+RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP
Sbjct  18   MEVSVEAGNAGAAAWLDDDGRPRRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  77

Query  269  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLF  448
            + MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLGG +V  CG+IQY NL 
Sbjct  78   TAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVVFCGIIQYANLV  137

Query  449  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            G+AIGYTIA+SISM AI+R+ CFH  G ++PC  SS PYMI FG++EI+ SQIP
Sbjct  138  GVAIGYTIASSISMKAIRRAGCFHSHGHEDPCKSSSTPYMILFGVVEILFSQIP  191



>ref|XP_003630316.1| Amino acid permease [Medicago truncatula]
 gb|AET04792.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=475

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  137  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  316
            DDDGR +RTG+VWTAS+HIITAVIGSGVLSLAWAI QLGW+AGP+VM+LFS V   TS+ 
Sbjct  25   DDDGRLKRTGSVWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTVSTSSF  84

Query  317  LADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  496
            LADCYRAGDP  GKR YTYMDAVRS LGG +V  CG+ QY NLFGI IGYTIAASISM A
Sbjct  85   LADCYRAGDPHSGKRNYTYMDAVRSILGGAKVTFCGIFQYLNLFGIVIGYTIAASISMTA  144

Query  497  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            IK+SNCFH+ G K+PCHMSSN YMI FG+I+I LSQIP
Sbjct  145  IKKSNCFHQHGDKSPCHMSSNLYMIMFGVIQIFLSQIP  182



>ref|XP_002442925.1| hypothetical protein SORBIDRAFT_08g004990 [Sorghum bicolor]
 gb|EES16763.1| hypothetical protein SORBIDRAFT_08g004990 [Sorghum bicolor]
Length=481

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = +2

Query  41   MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  220
            M M      T  H   + VS++A      + LDDDGRP+RTGT WTASAHIITAVIGSGV
Sbjct  1    MAMASHNGGTTKHLPPMEVSMEAGNGDAAEYLDDDGRPRRTGTFWTASAHIITAVIGSGV  60

Query  221  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLG  400
            LSLAWAI QLGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLG
Sbjct  61   LSLAWAIAQLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPDTGKRNYTYMDAVRSNLG  120

Query  401  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  580
            G +V  CG IQY NL G+AIGYTIA+SISM AI R+ CFH+ G   PC  SSNPYMI FG
Sbjct  121  GARVAFCGCIQYANLVGVAIGYTIASSISMQAISRAGCFHKRGHAVPCKSSSNPYMILFG  180

Query  581  IIEIILSQIP  610
             ++I+ SQIP
Sbjct  181  AVQILFSQIP  190



>gb|AFW56244.1| hypothetical protein ZEAMMB73_131551 [Zea mays]
Length=477

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 144/185 (78%), Gaps = 3/185 (2%)
 Frame = +2

Query  65   ATKNHRHHLG---VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAW  235
            A+ N   HL    VS++A    G + LDDDGRP+RTGT WTASAHIITAVIGSGVLSLAW
Sbjct  2    ASHNGTKHLAPMEVSVEAGNGGGAEWLDDDGRPRRTGTFWTASAHIITAVIGSGVLSLAW  61

Query  236  AIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVK  415
            AI QLGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLGG +V 
Sbjct  62   AIAQLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPDTGKRNYTYMDAVRSNLGGAKVA  121

Query  416  ICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEII  595
             CG IQY NL G+AIGYTIA+SISM A+ R+ CFH+ G   PC  SSNPYMI FG ++I+
Sbjct  122  FCGAIQYANLVGVAIGYTIASSISMQAVSRAGCFHKRGHAVPCKSSSNPYMILFGAVQIL  181

Query  596  LSQIP  610
             SQIP
Sbjct  182  FSQIP  186



>ref|XP_006578773.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006578774.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
 gb|KHN31183.1| Amino acid permease 2 [Glycine soja]
Length=486

