BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN005D04

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAG10403.1|AF233284_1  mannose-binding lectin                      99.0    2e-22   Convolvulus arvensis
gb|AAC49564.1|  lectin                                                89.4    9e-19   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...  89.4    1e-18   Calystegia sepium
dbj|BAA14024.1|  ipomoelin                                            85.1    3e-17   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...  85.1    4e-17   Ipomoea batatas [batate]
gb|EEC68267.1|  hypothetical protein OsI_36302                        88.6    2e-16   Oryza sativa Indica Group [Indian rice]
gb|ABA93998.1|  NB-ARC domain containing protein, expressed           86.3    9e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52195.1|  hypothetical protein OsJ_34074                        86.3    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663483.1|  PREDICTED: probable disease resistance RPP8-...  84.0    6e-15   
gb|EEC68269.1|  hypothetical protein OsI_36304                        83.6    8e-15   Oryza sativa Indica Group [Indian rice]
gb|EEE52196.1|  hypothetical protein OsJ_34075                        83.2    9e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94002.1|  Jacalin-like lectin domain containing protein, ex...  83.2    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663484.1|  PREDICTED: putative disease resistance RPP13...  82.0    2e-14   
gb|ACF87628.1|  unknown                                               76.3    4e-14   Zea mays [maize]
ref|NP_001106057.1|  PL3K2                                            75.9    6e-14   Zea mays [maize]
gb|ACG29554.1|  hypothetical protein                                  75.9    7e-14   Zea mays [maize]
ref|NP_001066367.1|  Os12g0198700                                     76.6    2e-13   
gb|EMT18893.1|  Disease resistance protein RPM1                       79.0    2e-13   
ref|NP_001066495.1|  Os12g0247700                                     75.9    4e-13   
gb|EEC69076.1|  hypothetical protein OsI_37951                        75.1    4e-13   Oryza sativa Indica Group [Indian rice]
gb|EAY82651.1|  hypothetical protein OsI_37872                        75.5    4e-13   Oryza sativa Indica Group [Indian rice]
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           75.5    5e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008677996.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.4    5e-13   Zea mays [maize]
ref|XP_008677991.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.4    5e-13   
ref|XP_008677992.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.4    5e-13   
ref|XP_008677998.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.4    5e-13   Zea mays [maize]
ref|XP_008677994.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.4    5e-13   Zea mays [maize]
ref|XP_008677990.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.4    6e-13   
ref|XP_008677986.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.4    6e-13   
ref|XP_004168675.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    8e-13   
ref|XP_008677993.1|  PREDICTED: mannose/glucose-specific lectin-l...  76.3    1e-12   
gb|EMS66150.1|  hypothetical protein TRIUR3_12251                     73.9    2e-12   Triticum urartu
ref|XP_008677995.1|  PREDICTED: mannose/glucose-specific lectin-l...  75.9    2e-12   
ref|XP_004152769.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12   
ref|XP_006647196.1|  PREDICTED: disease resistance protein RPM1-l...  75.1    3e-12   Oryza brachyantha
ref|XP_006647195.1|  PREDICTED: disease resistance protein RPM1-l...  75.1    3e-12   Oryza brachyantha
ref|XP_011463712.1|  PREDICTED: jacalin-related lectin 3-like         74.3    4e-12   Fragaria vesca subsp. vesca
gb|KGN62634.1|  hypothetical protein Csa_2G362470                     74.3    5e-12   Cucumis sativus [cucumbers]
gb|AFW60405.1|  putative protein kinase superfamily protein           73.9    7e-12   
ref|XP_004982894.1|  PREDICTED: salt stress-induced protein-like      70.1    7e-12   
ref|XP_008444758.1|  PREDICTED: LOW QUALITY PROTEIN: myrosinase-b...  73.9    7e-12   
ref|XP_010273654.1|  PREDICTED: mannose/glucose-specific lectin-like  70.1    8e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004980504.1|  PREDICTED: protein GOS9-like                     69.3    1e-11   
gb|EMT23136.1|  hypothetical protein F775_18655                       68.9    1e-11   
gb|AAA87041.1|  putative 32.6 kDa jasmonate-induced protein           71.2    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002440163.1|  hypothetical protein SORBIDRAFT_09g027055        70.1    1e-11   
gb|EMT07650.1|  Horcolin                                              70.5    3e-11   
gb|AAR20919.1|  jasmonate-induced protein                             70.1    4e-11   Triticum aestivum [Canadian hard winter wheat]
gb|EMT24046.1|  hypothetical protein F775_25349                       70.1    4e-11   
gb|EMS55842.1|  hypothetical protein TRIUR3_32339                     69.7    4e-11   Triticum urartu
gb|ABS82785.1|  jasmonate-induced protein                             69.7    4e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004297619.2|  PREDICTED: agglutinin                            70.9    6e-11   Fragaria vesca subsp. vesca
ref|XP_002449838.1|  hypothetical protein SORBIDRAFT_05g024220        68.9    7e-11   
ref|XP_004960459.1|  PREDICTED: salt stress-induced protein-like      67.4    7e-11   Setaria italica
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  71.2    8e-11   Nicotiana sylvestris
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  71.2    8e-11   Nicotiana sylvestris
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  71.2    8e-11   Nicotiana sylvestris
ref|XP_009589464.1|  PREDICTED: agglutinin-like                       69.7    9e-11   Nicotiana tomentosiformis
gb|EMT11070.1|  hypothetical protein F775_02114                       69.3    1e-10   
ref|XP_006662244.1|  PREDICTED: uncharacterized protein LOC102708001  68.9    1e-10   
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  70.9    1e-10   Nicotiana sylvestris
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  70.9    1e-10   Nicotiana sylvestris
ref|XP_003573652.1|  PREDICTED: horcolin-like                         65.5    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  70.5    1e-10   Nicotiana sylvestris
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  70.1    2e-10   Nicotiana tomentosiformis
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  70.1    2e-10   Nicotiana tomentosiformis
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  70.1    2e-10   Nicotiana tomentosiformis
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  70.1    2e-10   Nicotiana tomentosiformis
ref|NP_001148448.1|  jasmonate-induced protein                        66.6    2e-10   
gb|EEE60695.1|  hypothetical protein OsJ_14181                        64.7    2e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDM80625.1|  unnamed protein product                              67.8    3e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  69.3    3e-10   Nicotiana sylvestris
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   Nicotiana sylvestris
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   Nicotiana sylvestris
gb|EEC72970.1|  hypothetical protein OsI_06866                        68.9    4e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAD23250.1|  putative LZ-NBS-LRR class RGA                        68.9    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010230396.1|  PREDICTED: jacalin-related lectin 3-like         66.6    4e-10   Brachypodium distachyon [annual false brome]
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  68.9    4e-10   Nicotiana sylvestris
ref|XP_009768586.1|  PREDICTED: jacalin-related lectin 3-like         65.9    4e-10   Nicotiana sylvestris
tpg|DAA60181.1|  TPA: hypothetical protein ZEAMMB73_326702            67.0    5e-10   
ref|XP_006663456.1|  PREDICTED: disease resistance protein RPM1-like  68.6    5e-10   
gb|EAZ25557.1|  hypothetical protein OsJ_09383                        64.3    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232946.1|  PREDICTED: uncharacterized protein LOC104583002  65.9    6e-10   
gb|EAY80990.1|  hypothetical protein OsI_36172                        68.2    7e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004291831.1|  PREDICTED: jacalin-related lectin 3              67.8    7e-10   Fragaria vesca subsp. vesca
ref|NP_001052399.1|  Os04g0295400                                     64.3    7e-10   
sp|Q5U9T2.1|LECH_HORVU  RecName: Full=Horcolin; AltName: Full=Agg...  64.3    8e-10   Hordeum vulgare [barley]
gb|EMT07330.1|  Disease resistance protein RPM1                       67.8    9e-10   
gb|EAY96520.1|  hypothetical protein OsI_18424                        63.9    9e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_006853911.1|  hypothetical protein AMTR_s00036p00183970        63.5    9e-10   
gb|EAZ01021.1|  hypothetical protein OsI_23055                        67.4    1e-09   Oryza sativa Indica Group [Indian rice]
gb|EAY93469.1|  hypothetical protein OsI_15270                        63.9    1e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001054618.1|  Os05g0143600                                     63.5    1e-09   
ref|NP_001148739.1|  LOC100282355                                     64.3    1e-09   Zea mays [maize]
ref|XP_007215056.1|  hypothetical protein PRUPE_ppa012210mg           63.9    1e-09   
gb|EMS58273.1|  hypothetical protein TRIUR3_17900                     65.9    1e-09   Triticum urartu
ref|XP_008348486.1|  PREDICTED: agglutinin alpha chain-like           63.9    1e-09   Malus domestica [apple tree]
ref|XP_008654965.1|  PREDICTED: LOC100282355 isoform X4               64.3    1e-09   Zea mays [maize]
ref|XP_004235622.1|  PREDICTED: jacalin-related lectin 19             64.3    1e-09   Solanum lycopersicum
ref|XP_008244775.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  65.9    1e-09   
ref|XP_006343016.1|  PREDICTED: agglutinin-like                       63.9    2e-09   Solanum tuberosum [potatoes]
ref|XP_002440568.1|  hypothetical protein SORBIDRAFT_09g003330        62.8    2e-09   
ref|XP_004960703.1|  PREDICTED: agglutinin-like                       65.5    2e-09   Setaria italica
ref|XP_008244753.1|  PREDICTED: agglutinin-like                       63.5    2e-09   Prunus mume [ume]
ref|XP_008654963.1|  PREDICTED: LOC100282355 isoform X3               64.3    2e-09   
ref|XP_002450764.1|  hypothetical protein SORBIDRAFT_05g017250        67.0    2e-09   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  67.0    2e-09   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  67.0    2e-09   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  67.0    2e-09   
ref|XP_008654962.1|  PREDICTED: LOC100282355 isoform X2               64.3    2e-09   Zea mays [maize]
ref|XP_008654961.1|  PREDICTED: LOC100282355 isoform X1               64.3    2e-09   
ref|XP_006654724.1|  PREDICTED: agglutinin-like                       63.5    2e-09   
ref|NP_001056189.1|  Os05g0541800                                     62.8    2e-09   
dbj|BAK00987.1|  predicted protein                                    65.1    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004964114.1|  PREDICTED: mannose/glucose-specific lectin-like  62.4    2e-09   
ref|XP_009784520.1|  PREDICTED: uncharacterized protein LOC104232941  66.2    2e-09   Nicotiana sylvestris
ref|XP_006662272.1|  PREDICTED: uncharacterized protein LOC102701759  64.7    3e-09   Oryza brachyantha
gb|AAM46813.1|  hessian fly response gene 1 protein                   65.1    3e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008651439.1|  PREDICTED: jasmonate-induced protein isoform X1  64.7    3e-09   
ref|XP_010232948.1|  PREDICTED: jacalin-related lectin 19-like        64.3    3e-09   
gb|AHW81907.1|  mannose-binding lectin                                62.8    3e-09   Morus alba var. atropurpurea
ref|XP_009338132.1|  PREDICTED: uncharacterized protein LOC103930...  65.9    3e-09   Pyrus x bretschneideri [bai li]
ref|NP_001141303.1|  uncharacterized protein LOC100273394             64.7    3e-09   
ref|XP_004977415.1|  PREDICTED: uncharacterized protein LOC101784...  64.3    4e-09   Setaria italica
gb|AAL10685.1|  mannose-binding lectin                                62.4    4e-09   Morus nigra
ref|XP_004979670.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.5    5e-09   Setaria italica
ref|XP_004979671.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.5    5e-09   
ref|XP_004979669.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.5    5e-09   
ref|XP_009622525.1|  PREDICTED: agglutinin-like isoform X2            65.1    5e-09   
gb|KJB58185.1|  hypothetical protein B456_009G198200                  65.5    5e-09   Gossypium raimondii
ref|XP_011081586.1|  PREDICTED: jacalin-related lectin 19-like        63.9    5e-09   
ref|XP_009622524.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.1    5e-09   Nicotiana tomentosiformis
ref|XP_008806712.1|  PREDICTED: agglutinin-like isoform X2            62.4    5e-09   Phoenix dactylifera
ref|XP_008806706.1|  PREDICTED: agglutinin-like isoform X1            62.4    5e-09   Phoenix dactylifera
gb|AFW81812.1|  putative protein kinase superfamily protein           64.7    5e-09   
emb|CAE76026.1|  B1292H11.12                                          62.4    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006301377.1|  hypothetical protein CARUB_v10021789mg           62.0    6e-09   
ref|XP_008656248.1|  PREDICTED: putative receptor-like protein ki...  64.7    6e-09   Zea mays [maize]
ref|XP_002439182.1|  hypothetical protein SORBIDRAFT_09g001880        63.9    6e-09   Sorghum bicolor [broomcorn]
emb|CAD40628.2|  OSJNBa0016N04.16                                     64.7    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EMS51533.1|  hypothetical protein TRIUR3_05238                     63.9    6e-09   Triticum urartu
ref|XP_002461768.1|  hypothetical protein SORBIDRAFT_02g007760        64.3    6e-09   
ref|XP_009367509.1|  PREDICTED: agglutinin alpha chain                62.0    7e-09   Pyrus x bretschneideri [bai li]
ref|XP_006651478.1|  PREDICTED: horcolin-like                         61.6    7e-09   
gb|KJB58186.1|  hypothetical protein B456_009G198200                  65.1    7e-09   Gossypium raimondii
gb|ABA94728.1|  Jacalin-like lectin domain containing protein         64.7    7e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001104964.1|  beta-glucosidase aggregating factor precursor    63.5    7e-09   
ref|XP_003577374.2|  PREDICTED: mannose/glucose-specific lectin-l...  64.7    8e-09   
gb|ABF96452.1|  Jacalin-like lectin domain containing protein, ex...  61.6    8e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ABJ97445.1|  beta-glucosidase aggregating factor 1                 63.5    8e-09   Zea mays [maize]
ref|XP_007216928.1|  hypothetical protein PRUPE_ppa016643mg           63.9    8e-09   
ref|NP_001052560.1|  Os04g0369100                                     64.7    8e-09   
gb|EEE60834.1|  hypothetical protein OsJ_14451                        64.7    8e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009400545.1|  PREDICTED: agglutinin alpha chain                62.0    9e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001068257.2|  Os11g0607900                                     60.5    9e-09   
gb|AAK55472.1|AC084295_5  putative salt-induced protein               61.6    9e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467725.1|  hypothetical protein SORBIDRAFT_01g033090        61.2    9e-09   
ref|XP_010092355.1|  hypothetical protein L484_023733                 61.6    9e-09   
ref|XP_010237569.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.3    1e-08   
ref|XP_006372713.1|  hypothetical protein POPTR_0017s043602g          61.2    1e-08   
ref|NP_001050311.2|  Os03g0399800                                     61.6    1e-08   
sp|P83304.1|LEC_PARPC  RecName: Full=Mannose/glucose-specific lectin  63.9    1e-08   Parkia platycephala
gb|AAZ73664.1|  At1g19715                                             61.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ73661.1|  At1g19715                                             61.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
pdb|1XXQ|A  Chain A, Structure Of A Mannose-Specific Jacalin-Rela...  61.2    1e-08   Morus nigra
ref|XP_008804538.1|  PREDICTED: uncharacterized protein LOC103717797  63.9    1e-08   
ref|XP_004984089.1|  PREDICTED: protein GOS9-like                     60.8    1e-08   Setaria italica
gb|AAZ73652.1|  At1g19715                                             61.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466548.1|  PREDICTED: agglutinin-like                       63.5    1e-08   Cucumis melo [Oriental melon]
ref|XP_006390600.1|  hypothetical protein EUTSA_v10019210mg           60.8    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_009588771.1|  PREDICTED: agglutinin-like                       63.2    1e-08   Nicotiana tomentosiformis
gb|EMS53468.1|  hypothetical protein TRIUR3_21407                     60.5    1e-08   Triticum urartu
ref|XP_004986922.1|  PREDICTED: horcolin-like                         60.1    2e-08   
gb|ABA94721.1|  Jacalin-like lectin domain containing protein         63.5    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_177447.1|  Mannose-binding lectin superfamily protein          60.8    2e-08   
gb|AAZ73669.1|  At1g19715-like protein                                60.8    2e-08   Arabidopsis lyrata [lyrate rockcress]
ref|XP_002510452.1|  pentatricopeptide repeat-containing protein,...  63.9    2e-08   
ref|XP_009391787.1|  PREDICTED: agglutinin-like                       62.0    2e-08   
ref|XP_002300741.2|  hypothetical protein POPTR_0002s03180g           63.2    2e-08   
gb|AFW74546.1|  hypothetical protein ZEAMMB73_667809                  60.1    2e-08   
ref|XP_010471351.1|  PREDICTED: jacalin-related lectin 19             60.5    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004974871.1|  PREDICTED: mannose/glucose-specific lectin-like  61.6    2e-08   
ref|XP_008648490.1|  PREDICTED: salt stress-induced protein-like      60.1    2e-08   Zea mays [maize]
emb|CDP17400.1|  unnamed protein product                              62.4    2e-08   Coffea canephora [robusta coffee]
gb|ABA94732.1|  Jacalin-like lectin domain containing protein, ex...  62.8    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008348484.1|  PREDICTED: agglutinin-like isoform X2            60.1    3e-08   
ref|XP_010459648.1|  PREDICTED: jacalin-related lectin 3 isoform X1   62.8    3e-08   
gb|EEC79620.1|  hypothetical protein OsI_20824                        60.5    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_011030089.1|  PREDICTED: jacalin-related lectin 19             60.5    3e-08   Populus euphratica
ref|XP_009398855.1|  PREDICTED: protein GOS9-like                     59.7    3e-08   
gb|EAY90359.1|  hypothetical protein OsI_11939                        59.7    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_008348483.1|  PREDICTED: agglutinin-like isoform X1            60.5    3e-08   
ref|XP_010236764.1|  PREDICTED: jacalin-related lectin 19-like        60.1    3e-08   
gb|EEE52450.1|  hypothetical protein OsJ_34606                        62.0    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  63.2    3e-08   Nicotiana sylvestris
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  63.2    3e-08   Nicotiana sylvestris
ref|XP_008466552.1|  PREDICTED: agglutinin-like                       59.7    3e-08   Cucumis melo [Oriental melon]
gb|AAQ07258.1|  jacalin-like lectin                                   59.3    3e-08   Ananas comosus
ref|XP_006853910.1|  hypothetical protein AMTR_s00036p00183430        60.1    3e-08   
gb|EMT07336.1|  hypothetical protein F775_29709                       62.0    3e-08   
gb|KHG26998.1|  Agglutinin                                            62.4    3e-08   Gossypium arboreum [tree cotton]
ref|XP_006306414.1|  hypothetical protein CARUB_v10012347mg           62.8    4e-08   
ref|XP_010030255.1|  PREDICTED: agglutinin-like                       62.0    4e-08   Eucalyptus grandis [rose gum]
ref|XP_006853909.1|  hypothetical protein AMTR_s00036p00182710        60.1    4e-08   
pdb|4MQ0|A  Chain A, Crystal Structure Of Parkia Biglobosa Seed L...  62.0    4e-08   Parkia biglobosa
gb|EEE59214.1|  hypothetical protein OsJ_11170                        61.6    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477195.1|  PREDICTED: jacalin-related lectin 3-like iso...  62.4    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010498396.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006372325.1|  Mannose/glucose-specific lectin family protein   62.0    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  62.4    5e-08   Nicotiana sylvestris
gb|KDO84683.1|  hypothetical protein CISIN_1g007083mg                 62.0    5e-08   Citrus sinensis [apfelsine]
gb|KDO84682.1|  hypothetical protein CISIN_1g007083mg                 62.0    5e-08   Citrus sinensis [apfelsine]
ref|XP_004961574.1|  PREDICTED: mannose/glucose-specific lectin-like  62.0    6e-08   
ref|XP_009622527.1|  PREDICTED: agglutinin-like isoform X4            61.6    6e-08   
ref|XP_009622526.1|  PREDICTED: agglutinin-like isoform X3            61.6    6e-08   
tpg|DAA39774.1|  TPA: hypothetical protein ZEAMMB73_034611            58.9    6e-08   
ref|XP_009622528.1|  PREDICTED: agglutinin-like isoform X5            61.6    6e-08   Nicotiana tomentosiformis
ref|XP_002888904.1|  predicted protein                                59.3    6e-08   
ref|XP_004164005.1|  PREDICTED: agglutinin-like                       58.9    7e-08   
ref|XP_004961357.1|  PREDICTED: agglutinin-like                       59.7    7e-08   Setaria italica
gb|KCW56701.1|  hypothetical protein EUGRSUZ_I02393                   61.6    7e-08   Eucalyptus grandis [rose gum]
ref|XP_008391447.1|  PREDICTED: uncharacterized protein LOC103453663  61.2    7e-08   
ref|XP_010088386.1|  hypothetical protein L484_008121                 59.3    7e-08   Morus notabilis
ref|XP_011001797.1|  PREDICTED: mannose/glucose-specific lectin-l...  61.2    7e-08   Populus euphratica
ref|XP_010100192.1|  hypothetical protein L484_015337                 58.5    7e-08   
ref|XP_010533565.1|  PREDICTED: jacalin-related lectin 3 isoform X1   61.6    7e-08   Tarenaya hassleriana [spider flower]
ref|NP_001176790.1|  Os12g0144100                                     57.4    8e-08   
ref|XP_010477196.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010029744.1|  PREDICTED: jacalin-related lectin 4-like         61.6    8e-08   Eucalyptus grandis [rose gum]
ref|XP_010533571.1|  PREDICTED: jacalin-related lectin 3 isoform X2   61.2    8e-08   Tarenaya hassleriana [spider flower]
ref|XP_002318228.2|  hypothetical protein POPTR_0012s13320g           59.7    8e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010924946.1|  PREDICTED: jacalin-related lectin 19-like is...  59.3    8e-08   Elaeis guineensis
ref|XP_004960702.1|  PREDICTED: mannose/glucose-specific lectin-like  60.5    8e-08   
ref|XP_009127966.1|  PREDICTED: agglutinin                            58.9    9e-08   Brassica rapa
gb|EEE60415.1|  hypothetical protein OsJ_13609                        57.8    9e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.6    9e-08   
ref|XP_011028923.1|  PREDICTED: jacalin-related lectin 3-like iso...  61.2    9e-08   Populus euphratica
ref|XP_002510454.1|  hypothetical protein RCOM_1595950                61.2    9e-08   
ref|XP_010924945.1|  PREDICTED: jacalin-related lectin 19-like is...  58.9    9e-08   Elaeis guineensis
ref|XP_003576339.1|  PREDICTED: jacalin-related lectin 3-like         60.5    9e-08   
ref|XP_006473572.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    9e-08   Citrus sinensis [apfelsine]
ref|NP_001140746.1|  hypothetical protein                             61.2    1e-07   Zea mays [maize]
ref|XP_002461766.1|  hypothetical protein SORBIDRAFT_02g007740        60.5    1e-07   Sorghum bicolor [broomcorn]
ref|XP_002893064.1|  hypothetical protein ARALYDRAFT_472198           61.2    1e-07   
ref|XP_006473571.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    1e-07   Citrus sinensis [apfelsine]
ref|XP_006435072.1|  hypothetical protein CICLE_v10000604mg           61.2    1e-07   Citrus clementina [clementine]
ref|XP_011028924.1|  PREDICTED: uncharacterized protein LOC105128...  61.2    1e-07   Populus euphratica
ref|XP_010026053.1|  PREDICTED: jacalin-related lectin 3-like         59.7    1e-07   
ref|XP_002440040.1|  hypothetical protein SORBIDRAFT_09g024950        60.8    1e-07   
emb|CAJ38387.1|  jacalin-domain protein                               58.9    1e-07   Plantago major [cart-track plant]
ref|XP_010690084.1|  PREDICTED: jacalin-related lectin 19             58.5    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002467724.1|  hypothetical protein SORBIDRAFT_01g033080        58.2    1e-07   
gb|KDP38344.1|  hypothetical protein JCGZ_04269                       60.8    1e-07   Jatropha curcas
ref|XP_011015046.1|  PREDICTED: mannose/glucose-specific lectin-l...  60.5    1e-07   Populus euphratica
ref|XP_008671662.1|  PREDICTED: horcolin-like                         58.5    1e-07   Zea mays [maize]
ref|XP_010239309.1|  PREDICTED: LOW QUALITY PROTEIN: protein GOS9...  59.3    1e-07   Brachypodium distachyon [annual false brome]
ref|XP_010428208.1|  PREDICTED: jacalin-related lectin 19-like is...  58.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011001798.1|  PREDICTED: mannose/glucose-specific lectin-l...  60.5    1e-07   Populus euphratica
ref|XP_006362248.1|  PREDICTED: myrosinase-binding protein-like A...  60.5    1e-07   Solanum tuberosum [potatoes]
ref|XP_006362247.1|  PREDICTED: myrosinase-binding protein-like A...  60.5    1e-07   Solanum tuberosum [potatoes]
gb|ABA96465.1|  Protein GOS9, putative                                57.4    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KCW69704.1|  hypothetical protein EUGRSUZ_F03098                   58.9    2e-07   Eucalyptus grandis [rose gum]
gb|KDP38566.1|  hypothetical protein JCGZ_04491                       60.5    2e-07   Jatropha curcas
ref|XP_010231090.1|  PREDICTED: jacalin-related lectin 19-like is...  58.5    2e-07   Brachypodium distachyon [annual false brome]
gb|KDO58671.1|  hypothetical protein CISIN_1g037526mg                 58.2    2e-07   Citrus sinensis [apfelsine]
ref|XP_010231089.1|  PREDICTED: jacalin-related lectin 19-like is...  58.5    2e-07   Brachypodium distachyon [annual false brome]
ref|XP_009760249.1|  PREDICTED: agglutinin-like                       59.7    2e-07   Nicotiana sylvestris
ref|XP_011015045.1|  PREDICTED: mannose/glucose-specific lectin-l...  60.1    2e-07   Populus euphratica
ref|XP_011001796.1|  PREDICTED: mannose/glucose-specific lectin-l...  60.1    2e-07   Populus euphratica
gb|KFK41744.1|  hypothetical protein AALP_AA2G166700                  57.8    2e-07   Arabis alpina [alpine rockcress]
emb|CAE76030.1|  B1292H11.16                                          57.4    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006426466.1|  hypothetical protein CICLE_v10026553mg           57.8    2e-07   Citrus clementina [clementine]
ref|XP_010030903.1|  PREDICTED: agglutinin alpha chain-like           56.6    2e-07   
gb|AAC49284.1|  unknown                                               59.7    2e-07   Triticum aestivum [Canadian hard winter wheat]
gb|EMT04092.1|  hypothetical protein F775_28592                       59.7    2e-07   
ref|NP_001185041.1|  Mannose-binding lectin superfamily protein       60.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117315.1|  Mannose-binding lectin superfamily protein       60.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413293.1|  PREDICTED: protein GOS9-like                     57.0    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_849691.1|  Mannose-binding lectin superfamily protein          60.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477194.1|  PREDICTED: jacalin-related lectin 3-like iso...  60.1    2e-07   
ref|XP_010428207.1|  PREDICTED: jacalin-related lectin 19-like is...  58.2    2e-07   
ref|XP_010231088.1|  PREDICTED: jacalin-related lectin 19-like is...  58.9    2e-07   
ref|XP_010428206.1|  PREDICTED: jacalin-related lectin 19-like is...  58.2    2e-07   
ref|XP_010935305.1|  PREDICTED: jacalin-related lectin 3-like         59.7    2e-07   
ref|XP_010092351.1|  hypothetical protein L484_023729                 57.8    2e-07   
ref|XP_002515891.1|  hypothetical protein RCOM_1485780                59.7    2e-07   
ref|XP_002893063.1|  jacalin lectin family protein                    59.7    3e-07   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  60.1    3e-07   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  60.1    3e-07   
gb|EEE68468.1|  hypothetical protein OsJ_26865                        59.7    3e-07   
ref|XP_009599288.1|  PREDICTED: jacalin-related lectin 3 isoform X1   59.7    3e-07   
emb|CDY48032.1|  BnaA02g16250D                                        58.2    3e-07   
ref|XP_010062570.1|  PREDICTED: jacalin-related lectin 19             58.9    3e-07   
ref|XP_004147859.1|  PREDICTED: myrosinase-binding protein-like A...  59.3    3e-07   
ref|XP_009599289.1|  PREDICTED: jacalin-related lectin 3 isoform X2   59.7    3e-07   
gb|AAB72098.1|  32 kDa protein                                        58.9    3e-07   
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  58.9    3e-07   
ref|XP_008778289.1|  PREDICTED: mannose/glucose-specific lectin-like  58.9    3e-07   
gb|KDP38565.1|  hypothetical protein JCGZ_04490                       59.3    3e-07   
gb|AGT16237.1|  Jacalin-like lectin domain containing protein         59.3    3e-07   
ref|XP_008221341.1|  PREDICTED: uncharacterized protein LOC103321320  59.3    3e-07   
gb|EMT07556.1|  hypothetical protein F775_11805                       56.2    3e-07   
ref|XP_010110011.1|  hypothetical protein L484_021900                 59.7    4e-07   
ref|XP_006372328.1|  hypothetical protein POPTR_0017s00620g           56.6    4e-07   
ref|XP_003615697.1|  Myrosinase-binding protein-like protein          59.3    4e-07   
gb|EAY92859.1|  hypothetical protein OsI_14658                        58.2    4e-07   
gb|EMS65495.1|  hypothetical protein TRIUR3_18396                     58.9    4e-07   
gb|ADE77248.1|  unknown                                               57.0    4e-07   
gb|EYU45843.1|  hypothetical protein MIMGU_mgv1a014002mg              57.4    4e-07   
ref|XP_010060992.1|  PREDICTED: jacalin-related lectin 3              59.3    4e-07   
gb|AFW82809.1|  hypothetical protein ZEAMMB73_630227                  57.4    4e-07   
ref|XP_009602425.1|  PREDICTED: mannose/glucose-specific lectin-like  56.2    4e-07   
gb|AGT16242.1|  Jacalin-like lectin domain containing protein         59.3    4e-07   
ref|XP_010227994.1|  PREDICTED: jacalin-related lectin 3-like         58.5    4e-07   
emb|CDO97947.1|  unnamed protein product                              58.5    4e-07   
gb|KCW69706.1|  hypothetical protein EUGRSUZ_F03098                   57.8    4e-07   
ref|XP_006383724.1|  hypothetical protein POPTR_0005s25390g           58.9    4e-07   