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 148/194 (76%), Gaps = 7/194 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGF------KGLDDDGRPQRTGTVWTASAHIITAVI  208
            M E ++ T N  HH    ++A  + G       K  DDDG  +RTG VWT S+HIITAV+
Sbjct  1    MVEKSSRT-NLGHHQDFGMEAYSIDGVSSQSESKFYDDDGHVKRTGNVWTTSSHIITAVV  59

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWA+ Q+GWVAGP VM+ FS V  YT++LLADCYR GDPV GKR YT+MDAV+
Sbjct  60   GSGVLSLAWAMAQMGWVAGPVVMIFFSAVTLYTTSLLADCYRCGDPVTGKRNYTFMDAVQ  119

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            S LGGY    CG++QY NL+G A+GYTIAASISMMAIKRSNCFH SG KNPCH+SSNPYM
Sbjct  120  SILGGYYDTFCGVVQYSNLYGTAVGYTIAASISMMAIKRSNCFHSSGVKNPCHVSSNPYM  179

Query  569  IAFGIIEIILSQIP  610
            I FGII+I+ SQIP
Sbjct  180  IGFGIIQILFSQIP  193



>ref|XP_008662536.1| PREDICTED: amino acid permease 3-like [Zea mays]
 gb|AFW56241.1| hypothetical protein ZEAMMB73_107595 [Zea mays]
Length=480

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            +K+    L VS++A      + LDDDGRP+RTGT WTASAHI+TAVIGSGVLSLAWAI Q
Sbjct  9    SKHGVAPLEVSVEAGNGGAAEWLDDDGRPRRTGTFWTASAHIVTAVIGSGVLSLAWAIAQ  68

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGL  427
            LGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLGG +V  CG+
Sbjct  69   LGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVAFCGV  128

Query  428  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            IQY NL G+AIGYTIAASISM A++R+ CFH  G  +PC+ SS PYMI FG+++I+ SQI
Sbjct  129  IQYANLVGVAIGYTIAASISMKAVRRAGCFHAHGHADPCNSSSTPYMILFGVVQILFSQI  188

Query  608  P  610
            P
Sbjct  189  P  189



>ref|XP_007226332.1| hypothetical protein PRUPE_ppa022253mg [Prunus persica]
 gb|EMJ27531.1| hypothetical protein PRUPE_ppa022253mg [Prunus persica]
Length=483

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 148/191 (77%), Gaps = 7/191 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  217
            MG+  A      HH     VS++     G   +DDDGRP+RTGTVWT+SAHIITAVIGSG
Sbjct  1    MGDHTATGNLQLHHNPVFDVSLNVQE--GSNYIDDDGRPKRTGTVWTSSAHIITAVIGSG  58

Query  218  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNL  397
            VLSLAWA+ QLGW+AGP VM+LFS + YYTSTLLA CYR  DPV GKR YTY DAVRSNL
Sbjct  59   VLSLAWAMAQLGWIAGPIVMVLFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNL  116

Query  398  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  577
            G  QVK CG +Q   LFGI+IG+ IAA+ISM+AI+R NC H+SGGKNPCH++ NPYMIAF
Sbjct  117  GALQVKFCGSVQNVALFGISIGFNIAAAISMVAIQRCNCNHKSGGKNPCHININPYMIAF  176

Query  578  GIIEIILSQIP  610
            GI EI+LSQIP
Sbjct  177  GISEILLSQIP  187



>ref|XP_010090330.1| hypothetical protein L484_024995 [Morus notabilis]
 gb|EXB39300.1| hypothetical protein L484_024995 [Morus notabilis]
Length=511

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 143/185 (77%), Gaps = 9/185 (5%)
 Frame = +2

Query  80   RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  232
            RH+L V +           P     K  DDDGR +RTGT WTA++HIITAVIGSGVLSLA
Sbjct  24   RHYLQVEVQPKASEAEAINPQSNYSKCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLA  83