ref|XP_009110261.1|  PREDICTED: agglutinin-like                       58.9    5e-07   
ref|XP_009413935.1|  PREDICTED: protein GOS9-like                     56.2    5e-07   
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like         59.3    5e-07   
emb|CDY63700.1|  BnaC08g19180D                                        58.9    5e-07   
gb|KHN46147.1|  Agglutinin                                            58.9    5e-07   
gb|EMT33809.1|  hypothetical protein F775_16156                       56.6    5e-07   
gb|EAY98637.1|  hypothetical protein OsI_20561                        58.9    5e-07   
ref|XP_006416472.1|  hypothetical protein EUTSA_v10007145mg           58.9    5e-07   
ref|XP_010932865.1|  PREDICTED: jacalin-related lectin 3-like iso...  57.4    5e-07   
dbj|BAJ88436.1|  predicted protein                                    58.9    5e-07   
dbj|BAJ85606.1|  predicted protein                                    58.9    5e-07   
ref|XP_003578760.1|  PREDICTED: mannose/glucose-specific lectin-like  58.2    5e-07   
gb|AAY35064.1|  lectin KM+                                            56.2    5e-07   
ref|XP_006838698.1|  hypothetical protein AMTR_s00002p00248970        56.2    6e-07   
pdb|1TOQ|A  Chain A, Crystal Structure Of A Galactose Specific Le...  55.8    6e-07   
ref|XP_010664949.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    6e-07   
ref|XP_006644795.1|  PREDICTED: mannose/glucose-specific lectin-like  58.5    6e-07   
ref|XP_002439535.1|  hypothetical protein SORBIDRAFT_09g010668        55.8    6e-07   
gb|EEE64302.1|  hypothetical protein OsJ_19139                        58.9    6e-07   
gb|AAB22274.1|  jacalin heavy chain, agglutinin heavy chain=Thoms...  55.8    6e-07   
ref|NP_001055995.1|  Os05g0508400                                     58.5    7e-07   
ref|XP_011048833.1|  PREDICTED: jacalin-related lectin 3-like iso...  58.5    7e-07   
ref|XP_010654564.1|  PREDICTED: jacalin-related lectin 19-like        56.6    7e-07   
ref|XP_011048832.1|  PREDICTED: jacalin-related lectin 3-like iso...  58.5    7e-07   
ref|XP_009771019.1|  PREDICTED: jacalin-related lectin 3 isoform X1   58.5    7e-07   
ref|XP_007024409.1|  Mannose-binding lectin superfamily protein       57.8    7e-07   
ref|XP_003575754.1|  PREDICTED: uncharacterized protein LOC100829827  58.2    7e-07   
ref|XP_009771020.1|  PREDICTED: jacalin-related lectin 3 isoform X2   58.5    7e-07   
emb|CBI19765.3|  unnamed protein product                              58.5    7e-07   
ref|XP_007222058.1|  hypothetical protein PRUPE_ppa003185mg           58.5    7e-07   
gb|KJB63589.1|  hypothetical protein B456_010G007400                  58.5    8e-07   
ref|XP_006654618.1|  PREDICTED: myrosinase-binding protein-like A...  58.2    8e-07   
gb|KCW56858.1|  hypothetical protein EUGRSUZ_I02520                   58.5    8e-07   
emb|CDX96652.1|  BnaA08g21950D                                        58.2    8e-07   
pdb|3P8S|A  Chain A, Crystal Structure Of Single Chain Recombinan...  55.8    8e-07   
gb|AAY35063.1|  lectin KM+                                            55.5    8e-07   
ref|XP_009391798.1|  PREDICTED: agglutinin-like                       56.2    8e-07   
gb|AFW84361.1|  putative protein kinase superfamily protein           58.2    9e-07   
ref|XP_010932856.1|  PREDICTED: mannose/glucose-specific lectin-l...  57.4    9e-07   
ref|XP_010029904.1|  PREDICTED: jacalin-related lectin 4-like         58.5    9e-07   
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  58.5    9e-07   
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  58.5    9e-07   
ref|XP_008656997.1|  PREDICTED: cysteine-rich receptor-like prote...  58.2    9e-07   
ref|XP_007146775.1|  hypothetical protein PHAVU_006G068800g           58.2    9e-07   
pdb|4AKD|A  Chain A, High Resolution Structure Of Mannose Binding...  55.5    9e-07   
emb|CBI35988.3|  unnamed protein product                              56.6    9e-07   
emb|CDM80401.1|  unnamed protein product                              57.4    1e-06   
emb|CDX82115.1|  BnaC02g21750D                                        57.0    1e-06   
ref|XP_010537548.1|  PREDICTED: LOW QUALITY PROTEIN: jacalin-rela...  55.8    1e-06   
ref|NP_001042994.2|  Os01g0355100                                     55.1    1e-06   
gb|EAY73967.1|  hypothetical protein OsI_01851                        55.1    1e-06   
gb|EMT31922.1|  hypothetical protein F775_02779                       55.8    1e-06   
gb|EMT07446.1|  hypothetical protein F775_10439                       57.0    1e-06   
gb|EMS47225.1|  hypothetical protein TRIUR3_25909                     57.4    1e-06   
gb|ABS86033.1|  mannose-specific recombinant lectin                   55.1    1e-06   
sp|P82859.1|LECA_CASCR  RecName: Full=Agglutinin; AltName: Full=CCA   57.0    1e-06   
ref|XP_007017646.1|  Mannose-binding lectin superfamily protein, ...  57.8    1e-06   
ref|XP_004490606.1|  PREDICTED: mannose/glucose-specific lectin-l...  57.4    1e-06   
gb|ABC70328.1|  agglutinin isoform                                    57.0    1e-06   
ref|XP_004490607.1|  PREDICTED: mannose/glucose-specific lectin-l...  57.4    1e-06   
ref|XP_007017648.1|  Mannose-binding lectin superfamily protein, ...  57.4    2e-06   
gb|ACN33395.1|  unknown                                               57.0    2e-06   
gb|KHG23822.1|  Agglutinin alpha chain                                55.5    2e-06   
pdb|1VBP|A  Chain A, Crystal Structure Of Artocarpin-Mannopentose...  54.7    2e-06   
pdb|1VBO|A  Chain A, Crystal Structure Of Artocarpin-Mannotriose ...  54.7    2e-06   
emb|CDM80828.1|  unnamed protein product                              54.7    2e-06   
gb|ACR38528.1|  unknown                                               55.8    2e-06   
sp|P18670.2|LECA_ARTIN  RecName: Full=Agglutinin alpha chain; Alt...  54.3    2e-06   
emb|CDM86052.1|  unnamed protein product                              57.0    2e-06   
ref|XP_011074623.1|  PREDICTED: jacalin-related lectin 3              57.4    2e-06   
pdb|1UGW|A  Chain A, Crystal Structure Of Jacalin- Gal Complex        54.3    2e-06   
pdb|1J4S|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  54.7    2e-06   
pdb|1J4T|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  54.7    2e-06   
ref|XP_011001803.1|  PREDICTED: mannose/glucose-specific lectin-like  57.0    2e-06   
ref|XP_002461765.1|  hypothetical protein SORBIDRAFT_02g007735        54.3    2e-06   
ref|NP_001044410.1|  Os01g0775500                                     56.6    2e-06   
ref|XP_010110012.1|  hypothetical protein L484_021901                 57.0    2e-06   
ref|XP_010675832.1|  PREDICTED: mannose/glucose-specific lectin-like  54.7    2e-06   
gb|KDP40814.1|  hypothetical protein JCGZ_24813                       55.5    2e-06   
ref|XP_008388156.1|  PREDICTED: uncharacterized protein LOC103450568  57.0    2e-06   
ref|XP_004249154.1|  PREDICTED: jacalin-related lectin 3 isoform X2   57.0    2e-06   
ref|XP_007142199.1|  hypothetical protein PHAVU_008G260500g           57.0    2e-06   
ref|XP_010312054.1|  PREDICTED: jacalin-related lectin 3 isoform X1   57.0    2e-06   
gb|EEC71570.1|  hypothetical protein OsI_03937                        57.0    2e-06   
gb|ACF78865.1|  unknown                                               56.2    2e-06   
gb|KJB70346.1|  hypothetical protein B456_011G068300                  55.1    2e-06   
ref|XP_007142198.1|  hypothetical protein PHAVU_008G260500g           56.6    2e-06   
emb|CDP07465.1|  unnamed protein product                              57.0    2e-06   
gb|EEE55471.1|  hypothetical protein OsJ_03649                        57.0    3e-06   
emb|CDM86063.1|  unnamed protein product                              57.0    3e-06   
ref|XP_010064569.1|  PREDICTED: jacalin-related lectin 4-like         57.0    3e-06   
ref|XP_006838705.1|  hypothetical protein AMTR_s00002p00249920        56.6    3e-06   
ref|XP_009614721.1|  PREDICTED: jacalin-related lectin 19             55.5    3e-06   
gb|EAY82243.1|  hypothetical protein OsI_37448                        56.2    3e-06   
gb|AAB23126.1|  jacalin minor alpha'-subunit=65 kda lectin minor ...  53.9    3e-06   
ref|XP_010267066.1|  PREDICTED: jacalin-related lectin 19             55.1    3e-06   
ref|XP_010109960.1|  hypothetical protein L484_009242                 55.1    3e-06   
gb|EEE54522.1|  hypothetical protein OsJ_01681                        52.8    3e-06   
gb|AFW74848.1|  hypothetical protein ZEAMMB73_609032                  53.9    3e-06   
ref|NP_001042975.1|  Os01g0348800                                     53.1    3e-06   
gb|EMS47771.1|  hypothetical protein TRIUR3_34363                     53.5    4e-06   
ref|NP_001142347.1|  uncharacterized protein LOC100274518             55.8    4e-06   
gb|KHN02073.1|  Agglutinin                                            56.2    4e-06   
dbj|BAD52599.1|  putative salT                                        55.5    4e-06   
pdb|4AKB|A  Chain A, Structure Of Galactose Binding Lectin From C...  53.5    4e-06   
pdb|4AK4|A  Chain A, High Resolution Structure Of Galactose Bindi...  53.5    4e-06   
gb|EYU34206.1|  hypothetical protein MIMGU_mgv1a025615mg              55.8    4e-06   
ref|XP_003597652.1|  Agglutinin alpha chain                           56.2    5e-06   
ref|XP_010674585.1|  PREDICTED: uncharacterized protein LOC104890703  56.2    5e-06   
ref|XP_006602089.1|  PREDICTED: agglutinin-like                       55.8    5e-06   
ref|NP_001174671.1|  Os06g0226050                                     53.5    5e-06   
gb|KDP26963.1|  hypothetical protein JCGZ_22259                       55.5    5e-06   
ref|XP_002461767.1|  hypothetical protein SORBIDRAFT_02g007750        55.5    5e-06   
gb|ABI24164.1|  beta-glucosidase aggregating factor                   55.5    5e-06   
gb|AAA32679.1|  jacalin                                               54.7    5e-06   
ref|XP_003561042.1|  PREDICTED: jacalin-related lectin 3-like         55.5    5e-06   
ref|XP_009336846.1|  PREDICTED: uncharacterized protein LOC103929382  55.8    5e-06   
gb|ABS86034.1|  mannose-binding lectin                                53.1    6e-06   
ref|NP_001183767.1|  hypothetical protein                             53.5    6e-06   
emb|CAA72271.1|  jasmonate inducible protein                          55.8    6e-06   
emb|CDM86053.1|  unnamed protein product                              55.5    6e-06   
dbj|BAM00996.1|  hypothetical protein CLDAP_29560                     55.1    6e-06   
emb|CDY43099.1|  BnaC05g36780D                                        55.8    6e-06   
gb|EMT29229.1|  B3 domain-containing protein                          55.8    6e-06   
emb|CDM83580.1|  unnamed protein product                              55.1    7e-06   
gb|AAA32678.1|  jacalin                                               54.3    7e-06   
gb|AAL09163.1|  galactose-binding lectin                              54.3    7e-06   
pdb|1X1V|A  Chain A, Structure Of Banana Lectin- Methyl-Alpha-Man...  52.8    7e-06   
gb|AAA32680.1|  jacalin                                               54.3    7e-06   
gb|EMT16343.1|  Cysteine-rich receptor-like protein kinase 41         55.5    8e-06   
gb|KFK44089.1|  hypothetical protein AALP_AA1G214700                  55.5    8e-06   
ref|XP_010029921.1|  PREDICTED: jacalin-related lectin 4-like iso...  55.5    8e-06   
gb|KCW67999.1|  hypothetical protein EUGRSUZ_F01690                   55.5    8e-06   
gb|ABA94727.1|  Jacalin-like lectin domain containing protein         53.1    8e-06   
gb|AHZ86978.1|  extracellular jacalin-like lectin                     52.8    8e-06   
ref|XP_009388206.1|  PREDICTED: protein GOS9-like                     52.4    8e-06   
gb|KCW67998.1|  hypothetical protein EUGRSUZ_F01690                   55.5    8e-06   
ref|XP_009614655.1|  PREDICTED: mannose/glucose-specific lectin-like  52.8    9e-06   
ref|XP_010029920.1|  PREDICTED: myrosinase-binding protein 2-like...  55.5    9e-06   
ref|XP_010029918.1|  PREDICTED: jacalin-related lectin 4-like iso...  55.1    1e-05   
ref|XP_006342218.1|  PREDICTED: agglutinin-like                       54.7    1e-05   
ref|XP_009417382.1|  PREDICTED: mannose/glucose-specific lectin-like  54.7    1e-05   
gb|AFW74847.1|  hypothetical protein ZEAMMB73_609032                  53.9    1e-05   
ref|XP_010099935.1|  hypothetical protein L484_020123                 53.5    1e-05   
gb|EMT07620.1|  hypothetical protein F775_29169                       54.3    1e-05   
gb|AFW74846.1|  hypothetical protein ZEAMMB73_609032                  53.5    1e-05   
tpg|DAA39776.1|  TPA: hypothetical protein ZEAMMB73_755604            54.3    1e-05   
ref|NP_001278782.1|  uncharacterized protein LOC103164609             54.3    1e-05   
gb|ACF88449.1|  unknown                                               54.3    1e-05   
emb|CDY39357.1|  BnaC05g15300D                                        54.3    2e-05   
ref|XP_009782510.1|  PREDICTED: jacalin-related lectin 19             53.1    2e-05   
gb|AFK34206.1|  unknown                                               52.8    2e-05   
ref|XP_008677749.1|  PREDICTED: hypothetical protein isoform X1       53.9    2e-05   
gb|KCW56869.1|  hypothetical protein EUGRSUZ_I025311                  50.8    2e-05   
ref|XP_009384722.1|  PREDICTED: agglutinin alpha chain-like isofo...  52.8    2e-05   
ref|XP_009384641.1|  PREDICTED: agglutinin alpha chain-like isofo...  52.8    2e-05   
ref|XP_002985032.1|  hypothetical protein SELMODRAFT_121377           51.6    2e-05   
ref|XP_008677750.1|  PREDICTED: hypothetical protein isoform X2       53.5    2e-05   
ref|XP_002458583.1|  hypothetical protein SORBIDRAFT_03g036175        53.5    2e-05   
ref|XP_010932970.1|  PREDICTED: mannose/glucose-specific lectin-l...  52.8    2e-05   
ref|XP_011048836.1|  PREDICTED: jacalin-related lectin 3-like iso...  53.9    2e-05   
gb|EMS51477.1|  Mannose/glucose-specific lectin                       53.5    2e-05   
gb|AAA32677.1|  jacalin                                               52.8    2e-05   
ref|XP_010108457.1|  hypothetical protein L484_014128                 52.0    2e-05   
ref|XP_010320537.1|  PREDICTED: agglutinin-like                       52.0    2e-05   
gb|KEH39537.1|  mannose-binding lectin superfamily protein            52.4    2e-05   
ref|XP_010108459.1|  hypothetical protein L484_014130                 52.0    2e-05   
gb|AFW74852.1|  hypothetical protein ZEAMMB73_609032                  53.5    2e-05   
ref|XP_011048835.1|  PREDICTED: jacalin-related lectin 3-like iso...  53.9    2e-05   
ref|XP_003578759.1|  PREDICTED: mannose/glucose-specific lectin-like  53.5    2e-05   
ref|XP_010026052.1|  PREDICTED: agglutinin-like                       52.0    2e-05   
ref|XP_006376043.1|  hypothetical protein POPTR_0013s08290g           50.8    3e-05   
gb|KEH39536.1|  mannose-binding lectin superfamily protein            52.0    3e-05   
gb|EMT33622.1|  Cysteine proteinase RD21a                             53.5    3e-05   
ref|XP_010029907.1|  PREDICTED: jacalin-related lectin 3-like         50.8    3e-05   
ref|XP_004147879.1|  PREDICTED: uncharacterized protein LOC101206551  53.5    3e-05   
gb|KEH39538.1|  mannose-binding lectin superfamily protein            52.0    3e-05   
ref|XP_002883010.1|  jacalin lectin family protein                    53.5    3e-05   
ref|XP_010099937.1|  hypothetical protein L484_020125                 53.1    3e-05   
ref|XP_004979016.1|  PREDICTED: salt stress-induced protein-like      52.0    3e-05   
ref|XP_002970946.1|  hypothetical protein SELMODRAFT_17953            50.8    4e-05   
emb|CAB40792.1|  putative lectin                                      51.2    4e-05   
gb|EMT09327.1|  hypothetical protein F775_29083                       53.1    4e-05   



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G DEY+T ISGTFG +   +NVLRSIKF TN + +G YGPNV TPF+ +   GN+IVGF 
Sbjct  77   GADEYVTGISGTFGIYLD-NNVLRSIKFITNLKAYGPYGPNVGTPFSSENVVGNEIVGFL  135

Query  297  GRSGYYIDAIGTYNAP  250
            GRSGYY+DAIGTYN P
Sbjct  136  GRSGYYVDAIGTYNTP  151



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            +NI G DEYLT ISGTFG +   +NVLRSI FTTN +  G YG  V TPF+     GN+I
Sbjct  75   VNI-GTDEYLTGISGTFGIYLD-NNVLRSITFTTNLKAHGPYGQKVGTPFSSANVVGNEI  132

Query  309  VGFFGRSGYYIDAIGTYN  256
            VGF GRSGYY+DAIGTYN
Sbjct  133  VGFLGRSGYYVDAIGTYN  150



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            +NI G DEYLT ISGTFG +   +NVLRSI FTTN +  G YG  V TPF+     GN+I
Sbjct  74   VNI-GTDEYLTGISGTFGIYLD-NNVLRSITFTTNLKAHGPYGQKVGTPFSSANVVGNEI  131

Query  309  VGFFGRSGYYIDAIGTYN  256
            VGF GRSGYY+DAIGTYN
Sbjct  132  VGFLGRSGYYVDAIGTYN  149



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            +NIDG+   + EISG    +    NV+RSIKFTTN +E+G YG N  TPFN +  +GNKI
Sbjct  78   VNIDGD---IIEISGMIANYKGY-NVIRSIKFTTNKKEYGPYGANAGTPFNIKIPDGNKI  133

Query  309  VGFFGRSGYYIDAIGTY  259
            VGFFG SG+Y+DAIG Y
Sbjct  134  VGFFGNSGWYVDAIGAY  150



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            +NIDG+   + EISG    +    NV+RSIKFTTN +E+G YG N  TPFN +  +GNKI
Sbjct  84   VNIDGD---IIEISGMIANYKGY-NVIRSIKFTTNKKEYGPYGANAGTPFNIKIPDGNKI  139

Query  309  VGFFGRSGYYIDAIGTY  259
            VGFFG SG+Y+DAIG Y
Sbjct  140  VGFFGNSGWYVDAIGAY  156



>gb|EEC68267.1| hypothetical protein OsI_36302 [Oryza sativa Indica Group]
Length=1396

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E+L E+SGTFG F ++ N++ S+ F TNA+ +G YG    TPF+   Q+   IVGFF
Sbjct  1010  GPSEFLVEVSGTFGRFRAALNIITSLTFVTNAQSYGPYGQREGTPFHIPVQSSGCIVGFF  1069

Query  297   GRSGYYIDAIGTYNAP  250
             GR+G+Y+DAIG Y  P
Sbjct  1070  GRAGWYVDAIGIYVKP  1085


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E LT +SGTFG++ +S +V+ SI   TN   +G +G      FNF  Q    IVGFF
Sbjct  1165  GPSELLTTVSGTFGSYNTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFF  1224

Query  297   GRSGYYIDAIGTYNAP  250
             G +  YIDAIG Y  P
Sbjct  1225  GHAELYIDAIGVYVNP  1240


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVVTPFNFQAQNGNK  313
             IN+ G  E++T++ GTFG +     V+ S+ F  NA  ++G +G    TPF+        
Sbjct  1316  INL-GPSEFITKVHGTFGPYGEFPIVITSLTFINNAGHQYGPFGQGGGTPFHAPISGNGS  1374

Query  312   IVGFFGRSGYYIDAIGTYNAP  250
             IVGFFG  G  ++AIG Y  P
Sbjct  1375  IVGFFGHQGACLEAIGFYFRP  1395



>gb|ABA93998.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1384

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E+L E+SGTFG F ++ +++ S+ F TNA+ +G YG    TPF+   Q+   IVGFF
Sbjct  1038  GPSEFLVEVSGTFGRFRAALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGFF  1097

Query  297   GRSGYYIDAIGTYNAP  250
             GR+G+Y+DAIG Y  P
Sbjct  1098  GRAGWYVDAIGIYVKP  1113


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E LT +SGTFG++ +S +V+ SI   TN   +G +G      FNF  Q    IVGFF
Sbjct  1147  GPSELLTTVSGTFGSYNTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFF  1206

Query  297   GRSGYYIDAIGTYNAP  250
             G +  YIDAIG Y  P
Sbjct  1207  GHAELYIDAIGVYVNP  1222



>gb|EEE52195.1| hypothetical protein OsJ_34074 [Oryza sativa Japonica Group]
Length=1311

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E+L E+SGTFG F ++ +++ S+ F TNA+ +G YG    TPF+   Q+   IVGFF
Sbjct  970   GPSEFLVEVSGTFGRFRAALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGFF  1029

Query  297   GRSGYYIDAIGTYNAP  250
             GR+G+Y+DAIG Y  P
Sbjct  1030  GRAGWYVDAIGIYVKP  1045


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E LT +SGTFG++ +S +V+ SI   TN   +G +G      FNF  Q    IVGFF
Sbjct  1079  GPSELLTTVSGTFGSYNTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFF  1138

Query  297   GRSGYYIDAIGTYNAP  250
             G +  YIDAIG Y  P
Sbjct  1139  GHAELYIDAIGVYVNP  1154


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVVTPFNFQAQNGNK  313
             IN+ G  E++T++ GTFG F     V+ S+ F  NA  ++G +G    TPF+        
Sbjct  1231  INL-GPSEFITKVHGTFGPFGEFPIVITSLTFINNAGHQYGPFGQGGGTPFHAPISGNGS  1289

Query  312   IVGFFGRSGYYIDAIGTYNAP  250
             IVGFFG  G  ++AIG Y  P
Sbjct  1290  IVGFFGHQGACLEAIGFYFRP  1310



>ref|XP_006663483.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Oryza brachyantha]
Length=1368

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  468   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
             E+L E+SGTFG F ++ NV+ S+ F TNA  +G YG    TPF+   Q+   IVGFFGR+
Sbjct  984   EFLLEVSGTFGRFRTALNVMTSLTFVTNAHSYGPYGKIEGTPFHMPVQSNGCIVGFFGRA  1043

Query  288   GYYIDAIGTYNAP  250
             G+Y+DAIG Y  P
Sbjct  1044  GWYVDAIGIYVNP  1056


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -3

Query  471   DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
             +E++T + GT G++ +S +V+ SI   TN   +G +G     PF+F  Q    IVGFFG 
Sbjct  1138  EEFITSVCGTIGSYNTSFDVITSITLVTNIDCYGPFGQENGIPFHFPIQGNGSIVGFFGH  1197