Query  233  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQV  412
            WA+ QLGWV GP VMLLF+ V  YTS LLA CYR GD V G+R YTYM+AV++NLGG + 
Sbjct  84   WAVAQLGWVTGPIVMLLFAFVNLYTSNLLAQCYRTGDRVTGQRNYTYMEAVKANLGGKRT  143

Query  413  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  592
             +CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH+SGGK+PCHMSSN YMI FGI EI
Sbjct  144  MLCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHKSGGKDPCHMSSNGYMITFGISEI  203

Query  593  ILSQI  607
            I SQI
Sbjct  204  IFSQI  208



>gb|KHF99365.1| Amino acid permease 2 [Gossypium arboreum]
Length=332

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 141/189 (75%), Gaps = 11/189 (6%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGV-SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  223
            MGE  A  K H H+  V  +   P  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGEKCAG-KTHLHNNQVFDLSVLPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  224  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGG  403
            SLAWA  QLGW+A P+VM LFS V  YTSTLLA CYR  DPV GKR YTYMDA       
Sbjct  60   SLAWATAQLGWIASPAVMFLFSFVTDYTSTLLAACYRCDDPVNGKRNYTYMDA-------  112

Query  404  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  583
              VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFHESGGKNP HM+S+P  IA GI
Sbjct  113  --VKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHESGGKNPFHMNSSPCRIALGI  170

Query  584  IEIILSQIP  610
             EII SQ+P
Sbjct  171  AEIIFSQVP  179



>dbj|BAK03497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51007.2| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VMLLFS V YYT
Sbjct  33   KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMLLFSLVTYYT  92

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S+LL+DCYR+GD   GKR YTYMDAV +NL G +V++CG +QY N+ G+AIGYTIAASIS
Sbjct  93   SSLLSDCYRSGDETTGKRNYTYMDAVNANLSGIKVQLCGFLQYANIVGVAIGYTIAASIS  152

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+AIK++NCFH  G  NPCH+SS PYMI FG+ EI  SQIP
Sbjct  153  MLAIKKANCFHVKGHVNPCHISSTPYMIIFGVAEIFFSQIP  193



>ref|XP_006581782.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 gb|KHN09640.1| Amino acid permease 2 [Glycine soja]
Length=486

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 149/194 (77%), Gaps = 7/194 (4%)
 Frame = +2

Query  47   MGESAAATKNHRHHLGVSIDAPPLYGF------KGLDDDGRPQRTGTVWTASAHIITAVI  208
            M E ++ T N  HH    ++   + G       K  DDDG  +RTGTVWT S+HIITAV+
Sbjct  1    MVEKSSRT-NLSHHQDFGMEPYSIDGVSSQTNSKFYDDDGHVKRTGTVWTTSSHIITAVV  59

Query  209  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVR  388
            GSGVLSLAWA+ Q+GWVAGP+VM+ FS V  YT++LLADCYR GDPV GKR YT+MDAV+
Sbjct  60   GSGVLSLAWAMAQMGWVAGPAVMIFFSVVTLYTTSLLADCYRCGDPVTGKRNYTFMDAVQ  119

Query  389  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  568
            S LGGY    CG++QY NL+G A+GYTIAASISMMAIKRSNCFH SGGK+PC +SSNPYM
Sbjct  120  SILGGYYDAFCGVVQYSNLYGTAVGYTIAASISMMAIKRSNCFHSSGGKSPCQVSSNPYM  179

Query  569  IAFGIIEIILSQIP  610
            I FGII+I+ SQIP
Sbjct  180  IGFGIIQILFSQIP  193



>ref|XP_006581783.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=469

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDG  +RTGTVWT S+HIITAV+GSGVLSLAWA+ Q+GWVAGP+VM+ FS V  YT
Sbjct  16   KFYDDDGHVKRTGTVWTTSSHIITAVVGSGVLSLAWAMAQMGWVAGPAVMIFFSVVTLYT  75