Query  291   SGYYIDAIGTYNAP  250
             +  Y+DAIG Y  P
Sbjct  1198  ADIYVDAIGVYVTP  1211


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTN-AREFGTYGPNVVTPFNFQAQNGNKIVGF  301
             G  E+LT++ GTFG F     V+ S+ F +N   ++G +G    TPF+        IVGF
Sbjct  1291  GPSEFLTKVLGTFGQFDEFPIVITSLTFFSNTGHQYGPFGQGGGTPFHAPISGNGSIVGF  1350

Query  300   FGRSGYYIDAIGTYNAP  250
             FG  G  ++AIG Y  P
Sbjct  1351  FGYQGDCVEAIGFYFRP  1367



>gb|EEC68269.1| hypothetical protein OsI_36304 [Oryza sativa Indica Group]
Length=1419

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -3

Query  468   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
             E L E+SGTFG FA   N++ S+ F TN + +G +G    TPF+   Q G +IVGFFGR+
Sbjct  1047  EVLVEVSGTFGRFAGFQNIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRA  1106

Query  288   GYYIDAIGTYNAPD  247
             G+  DAIG Y  PD
Sbjct  1107  GWCFDAIGIYVNPD  1120


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNVVTPFNFQAQNGNKIVGF  301
             G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G    TPF+        IVGF
Sbjct  1342  GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGF  1401

Query  300   FGRSGYYIDAIGTY  259
             FGR G  I+A+G Y
Sbjct  1402  FGREGLCIEAVGFY  1415


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -3

Query  462   LTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRSGY  283
             +T + GT G++ +  +V+ SI   TNA  +G +G     PF+F  Q    IVGFFG +  
Sbjct  1192  ITRVYGTSGSYNTPSDVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHANL  1251

Query  282   YIDAIGTYNAP  250
             Y+DAIG Y  P
Sbjct  1252  YVDAIGVYVTP  1262



>gb|EEE52196.1| hypothetical protein OsJ_34075 [Oryza sativa Japonica Group]
Length=1431

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -3

Query  468   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
             E L E+SGTFG FA   N++ S+ F TN + +G +G    TPF+   Q G +IVGFFGR+
Sbjct  1047  EVLVEVSGTFGRFAGFQNIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRA  1106

Query  288   GYYIDAIGTYNAPD  247
             G+  DAIG Y  PD
Sbjct  1107  GWCFDAIGIYVNPD  1120


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E++T + GT G++ +  +V+ SI   TNA  +G +G     PF+F  Q    IVGFF
Sbjct  1199  GPSEFITRVYGTIGSYNTPSDVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFF  1258

Query  297   GRSGYYIDAIGTYNAP  250
             G +  Y+DAIG Y  P
Sbjct  1259  GHANLYVDAIGVYVTP  1274


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNVVTPFNFQAQNGNKIVGF  301
             G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G    TPF+        IVGF
Sbjct  1354  GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGF  1413

Query  300   FGRSGYYIDAIGTY  259
             FGR G  I+A+G Y
Sbjct  1414  FGREGLCIEAVGFY  1427



>gb|ABA94002.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1386

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -3

Query  468   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
             E L E+SGTFG FA   N++ S+ F TN + +G +G    TPF+   Q G +IVGFFGR+
Sbjct  1002  EVLVEVSGTFGRFAGFQNIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRA  1061

Query  288   GYYIDAIGTYNAPD  247
             G+  DAIG Y  PD
Sbjct  1062  GWCFDAIGIYVNPD  1075


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E++T + GT G++ +  +V+ SI   TNA  +G +G     PF+F  Q    IVGFF
Sbjct  1154  GPSEFITRVYGTIGSYNTPSDVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFF  1213

Query  297   GRSGYYIDAIGTYNAP  250
             G +  Y+DAIG Y  P
Sbjct  1214  GHANLYVDAIGVYVTP  1229


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNVVTPFNFQAQNGNKIVGF  301
             G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G    TPF+        IVGF
Sbjct  1309  GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGF  1368

Query  300   FGRSGYYIDAIGTY  259
             FGR G  I+A+G Y
Sbjct  1369  FGREGLCIEAVGFY  1382



>ref|XP_006663484.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Oryza brachyantha]
Length=1366

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -3

Query  468   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
             E L E+SGTFG F    N++ S+ F TN R +G YG    TPF+   Q    IVGFFGR+
Sbjct  980   EILVEVSGTFGRFIGFQNIITSLTFVTNTRSYGPYGQRKGTPFDIPVQGSGCIVGFFGRA  1039

Query  288   GYYIDAIGTYNAPD  247
             G+ +DAIG Y  PD
Sbjct  1040  GWCVDAIGIYVNPD  1053


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             G  E++T +SGT G++ +  +V+ SI   TN   +G +G     PFNF  Q   +IVGFF
Sbjct  1132  GSSEFITRVSGTIGSYNTPSDVVTSITLVTNVGCYGPFGQENGIPFNFPVQGNGRIVGFF  1191

Query  297   GRSGYYIDAIGTYNAP  250
             G +  Y+DAIG Y  P
Sbjct  1192  GHADLYVDAIGVYVNP  1207


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = -3

Query  477   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVVTPFNFQAQNGNKIVGF  301
             G  E+L ++ GTFG F    NV+ S+ F TN    +G +G    TPF         IVGF
Sbjct  1289  GPLEFLVKVLGTFGPFGEFPNVITSLTFVTNTDHHYGPFGQGGGTPFYGPMSGHGSIVGF  1348

Query  300   FGRSGYYIDAIGTY  259
             FGR G  I+AIG Y
Sbjct  1349  FGRKGPCIEAIGFY  1362



>gb|ACF87628.1| unknown [Zea mays]
Length=122

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            DE LTEISGT G   + DN+++S+KF TN R +G YG +  TPF  +  N   + GFFGR
Sbjct  48   DESLTEISGTTGPAYNIDNLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFGR  107

Query  291  SGYYIDAIGTYNAPD  247
            SG  +DAIG Y  P+
Sbjct  108  SGDCLDAIGLYVNPN  122



>ref|NP_001106057.1| PL3K2 [Zea mays]
 gb|ABR68026.1| PL3K2 [Zea mays]
 gb|ACF80462.1| unknown [Zea mays]
 gb|ACG30569.1| hypothetical protein [Zea mays]
Length=151

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            DE LTEISGT G   + DN+++S+KF TN R +G YG +  TPF  +  N   + GFFGR
Sbjct  77   DESLTEISGTTGPAYNIDNLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFGR  136

Query  291  SGYYIDAIGTYNAPD  247
            SG  +DAIG Y  P+
Sbjct  137  SGDCLDAIGLYVNPN  151



>gb|ACG29554.1| hypothetical protein [Zea mays]
 gb|ACG44268.1| hypothetical protein [Zea mays]
Length=151

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            DE LTEISGT G   + DN+++S+KF TN R +G YG +  TPF  +  N   + GFFGR
Sbjct  77   DESLTEISGTTGPAYNIDNLVKSLKFVTNKRTYGPYGRDEGTPFRVKVMNNGHVAGFFGR  136

Query  291  SGYYIDAIGTYNAPD  247
            SG  +DAIG Y  P+
Sbjct  137  SGDCLDAIGLYVNPN  151



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+L E+SGTFG +     V+RSIKF TN + +G +G    TPF+   QN + IVGFF
Sbjct  232  GSSEFLKEVSGTFGPYEGW-KVIRSIKFVTNKKTYGPFGRQEGTPFSVPVQNNSTIVGFF  290

Query  297  GRSGYYIDAIGTYNAP  250
            GRSG Y+D +G Y  P
Sbjct  291  GRSGKYLDTVGIYVHP  306



>gb|EMT18893.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=809

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E L E+SGT G++ +  NV+ S+   T+AR +G +G     PF+ +A + + I+GFFGRS
Sbjct  736  EILKEVSGTVGSYGALTNVITSLTLVTSARTYGPFGKGDGIPFSMEAASNSSIIGFFGRS  795

Query  288  GYYIDAIGTYNAP  250
            G+Y+DAIG Y  P
Sbjct  796  GWYLDAIGVYTRP  808



>ref|NP_001066495.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|ABA97248.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB51090.1| mannose-specific jacalin-related lectin [Oryza sativa Japonica 
Group]
 dbj|BAF29514.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|EAZ20117.1| hypothetical protein OsJ_35712 [Oryza sativa Japonica Group]
Length=306

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+L E+SGTFG +  S  V+ SI F TN + +G +G    TPF+  AQN + IVGFF
Sbjct  231  GSSEFLKEVSGTFGPYEGS-TVITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGFF  289

Query  297  GRSGYYIDAIGTYNAP  250
            GRSG YI+A+G Y  P
Sbjct  290  GRSGKYINAVGVYVQP  305



>gb|EEC69076.1| hypothetical protein OsI_37951 [Oryza sativa Indica Group]
Length=250

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+L E+S TFG +  S  V+RSI F TN + +G +G    TPF+  AQN + +VGFF
Sbjct  175  GSSEFLKEVSRTFGPYEGS-TVIRSINFITNKQTYGPFGRQEGTPFSVPAQNNSSVVGFF  233

Query  297  GRSGYYIDAIGTYNAP  250
            GRSG YI+A+G Y  P
Sbjct  234  GRSGKYINAVGVYVQP  249



>gb|EAY82651.1| hypothetical protein OsI_37872 [Oryza sativa Indica Group]
Length=304

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
             E+L E+SGTFG +  S NV+ SIKF TN + +G +G    TPF+   QN + +VGFFGR
Sbjct  231  SEFLKEVSGTFGTYYGS-NVITSIKFVTNVKTYGPFGKQNGTPFSIPVQNNSSVVGFFGR  289

Query  291  SGYYIDAIGTYNAP  250
             G Y+DA+G Y  P
Sbjct  290  GGKYLDAVGVYVHP  303



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            + G  E++ E+SGTFG +     N++ S+KF TN + +G +G    TPF   AQ  + IV
Sbjct  225  VLGASEFMKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIPAQKNSSIV  284

Query  306  GFFGRSGYYIDAIGTYNAP  250
            GFFGRSG Y+DA+G Y  P
Sbjct  285  GFFGRSGIYLDALGVYVRP  303



>ref|XP_008677996.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
 ref|XP_008677997.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
Length=652

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G    TPF+ Q QN  +IVGFF
Sbjct  214  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  273

Query  297  GRSGYYIDAIGTYNAPD  247
            GRSG Y+ AIG Y   D
Sbjct  274  GRSGQYLYAIGVYTNQD  290


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  409  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  468

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  469  GRYLNAIGVYTAP  481



>ref|XP_008677991.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Zea 
mays]
Length=778

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G    TPF+ Q QN  +IVGFF
Sbjct  345  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  404

Query  297  GRSGYYIDAIGTYNAPD  247
            GRSG Y+ AIG Y   D
Sbjct  405  GRSGQYLYAIGVYTNQD  421


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  540  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  599

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  600  GRYLNAIGVYTAP  612



>ref|XP_008677992.1| PREDICTED: mannose/glucose-specific lectin-like isoform X4 [Zea 
mays]
Length=760

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G    TPF+ Q QN  +IVGFF
Sbjct  322  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  381

Query  297  GRSGYYIDAIGTYNAPD  247
            GRSG Y+ AIG Y   D
Sbjct  382  GRSGQYLYAIGVYTNQD  398


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  517  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  576

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  577  GRYLNAIGVYTAP  589



>ref|XP_008677998.1| PREDICTED: mannose/glucose-specific lectin-like isoform X9 [Zea 
mays]
Length=616

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G    TPF+ Q QN  +IVGFF
Sbjct  178  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  237

Query  297  GRSGYYIDAIGTYNAPD  247
            GRSG Y+ AIG Y   D
Sbjct  238  GRSGQYLYAIGVYTNQD  254


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  373  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  432

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  433  GRYLNAIGVYTAP  445



>ref|XP_008677994.1| PREDICTED: mannose/glucose-specific lectin-like isoform X6 [Zea 
mays]
Length=684

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G    TPF+ Q QN  +IVGFF
Sbjct  246  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  305

Query  297  GRSGYYIDAIGTYNAPD  247
            GRSG Y+ AIG Y   D
Sbjct  306  GRSGQYLYAIGVYTNQD  322


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  441  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  500

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  501  GRYLNAIGVYTAP  513



>ref|XP_008677990.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Zea 
mays]
Length=781

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G    TPF+ Q QN  +IVGFF
Sbjct  343  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  402

Query  297  GRSGYYIDAIGTYNAPD  247
            GRSG Y+ AIG Y   D
Sbjct  403  GRSGQYLYAIGVYTNQD  419


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  538  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  597

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  598  GRYLNAIGVYTAP  610



>ref|XP_008677986.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677987.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677988.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677989.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
Length=783

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G    TPF+ Q QN  +IVGFF
Sbjct  345  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  404

Query  297  GRSGYYIDAIGTYNAPD  247
            GRSG Y+ AIG Y   D
Sbjct  405  GRSGQYLYAIGVYTNQD  421


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  540  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  599

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  600  GRYLNAIGVYTAP  612



>ref|XP_004168675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, 
partial [Cucumis sativus]
Length=1090

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG    T F+F    G K
Sbjct  916  VKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-K  974

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG Y+DAIG Y  P
Sbjct  975  IVGFHGRSGLYLDAIGVYLKP  995



>ref|XP_008677993.1| PREDICTED: mannose/glucose-specific lectin-like isoform X5 [Zea 
mays]
Length=703

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  460  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  519

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  520  GRYLNAIGVYTAP  532



>gb|EMS66150.1| hypothetical protein TRIUR3_12251 [Triticum urartu]
Length=307

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            + G  E++ E+SGT+G + A   N++ S+KF TN + +G +G    TPF    +N + IV
Sbjct  228  VLGASEFVKEVSGTYGIYDADQHNIIMSLKFITNVKAYGPFGEANGTPFTIPVENNSSIV  287

Query  306  GFFGRSGYYIDAIGTYNAP  250
            GFFGRSG Y+DA+G Y  P
Sbjct  288  GFFGRSGIYLDALGVYVRP  306



>ref|XP_008677995.1| PREDICTED: mannose/glucose-specific lectin-like isoform X7 [Zea 
mays]
Length=680

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  437  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  496

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  497  GRYLNAIGVYTAP  509



>ref|XP_004152769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Cucumis sativus]
Length=1463

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
             + +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG    T F+F    G K
Sbjct  943   VKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-K  1001

Query  312   IVGFFGRSGYYIDAIGTYNAP  250
             IVGF GRSG Y+DAIG Y  P
Sbjct  1002  IVGFHGRSGLYLDAIGVYLKP  1022


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -3

Query  468   EYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
             E LT ++G +G       NV++S+ F T   ++G +G    TPF+   + G KIVGF GR
Sbjct  1178  EILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  1236

Query  291   SGYYIDAIGTY  259
              G ++DA+G +
Sbjct  1237  KGLFLDALGVH  1247


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 3/79 (4%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
             + +D   E LT ISG +G     +    ++S+ F T+  +FG +G  V + F      G 
Sbjct  1367  VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEVGSFFTSTTTEG-  1425

Query  315   KIVGFFGRSGYYIDAIGTY  259
             K+VGF GRS  Y+DAIG +
Sbjct  1426  KVVGFHGRSSLYLDAIGVH  1444



>ref|XP_006647196.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Oryza 
brachyantha]
Length=960

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            IN+D E EYL E+ GT G F  S   + S+   TN R +G +G    TPF    +  + I
Sbjct  881  INLD-EREYLVEVIGTVGPFNVSSEAITSLTLVTNVRSYGPFGQPQGTPFRTPLKKNSCI  939

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            VGFFGRSG Y+DA+G Y  P
Sbjct  940  VGFFGRSGTYLDAVGVYFHP  959



>ref|XP_006647195.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Oryza 
brachyantha]
Length=1077

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
             IN+D E EYL E+ GT G F  S   + S+   TN R +G +G    TPF    +  + I
Sbjct  998   INLD-EREYLVEVIGTVGPFNVSSEAITSLTLVTNVRSYGPFGQPQGTPFRTPLKKNSCI  1056

Query  309   VGFFGRSGYYIDAIGTYNAP  250
             VGFFGRSG Y+DA+G Y  P
Sbjct  1057  VGFFGRSGTYLDAVGVYFHP  1076



>ref|XP_011463712.1| PREDICTED: jacalin-related lectin 3-like [Fragaria vesca subsp. 
vesca]
Length=599

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            I +D  DE+L  +SG +        +  VLRS+KF TN R FG +G  V TPF F+ ++G
Sbjct  327  IKLDYPDEFLVSVSGYYCGVTWIVGAPVVLRSLKFETNKRTFGPFGVEVGTPFTFRVKDG  386

Query  318  NKIVGFFGRSGYYIDAIG  265
             KIVGF GR+G+Y+DAIG
Sbjct  387  VKIVGFKGRNGWYLDAIG  404


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            I ++  +E++  ++G +G       +  VL S++F +N R FG +G  V TPF F+ ++G
Sbjct  479  IKLEYPNEFIVSVTGHYGGVTWIVGAPVVLLSLRFESNRRTFGPFGVQVGTPFTFRVKDG  538

Query  318  NKIVGFFGRSGYYIDAIG--TYNAPD  247
            ++IVG  GR+G+Y+DAIG  T  AP+
Sbjct  539  DQIVGLKGRNGWYLDAIGFHTSRAPE  564


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DE+L  +SG +         V+RS+KF +N R FG +G    TPF F   +G K
Sbjct  77   IKLQYPDEFLVSVSGHYCPVVYGGSPVIRSLKFESNRRTFGPFGVEEGTPFTFTV-DGGK  135

Query  312  IVGFFGRSGYYIDAIG--TYNAP  250
            IVG  GR G+Y+DAIG   Y+AP
Sbjct  136  IVGLKGRGGWYLDAIGFHVYHAP  158



>gb|KGN62634.1| hypothetical protein Csa_2G362470 [Cucumis sativus]
Length=598

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG    T F+F    G K
Sbjct  74   VKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-K  132

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG Y+DAIG Y  P
Sbjct  133  IVGFHGRSGLYLDAIGVYLKP  153


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E LT ++G +G       NV++S+ F T   ++G +G    TPF+   + G KIVGF GR
Sbjct  313  EILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  371

Query  291  SGYYIDAIGTY  259
             G ++DA+G +
Sbjct  372  KGLFLDALGVH  382



>gb|AFW60405.1| putative protein kinase superfamily protein [Zea mays]
Length=634

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G    TPF+ Q QN  +IVGFF
Sbjct  223  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  282

Query  297  GRSGYYIDAIG  265
            GRSG Y+ AIG
Sbjct  283  GRSGQYLYAIG  293


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G    T F+   Q    IVGFFGRS
Sbjct  391  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  450

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y AP
Sbjct  451  GRYLNAIGVYTAP  463



>ref|XP_004982894.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=151

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E++ EISGT+G F     V+RS+ F TN  + G +G    TPF+   Q+G  +VGFF
Sbjct  77   GAGEFVKEISGTYGPFGG-HTVVRSLTFVTNIGKHGPFGTPWQTPFSVPVQDGAHVVGFF  135

Query  297  GRSGYYIDAIGTYNAP  250
            GRSG  +DA+G Y  P
Sbjct  136  GRSGSLLDAVGVYVHP  151



>ref|XP_008444758.1| PREDICTED: LOW QUALITY PROTEIN: myrosinase-binding protein-like 
At3g16470 [Cucumis melo]
Length=598

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG    T F+F    G K
Sbjct  74   VKLDFPDEYLTMIRGYYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTVFSFPTTEG-K  132

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG Y+DAIG Y  P
Sbjct  133  IVGFHGRSGLYLDAIGVYLKP  153


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E LT ++G +G       NV++S+ F T   ++G +G    TPF+   + G KIVGF GR
Sbjct  313  EILTHVTGHYGPVMYMGPNVIKSLSFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  371

Query  291  SGYYIDAIGTY  259
             G ++DA+G +
Sbjct  372  KGLFLDALGVH  382



>ref|XP_010273654.1| PREDICTED: mannose/glucose-specific lectin-like [Nelumbo nucifera]
Length=147

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            I I   DEYLT ISGTFG    + N   V+RSI+F TNAR +G YG    T F+   + G
Sbjct  66   IQIAWPDEYLTSISGTFGRRWKNQNGHVVVRSIQFNTNARSYGPYGSTDGTAFSLPVKQG  125

Query  318  NKIVGFFGRSGYYIDAIGTY  259
             KIVGF GR G  +D+IG Y
Sbjct  126  -KIVGFHGRCGADLDSIGVY  144



>ref|XP_004980504.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=128

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            IN+ G  E++ E+SGT+G F+   NV+ S    TN   +G +G    TPF+ +      I
Sbjct  47   INL-GPSEFVKEVSGTYGRFSHLPNVITSFTLVTNLCSYGPFGQPSGTPFHTRVDRTGSI  105

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            VGFFGRSG Y+DAIG Y  P
Sbjct  106  VGFFGRSGKYLDAIGVYVRP  125



>gb|EMT23136.1| hypothetical protein F775_18655 [Aegilops tauschii]
Length=118

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            IN+D  + Y+TEISGT G F + D+++ S+K  T+     TYG    TPF     +G KI
Sbjct  41   INLDATN-YVTEISGTVGKFGT-DDIVTSLKIVTSKGVTKTYGSGTGTPFRVPVLDGGKI  98

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            VGFFGR+G ++DAIG Y +P
Sbjct  99   VGFFGRAGAFLDAIGFYISP  118



>gb|AAA87041.1| putative 32.6 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72096.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            + G  E++ E+SGTFG +     N++ S+KF TN + +G +G    TPF    Q  + IV
Sbjct  225  VLGASEFVKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIAVQKNSSIV  284

Query  306  GFFGRSGYYIDAIGTYNAP  250
            GFF RSG Y+DA+G Y  P
Sbjct  285  GFFARSGIYLDALGVYVRP  303



>ref|XP_002440163.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
 gb|EES18593.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
Length=206

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYLT +SG +   A   + V+RS+ F TN R +G +G    TPF+F    G  
Sbjct  77   IKLSCPDEYLTTVSGHYAPIAHGGSPVIRSLAFRTNLRAYGPFGAAEGTPFSFPV-VGGV  135

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF+GRSG+ +DA+G Y AP
Sbjct  136  IVGFYGRSGWQLDAVGLYVAP  156



>gb|EMT07650.1| Horcolin [Aegilops tauschii]
Length=320

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            +DEYLT + G +G F  +  V+RS+   +N R +G+YG     PF   A  G KI+GF  
Sbjct  244  QDEYLTSVHGHYGQFKDT-VVIRSLTLVSNLRSYGSYGKEDGVPFALHAGPGGKIIGFHA  302

Query  294  RSGYYIDAIGTY  259
            RSG ++DAIGTY
Sbjct  303  RSGQFLDAIGTY  314



>gb|AAR20919.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            + G  E++ E+SGTFG +   + N++ S+KF TN + +G +G    T F    Q  + IV
Sbjct  225  VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIV  284

Query  306  GFFGRSGYYIDAIGTYNAP  250
            GFFGRSG Y+DA+G Y  P
Sbjct  285  GFFGRSGIYLDALGVYVHP  303



>gb|EMT24046.1| hypothetical protein F775_25349 [Aegilops tauschii]
Length=304

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            + G  E++ E+SGTFG +   + N++ S+KF TN + +G +G    T F    Q  + IV
Sbjct  225  VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIV  284

Query  306  GFFGRSGYYIDAIGTYNAP  250
            GFFGRSG Y+DA+G Y  P
Sbjct  285  GFFGRSGIYLDALGVYVHP  303



>gb|EMS55842.1| hypothetical protein TRIUR3_32339 [Triticum urartu]
Length=288

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            + G  E++ E+SGTFG +   + N++ S+KF TN + +G +G    T F    Q  + IV
Sbjct  209  VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSSIV  268

Query  306  GFFGRSGYYIDAIGTYNAP  250
            GFFGRSG Y+DA+G Y  P
Sbjct  269  GFFGRSGIYLDALGVYVHP  287



>gb|ABS82785.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            + G  E++ E+SGTFG +   + N++ S+KF TN + +G +G    T F    Q  + IV
Sbjct  225  VLGTSEFVREVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIV  284

Query  306  GFFGRSGYYIDAIGTYNAP  250
            GFFGRSG Y+DA+G Y  P
Sbjct  285  GFFGRSGIYLDALGVYVHP  303



>ref|XP_004297619.2| PREDICTED: agglutinin [Fragaria vesca subsp. vesca]
Length=525

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            I ++  DE+L  ISG +        +  VLRS+KF +N R FG +G    TPF F+ ++ 
Sbjct  295  IKLECPDEFLVSISGYYCGVTWIVGAPVVLRSLKFESNKRTFGPFGNQFGTPFTFKVKDS  354

Query  318  NKIVGFFGRSGYYIDAIGTYNAP  250
            ++IVGF GR G Y+DAIG ++ P
Sbjct  355  DRIVGFKGRKGRYLDAIGFHSKP  377


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISG--TFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            + ++  +E++  +SG  ++  + S   V+RS+KF +N R +G +G  V TPF+F+ ++G+
Sbjct  446  VKLEYPNEFMVTVSGHISWVPWMSGTRVVRSLKFDSNRRTYGPFGVQVGTPFSFRVKDGD  505

Query  315  KIVGFFGRSGYYIDAIGTYN  256
            +IVG  GRSG+Y+ AIG Y 
Sbjct  506  QIVGLRGRSGWYLYAIGFYT  525



>ref|XP_002449838.1| hypothetical protein SORBIDRAFT_05g024220 [Sorghum bicolor]
 gb|EES08826.1| hypothetical protein SORBIDRAFT_05g024220 [Sorghum bicolor]
Length=281

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            + E++ E+SGTFG +A   NV+ SIK  TN + +G +G    + F+   Q  + + GFFG
Sbjct  206  DSEFVKEVSGTFGMYAKVVNVINSIKLVTNVKTYGPFGQENGSSFSVPVQGNSGVAGFFG  265

Query  294  RSGYYIDAIGTYNAP  250
            RSG ++DAIG Y  P
Sbjct  266  RSGKFLDAIGVYVHP  280



>ref|XP_004960459.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=149

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E++ EISGT+G F     V+RS+ F TN  + G +G    TPF+   Q+  ++VGFF
Sbjct  75   GAGEFVKEISGTYGPFGGH-TVVRSLTFVTNVGKHGPFGNPGQTPFSVPVQDDARVVGFF  133

Query  297  GRSGYYIDAIGTYNAP  250
            GRSG  +DA+G Y  P
Sbjct  134  GRSGSLLDAVGVYVHP  149



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG +     V++S+ F TNA  +G +G N   TPF+   + G  IVGF GR
Sbjct  241  EYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSLVMKEGVAIVGFHGR  299

Query  291  SGYYIDAIGTY  259
            SG+Y+DAIG Y
Sbjct  300  SGFYLDAIGVY  310


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E LT I GT G F +   V++S+ FTTN + +G +G     TPF+   + G  I+GF GR
Sbjct  35   ERLTGIKGTLGRF-NGHLVVKSLCFTTNVKNYGPFGSEGGGTPFSHVMKEGGAIMGFHGR  93

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  94   CGEYLDAIGVY  104



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG +     V++S+ F TNA  +G +G N   TPF+   + G  IVGF GR
Sbjct  293  EYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSLVMKEGVAIVGFHGR  351

Query  291  SGYYIDAIGTY  259
            SG+Y+DAIG Y
Sbjct  352  SGFYLDAIGVY  362