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            ++LLADCYR GDPV GKR YT+MDAV+S LGGY    CG++QY NL+G A+GYTIAASIS
Sbjct  76   TSLLADCYRCGDPVTGKRNYTFMDAVQSILGGYYDAFCGVVQYSNLYGTAVGYTIAASIS  135

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            MMAIKRSNCFH SGGK+PC +SSNPYMI FGII+I+ SQIP
Sbjct  136  MMAIKRSNCFHSSGGKSPCQVSSNPYMIGFGIIQILFSQIP  176



>ref|NP_001142349.1| hypothetical protein [Zea mays]
 ref|XP_008672537.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672538.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672539.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF88256.1| unknown [Zea mays]
 tpg|DAA56510.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=494

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDGRP+R GT+WTASAHIITAVIGSGVLSL WAI QLGWVAGP VMLLFS V YYT
Sbjct  34   KCFDDDGRPKRNGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPVVMLLFSLVTYYT  93

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S+LLADCYR+GDP  GKR YTYMDAV +NL G +V+ICG +QY N+ G+AIGYTIAASIS
Sbjct  94   SSLLADCYRSGDPSTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  153

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            M+AI+R+NCFH+ G  NPC +SS PYMI FG+ EI  SQIP
Sbjct  154  MLAIRRANCFHQKGHGNPCKISSTPYMIIFGVAEIFFSQIP  194



>gb|AFW56242.1| hypothetical protein ZEAMMB73_107595, partial [Zea mays]
Length=492

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  68   TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  247
            +K+    L VS++A      + LDDDGRP+RTGT WTASAHI+TAVIGSGVLSLAWAI Q
Sbjct  9    SKHGVAPLEVSVEAGNGGAAEWLDDDGRPRRTGTFWTASAHIVTAVIGSGVLSLAWAIAQ  68

Query  248  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGL  427
            LGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKR YTYMDAVRSNLGG +V  CG+
Sbjct  69   LGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVAFCGV  128

Query  428  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  607
            IQY NL G+AIGYTIAASISM A++R+ CFH  G  +PC+ SS PYMI FG+++I+ SQI
Sbjct  129  IQYANLVGVAIGYTIAASISMKAVRRAGCFHAHGHADPCNSSSTPYMILFGVVQILFSQI  188

Query  608  P  610
            P
Sbjct  189  P  189



>ref|NP_001066317.1| Os12g0181600 [Oryza sativa Japonica Group]
 gb|ABA95955.1| amino acid transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29336.1| Os12g0181600 [Oryza sativa Japonica Group]
 dbj|BAG87950.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97363.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +2

Query  89   LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  268
            + VS++A        LDDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP
Sbjct  11   MEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  70

Query  269  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLF  448
            +VMLLF+ V+YYTSTLLA+CYR GDP  GKR YTYMDAVR+NLGG +V  CG+IQY NL 
Sbjct  71   AVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYANLV  130

Query  449  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            G+AIGYTIA+SISM AI+R+ CFH +G  +PC  SSNPYMI FG ++I+ SQIP
Sbjct  131  GVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGAVQIVFSQIP  184



>ref|XP_002534252.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF28130.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  128  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  307
            K  DDDG  +RTGT WTA++HIITAVIG GVLSLAWAI QLGW+AGP+VM+LF+ V  YT
Sbjct  22   KCYDDDGHSKRTGTFWTAASHIITAVIGPGVLSLAWAIAQLGWIAGPAVMVLFAIVNLYT  81

Query  308  STLLADCYRAGDPVFGKRKYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  487
            S LLA CYRAGDPV G+  YTYM+AV++NLGG +V  CGLIQY NLFG+ IGYTIAAS+S
Sbjct  82   SNLLAQCYRAGDPVTGQINYTYMEAVKANLGGRKVFFCGLIQYLNLFGVVIGYTIAASVS  141

Query  488  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  610
            MMAIKRSNCFH SGGK+PCHMSSN YMI FGI E+I SQIP
Sbjct  142  MMAIKRSNCFHASGGKDPCHMSSNGYMITFGIAEVIFSQIP  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230