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E LT I GT G F +   V++S+ FTTN + +G +G     TPF+   + G  I+GF GR
Sbjct  87   ERLTGIKGTLGRF-NGHLVVKSLCFTTNVKNYGPFGSEGGGTPFSHVMKEGGAIMGFHGR  145

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  146  CGEYLDAIGVY  156



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG +     V++S+ F TNA  +G +G N   TPF+   + G  IVGF GR
Sbjct  293  EYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSLVMKEGVAIVGFHGR  351

Query  291  SGYYIDAIGTY  259
            SG+Y+DAIG Y
Sbjct  352  SGFYLDAIGVY  362


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E LT I GT G F +   V++S+ FTTN + +G +G     TPF+   + G  I+GF GR
Sbjct  87   ERLTGIKGTLGRF-NGHLVVKSLCFTTNVKNYGPFGSEGGGTPFSHVMKEGGAIMGFHGR  145

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  146  CGEYLDAIGVY  156



>ref|XP_009589464.1| PREDICTED: agglutinin-like, partial [Nicotiana tomentosiformis]
Length=363

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            EYLT I GTFG    S  V++S+ F TNAR +G +G  + TPF+   + G  IVGF GR 
Sbjct  110  EYLTGIKGTFG-HCGSYLVIKSLCFETNARNYGPFGSEIGTPFSLVMKEGGAIVGFHGRC  168

Query  288  GYYIDAIGTY  259
            G Y+DAIG Y
Sbjct  169  GAYLDAIGVY  178


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYL  I GTF  + S   V+ S+ F TNA+ +G +G     TPF+F  + G  I GF GR
Sbjct  297  EYLIGIKGTFRRYGSH-FVINSLCFITNAKNYGPFGSEAGGTPFSFVMKEGGAIEGFHGR  355

Query  291  SGYYIDAI  268
             G Y+DAI
Sbjct  356  CGAYLDAI  363



>gb|EMT11070.1| hypothetical protein F775_02114 [Aegilops tauschii]
Length=332

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            +DEYLT + G +G F     V+RS+ F +N R +G YG     PF   A  G KI+GF  
Sbjct  256  QDEYLTSVHGHYGQFKDF-VVIRSLTFVSNLRSYGPYGKEDGVPFALHAGPGGKIIGFHA  314

Query  294  RSGYYIDAIGTYNAPD  247
            RSG ++DAIGTY   D
Sbjct  315  RSGQFLDAIGTYVKMD  330



>ref|XP_006662244.1| PREDICTED: uncharacterized protein LOC102708001 [Oryza brachyantha]
Length=334

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN-KIVGF  301
            GE E +TE+SGT G F   +NV+ S+   TN R +G +G     PF+      N  IVGF
Sbjct  256  GESEVVTEVSGTIGPFHHLNNVITSLSIVTNLRSYGPFGSAKGIPFSTSTLVSNSSIVGF  315

Query  300  FGRSGYYIDAIGTY  259
            FGRSG Y+DAIG Y
Sbjct  316  FGRSGSYLDAIGVY  329



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            EYLT I GTFG +    +V++S+ F TNA+ +G +G    TPF+   + G  IVGF GR 
Sbjct  35   EYLTCIKGTFG-YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRC  93

Query  288  GYYIDAIGTY  259
            G Y+DAIG Y
Sbjct  94   GAYLDAIGVY  103


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GT G F    +V++S+ FTTN + +G +G     TPF+   + G  IVGF GR
Sbjct  217  EHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHGR  275

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  276  CGAYLDAIGVY  286


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG + +   V++S+ F TNA  +G +G +   TPF+   + G  IVGF G 
Sbjct  423  EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFSLVMKEGVAIVGFHGL  481

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  482  CGAYLDAIGIY  492



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            EYLT I GTFG +    +V++S+ F TNA+ +G +G    TPF+   + G  IVGF GR 
Sbjct  105  EYLTCIKGTFG-YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRC  163

Query  288  GYYIDAIGTY  259
            G Y+DAIG Y
Sbjct  164  GAYLDAIGVY  173


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GT G F    +V++S+ FTTN + +G +G     TPF+   + G  IVGF GR
Sbjct  287  EHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHGR  345

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  346  CGAYLDAIGVY  356


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG + +   V++S+ F TNA  +G +G +   TPF+   + G  IVGF G 
Sbjct  493  EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFSLVMKEGVAIVGFHGL  551

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  552  CGAYLDAIGIY  562



>ref|XP_003573652.1| PREDICTED: horcolin-like [Brachypodium distachyon]
Length=102

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFG--TYGPNVVTPFNFQAQNGN  316
            I +D  D Y+T ISGTFG    +D V+ S+K +T   + G  TYG    TPF+   ++G 
Sbjct  22   ITLDPTD-YVTGISGTFGTAFDNDRVVTSLKISTFKEKDGSKTYGKPNGTPFHIPVRDGG  80

Query  315  KIVGFFGRSGYYIDAIGTYNAP  250
            ++VGFFGRSG  +DAIG Y AP
Sbjct  81   RVVGFFGRSGDMLDAIGVYFAP  102



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG F    +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  99   EYLTGIKGTFGRFYGH-SVIKSLCFITNAKNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  157

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  158  SGLYLDAIGVY  168



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG F    +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  55   EYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  113

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  114  SGLYLDAIGVY  124



>ref|XP_009614994.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1334

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG F    +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  160

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  161  SGLYLDAIGVY  171



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG F    +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  160

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  161  SGLYLDAIGVY  171



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG F    +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  160

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  161  SGLYLDAIGVY  171



>ref|NP_001148448.1| jasmonate-induced protein [Zea mays]
 gb|ACG31498.1| jasmonate-induced protein [Zea mays]
Length=184

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYGPNVVTPFNFQAQNGNKIV  307
            G+ E LTE+SGT G       V+ SIKF T+ +    FG +G    TPF    Q G+ IV
Sbjct  106  GDSEVLTELSGTIG-IVDGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIV  164

Query  306  GFFGRSGYYIDAIGTY  259
            GFF R+G Y+DA+G Y
Sbjct  165  GFFARAGVYLDALGVY  180



>gb|EEE60695.1| hypothetical protein OsJ_14181 [Oryza sativa Japonica Group]
Length=95

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYG-PNVVTPFNFQAQNGNKIVG  304
            G  +++ EISGT G + S   NVLRS+K TT  R +G YG P    PF+F     ++I G
Sbjct  17   GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITG  76

Query  303  FFGRSGYYIDAIGTY  259
            FF R+G+  DAIG Y
Sbjct  77   FFVRAGFITDAIGVY  91



>emb|CDM80625.1| unnamed protein product [Triticum aestivum]
 emb|CDM80626.1| unnamed protein product [Triticum aestivum]
Length=307

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            +DEYLT + G +G F     V+RS+KF +N R +G YG      F   A  G KI+GF  
Sbjct  231  QDEYLTSVHGHYGQFKGF-VVVRSLKFVSNLRSYGPYGKEDGVSFALHAGPGGKIIGFHA  289

Query  294  RSGYYIDAIGTYNAPD  247
            RSG ++DAIGTY   D
Sbjct  290  RSGQFLDAIGTYVKMD  305



>ref|XP_009768641.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1282

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG    S +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  29   EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGR  87

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  88   CGAYLDAIGVY  98



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG    S +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  86   EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGR  144

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  145  CGAYLDAIGVY  155



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG    S +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGR  160

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  161  CGAYLDAIGVY  171



>gb|EEC72970.1| hypothetical protein OsI_06866 [Oryza sativa Indica Group]
Length=1072

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
             I++D E E+L E+ GT G F      + S+   TN R +G +G    TPF    +  + I
Sbjct  993   IDLD-EREFLMEVIGTVGPFNVLSEAITSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCI  1051

Query  309   VGFFGRSGYYIDAIGTYNAP  250
             VGFFGRSG Y+DA+G Y  P
Sbjct  1052  VGFFGRSGTYLDAVGVYFHP  1071



>dbj|BAD23250.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 dbj|BAD23344.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 gb|EAZ22703.1| hypothetical protein OsJ_06375 [Oryza sativa Japonica Group]
Length=1072

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
             I++D E E+L E+ GT G F      + S+   TN R +G +G    TPF    +  + I
Sbjct  993   IDLD-EREFLMEVIGTVGPFNVLSEAITSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCI  1051

Query  309   VGFFGRSGYYIDAIGTYNAP  250
             VGFFGRSG Y+DA+G Y  P
Sbjct  1052  VGFFGRSGTYLDAVGVYFHP  1071



>ref|XP_010230396.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
 ref|XP_010230397.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=246

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 2/77 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I +D +DEYLT + G +G F    +V+R++ F +N R  G YG +    F   A  G KI
Sbjct  168  ICLD-KDEYLTGVKGRYGQF-DGWSVIRALTFVSNRRTIGPYGTDEGMEFELPAAGGGKI  225

Query  309  VGFFGRSGYYIDAIGTY  259
            VGF GRSG  +DAIGTY
Sbjct  226  VGFHGRSGGLVDAIGTY  242



>ref|XP_009795366.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795367.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795368.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795369.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795370.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795373.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795374.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795375.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1346

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG F    ++++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFGRFYDR-SIIKSLCFITNAKNYGPFGCEAAGTPFSLVMEEGVAIVGFHGR  160

Query  291  SGYYIDAIGTY  259
            SG ++DAIG Y
Sbjct  161  SGLFLDAIGVY  171



>ref|XP_009768586.1| PREDICTED: jacalin-related lectin 3-like [Nicotiana sylvestris]
Length=225

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFG----TYGP--NVV--TPFNFQAQNGNK  313
            EYLT I+GTFG    SD V++S+ F TNA+ +G    +YGP  ++V  TPF+   + G  
Sbjct  125  EYLTGINGTFG-HDGSDLVIKSLCFITNAKSYGPFGSSYGPFGSMVGGTPFSLVMKEGVA  183

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GRSG Y+DAIG Y
Sbjct  184  IVGFHGRSGLYLDAIGVY  201



>tpg|DAA60181.1| TPA: hypothetical protein ZEAMMB73_326702 [Zea mays]
Length=297

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 4/78 (5%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYGPNVVTPFNFQAQNGNKIV  307
            G+ E LTE+SGT G       V+ SIKF T+ +    FG +G    TPF    Q G+ IV
Sbjct  168  GDSEVLTELSGTIGN-VDGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIV  226

Query  306  GFFGRSGYYIDAIGTYNA  253
            GFF R+G Y+DA+G Y+A
Sbjct  227  GFFARAGVYLDALGVYDA  244



>ref|XP_006663456.1| PREDICTED: disease resistance protein RPM1-like [Oryza brachyantha]
Length=1102

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  468   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
             E++ E+SGT+G F S  +V+ S++  TN R +G +G    T F  + +    IVGFFG S
Sbjct  1030  EFVKEVSGTYGPFFSFPSVITSLQLRTNIRSYGPFGEPKGTTFRTRVKQNGSIVGFFGHS  1089

Query  288   GYYIDAIGTYNAP  250
               YIDAIG Y  P
Sbjct  1090  TVYIDAIGVYIHP  1102



>gb|EAZ25557.1| hypothetical protein OsJ_09383 [Oryza sativa Japonica Group]
Length=126

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E++T++ GT G F    +V+ SI FTTNA  +G +G    T F     +   IVGFF
Sbjct  50   GPSEFVTKVYGTIGPFGKFSSVITSIHFTTNADRYGPFGQGTGTRFEAPMHSDGSIVGFF  109

Query  297  GRSGYYIDAIGTYNAP  250
            GR+  Y+DAIG Y  P
Sbjct  110  GRTSSYVDAIGFYVVP  125



>ref|XP_010232946.1| PREDICTED: uncharacterized protein LOC104583002 [Brachypodium 
distachyon]
Length=250

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
             DE+LT + G  G  A    V++S+ F +N R +G YG +   PF   A  G +IVGF G
Sbjct  153  RDEHLTCVKGLLGNHAQW-FVVKSLTFVSNRRTYGPYGEDHGVPFELPAPAGGRIVGFHG  211

Query  294  RSGYYIDAIGTYNAPDY  244
            RSG  +DAIGTY   D+
Sbjct  212  RSGGLLDAIGTYVRMDW  228



>gb|EAY80990.1| hypothetical protein OsI_36172 [Oryza sativa Indica Group]
Length=1081

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  468   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
             E +TE+SGT G F+   +V+ S++  TN R +G +G    T F  + +    IVGFFGRS
Sbjct  1009  EIVTEVSGTCGPFSQFPSVVTSLQLVTNLRSYGPFGQAKGTKFRTRVKQNGSIVGFFGRS  1068

Query  288   GYYIDAIGTYNAP  250
               Y+DAIG Y  P
Sbjct  1069  TIYLDAIGVYVRP  1081



>ref|XP_004291831.1| PREDICTED: jacalin-related lectin 3 [Fragaria vesca subsp. vesca]
Length=642

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  +E+LT   G +G  +    V LRSI F +N R +G +G    T F+     GNK
Sbjct  74   VQLDYPEEFLTSFHGYYGKISEWGTVSLRSITFKSNKRSYGPFGMEQGTYFSLPVTTGNK  133

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF G+SG+Y+DAIG +  P
Sbjct  134  IVGFHGKSGWYVDAIGAHLKP  154


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D  +E LT I+GTFG       NV++S+ F T  ++ G YG    T F+ Q + G K
Sbjct  311  IIFDYPNEILTHITGTFGPVMGMGPNVIKSMSFHTTKKKHGPYGEEQGTQFSTQLREG-K  369

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVG  GR+G ++DAIG +
Sbjct  370  IVGIHGRTGLFLDAIGVH  387



>ref|NP_001052399.1| Os04g0295400 [Oryza sativa Japonica Group]
 emb|CAD40444.2| OSJNBa0041M21.2 [Oryza sativa Japonica Group]
 dbj|BAF14313.1| Os04g0295400 [Oryza sativa Japonica Group]
Length=150

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYG-PNVVTPFNFQAQNGNKIVG  304
            G  +++ EISGT G + S   NVLRS+K TT  R +G YG P    PF+F     ++I G
Sbjct  72   GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITG  131

Query  303  FFGRSGYYIDAIGTY  259
            FF R+G+  DAIG Y
Sbjct  132  FFVRAGFITDAIGVY  146



>sp|Q5U9T2.1|LECH_HORVU RecName: Full=Horcolin; AltName: Full=Agglutinin; AltName: Full=Mannose-specific 
lectin [Hordeum vulgare]
 sp|P82953.2|LECH_HORVD RecName: Full=Horcolin; AltName: Full=Agglutinin; AltName: Full=Mannose-specific 
lectin [Hordeum vulgare subsp. vulgare]
 gb|AAK54458.1| horcolin [Hordeum vulgare subsp. vulgare]
 gb|AAV39531.1| horcolin [Hordeum vulgare]
 dbj|BAJ87539.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=146

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            IN+D  + Y+TEISGT G F + D+++ S+K  T+     TYG     PF     +G KI
Sbjct  69   INLDATN-YVTEISGTVGKFGT-DDIVTSLKIITSKGVTRTYGSGTGIPFRVPVLDGGKI  126

Query  309  VGFFGRSGYYIDAIGTYNAP  250
             GFFGR+G ++DAIG Y  P
Sbjct  127  AGFFGRAGAFLDAIGFYITP  146



>gb|EMT07330.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=885

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E + EISGTFG +    ++++S+   TN R +G +G    TPF+ + +    IVGFFG S
Sbjct  813  ELVLEISGTFGPYGQFPSIIKSLMLVTNLRTYGPFGQLHGTPFHSRVKKNGTIVGFFGCS  872

Query  288  GYYIDAIGTYNAP  250
            G ++DAIG Y  P
Sbjct  873  GEFLDAIGVYIHP  885



>gb|EAY96520.1| hypothetical protein OsI_18424 [Oryza sativa Indica Group]
Length=144

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVV-TPFNFQAQNGNKIVG  304
            GE E +TE+SGT G +     V+RS+ F T+A +  G +G  V    F    + G ++VG
Sbjct  67   GEAERITEVSGTLGPWGPHACVVRSLAFVTSAGKTHGPFGEEVGGAAFRVPVKGGGRVVG  126

Query  303  FFGRSGYYIDAIGTYNAP  250
            FF RSG+ +DA+G Y  P
Sbjct  127  FFARSGWLLDAVGVYVHP  144



>ref|XP_006853911.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
 gb|ERN15378.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
Length=126

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            +E++T +SG +     S   V+RS+KF TN + +G YG    TPF+F   +G  IVGF G
Sbjct  22   EEFITGVSGHYSPMVHSGTPVIRSLKFATNRKTYGPYGVEEGTPFSF-PMDGGHIVGFKG  80

Query  294  RSGYYIDAIG  265
            RSG+Y+DAIG
Sbjct  81   RSGWYLDAIG  90



>gb|EAZ01021.1| hypothetical protein OsI_23055 [Oryza sativa Indica Group]
Length=694

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQN-GNKIVG  304
            G  EYL EISGT G F  +   V+ S+   T  R +G YG  V  PF+   QN G  IVG
Sbjct  311  GPSEYLIEISGTVGPFTYAPHGVITSLTLVTTIRTYGPYGELVGNPFHIPMQNKGGSIVG  370

Query  303  FFGRSGYYIDAIGTYNAPD  247
            FF R G+Y+DA G Y  P+
Sbjct  371  FFARVGWYVDAFGIYVNPN  389


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK-IVGF  301
            G  E++T + GT G F +  +V+ S++F TNA ++G +G  + T F      G+  IVGF
Sbjct  617  GPSEFVTAVYGTVGPFGNYSSVITSLRFVTNAGKYGPFGQGIGTHFQAPMHKGSSSIVGF  676

Query  300  FGRSGYYIDAIGTYNAP  250
            FGRS   +++IG Y  P
Sbjct  677  FGRSSSCVESIGFYVVP  693


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LT  SGT G      NV+ S+   TNAR +G +G     PF    +N   IVGFFGR+
Sbjct  470  EFLTGFSGTTG-----HNVVTSLTLITNARSYGPFGQVGGAPFQVPMRNNASIVGFFGRA  524

Query  288  GYYIDAIGTYNAPD  247
              Y++AIG Y  P+
Sbjct  525  DQYLNAIGVYANPE  538



>gb|EAY93469.1| hypothetical protein OsI_15270 [Oryza sativa Indica Group]
Length=150

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYG-PNVVTPFNFQAQNGNKIVG  304
            G  +++ EISGT G + S   NVLRS+K TT  R +G YG P    PF+F     ++I G
Sbjct  72   GLMDFVMEISGTTGMWVSGMRNVLRSLKITTLKRTYGPYGNPEAGIPFSFSVDGSDRITG  131

Query  303  FFGRSGYYIDAIGTY  259
            FF R+G+  DAIG Y
Sbjct  132  FFVRAGFITDAIGVY  146



>ref|NP_001054618.1| Os05g0143600 [Oryza sativa Japonica Group]
 gb|AAU90197.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16532.1| Os05g0143600 [Oryza sativa Japonica Group]
 gb|EEE62296.1| hypothetical protein OsJ_17084 [Oryza sativa Japonica Group]
Length=152

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVV-TPFNFQAQNGNKIVG  304
            GE E +TE+SGT G +     V+RS+ F T+A +  G +G  V    F    + G ++VG
Sbjct  75   GEAERVTEVSGTLGPWGPHACVVRSLAFVTSAGKTHGPFGEEVGGAAFRVPVKGGGRVVG  134

Query  303  FFGRSGYYIDAIGTYNAP  250
            FF RSG+ +DA+G Y  P
Sbjct  135  FFARSGWLLDAVGVYVHP  152



>ref|NP_001148739.1| LOC100282355 [Zea mays]
 gb|ACG32703.1| agglutinin [Zea mays]
Length=207

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G    TPF F   +G  
Sbjct  78   IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  136

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG+ +DA+G Y AP
Sbjct  137  IVGFCGRSGWQLDAVGLYVAP  157



>ref|XP_007215056.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
 gb|EMJ16255.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
Length=179

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DE+L  +SG +         ++RS+KF +N R FG YG    TPF F   +G K
Sbjct  76   IKLQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTPFTFSV-DGGK  134

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVG  GR+G+Y+DAIG + +P
Sbjct  135  IVGLKGRNGWYLDAIGFHVSP  155



>gb|EMS58273.1| hypothetical protein TRIUR3_17900 [Triticum urartu]
Length=304

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            + G  E++ E SGTF  +   + N++ S+KF TN + +G +G    T F    Q  + IV
Sbjct  225  VLGTSEFVKEFSGTFSLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSNIV  284

Query  306  GFFGRSGYYIDAIGTYNAP  250
            GFFGRSG Y+DA+G Y  P
Sbjct  285  GFFGRSGIYLDALGVYVHP  303



>ref|XP_008348486.1| PREDICTED: agglutinin alpha chain-like [Malus domestica]
Length=189

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEY+  ++G +G        ++RS+KF +N R FG +G +  TPF +   +G K
Sbjct  83   IKLQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGTPFTYTL-DGGK  141

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVG  GR+G+YIDAIG + +P
Sbjct  142  IVGLKGRNGWYIDAIGFHVSP  162



>ref|XP_008654965.1| PREDICTED: LOC100282355 isoform X4 [Zea mays]
Length=211

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G    TPF F   +G  
Sbjct  84   IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  142

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG+ +DA+G Y AP
Sbjct  143  IVGFCGRSGWQLDAVGLYVAP  163



>ref|XP_004235622.1| PREDICTED: jacalin-related lectin 19 [Solanum lycopersicum]
Length=201

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   +EYLT +SG +         V+RS+ F++N R+FG +G    TPF+   + G +
Sbjct  75   IKLQFPEEYLTSVSGYYCPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPMEGG-Q  133

Query  312  IVGFFGRSGYYIDAIGTYNA  253
            IVGF GRSG+Y+DAIG Y A
Sbjct  134  IVGFKGRSGWYVDAIGFYIA  153



>ref|XP_008244775.1| PREDICTED: LOW QUALITY PROTEIN: agglutinin-like [Prunus mume]
Length=343

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 3/82 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I +   DE+L  +SG +    F     ++RS+KF +N R FG YG    TPF F   +G 
Sbjct  239  IKLQYPDEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGG  297

Query  315  KIVGFFGRSGYYIDAIGTYNAP  250
            KIVG  GRSG+Y+DAIG + +P
Sbjct  298  KIVGLKGRSGWYLDAIGFHVSP  319


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I +   DEYL   SG +    F     ++RS+KF +N R FG YG    TPF F   +G 
Sbjct  83   IKLQYPDEYLVGASGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGG  141

Query  315  KIVGFFGRSGYYIDAIGTYNAP  250
            +IVG  GR G+Y++AIG + +P
Sbjct  142  QIVGLKGRDGWYLNAIGFHVSP  163



>ref|XP_006343016.1| PREDICTED: agglutinin-like [Solanum tuberosum]
Length=201

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   +EYLT +SG +         V+RS+ F++N R+FG +G    TPF+   + G +
Sbjct  75   IKLQFPEEYLTSVSGYYSPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPMEGG-Q  133

Query  312  IVGFFGRSGYYIDAIGTYNA  253
            IVGF GRSG+Y+DAIG Y A
Sbjct  134  IVGFKGRSGWYLDAIGFYIA  153



>ref|XP_002440568.1| hypothetical protein SORBIDRAFT_09g003330 [Sorghum bicolor]
 gb|EES18998.1| hypothetical protein SORBIDRAFT_09g003330 [Sorghum bicolor]
Length=120

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PNVVTPFNFQAQNGNKIVGFF  298
            + E + EISGT+GAF   +    S+ F TNA + G +G P   TPF+    NG ++VGFF
Sbjct  47   DTEVVKEISGTYGAFDGHE--ASSLTFVTNAGKHGPFGEPRQGTPFSVPVHNGGRVVGFF  104

Query  297  GRSGYYIDAIGTYNAP  250
             RSG  +DA+G Y  P
Sbjct  105  WRSGSLLDALGVYVHP  120



>ref|XP_004960703.1| PREDICTED: agglutinin-like [Setaria italica]
Length=321

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG--PNVVTPFNFQAQNGNKIVG  304
            G  E++ E+SGT GA+   +N++R++   TN R +G +G   N   PF+   QN + IVG
Sbjct  242  GPSEFVKEVSGTIGAYRHYNNIIRTLAIVTNVRTYGPFGNQLNGTAPFSIPVQNNSSIVG  301

Query  303  FFGRSGYYIDAIGTY  259
            FF R   ++DAIG Y
Sbjct  302  FFARGQQFLDAIGVY  316



>ref|XP_008244753.1| PREDICTED: agglutinin-like [Prunus mume]
Length=179

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DE+L  +SG +         ++RS+KF +N R FG YG    TPF F   +G K
Sbjct  76   IKLQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGK  134

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVG  GR+G+Y+DAIG + +P
Sbjct  135  IVGLKGRNGWYLDAIGFHVSP  155



>ref|XP_008654963.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
 ref|XP_008654964.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
Length=231

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G    TPF F   +G  
Sbjct  104  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  162

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG+ +DA+G Y AP
Sbjct  163  IVGFCGRSGWQLDAVGLYVAP  183



>ref|XP_002450764.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
 gb|EES09752.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
Length=1080

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -3

Query  468   EYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
             EY+ E+SGT+G  +   D V+ S+   TN   +G +G    TPF+ +      IVGFFGR
Sbjct  1004  EYVKEVSGTYGLCSPHPDVVITSLTLVTNLCSYGPFGQPTGTPFHTRVDKTASIVGFFGR  1063

Query  291   SGYYIDAIGTYNAP  250
             SG Y+DAIG Y  P
Sbjct  1064  SGIYLDAIGVYVRP  1077



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG    S  V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  54   EYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHGR  112

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  113  CGAYLDAIGVY  123



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG    S  V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  85   EYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHGR  143

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  144  CGAYLDAIGVY  154



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG    S  V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  101  EYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHGR  159

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  160  CGAYLDAIGVY  170



>ref|XP_008654962.1| PREDICTED: LOC100282355 isoform X2 [Zea mays]
 gb|AFW80927.1| hypothetical protein ZEAMMB73_478294 [Zea mays]
Length=237

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G    TPF F   +G  
Sbjct  110  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  168

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG+ +DA+G Y AP
Sbjct  169  IVGFCGRSGWQLDAVGLYVAP  189



>ref|XP_008654961.1| PREDICTED: LOC100282355 isoform X1 [Zea mays]
Length=238

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G    TPF F   +G  
Sbjct  111  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  169

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG+ +DA+G Y AP
Sbjct  170  IVGFCGRSGWQLDAVGLYVAP  190



>ref|XP_006654724.1| PREDICTED: agglutinin-like [Oryza brachyantha]
Length=200

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASS--DNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNG  319
            I +   +EY+T +SG +   A+   +  +RS+ FTTN RE+G +G     TPF F   +G
Sbjct  70   IKLSFPEEYVTTVSGHYAPVAAHGGEPAIRSLAFTTNRREYGPFGAAAEGTPFTFPV-DG  128

Query  318  NKIVGFFGRSGYYIDAIGTYNAP  250
              +VGF+GRSG  +DA+G + AP
Sbjct  129  GAVVGFWGRSGRQLDAVGVHVAP  151



>ref|NP_001056189.1| Os05g0541800 [Oryza sativa Japonica Group]
 dbj|BAF18103.1| Os05g0541800, partial [Oryza sativa Japonica Group]
Length=133

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 49/84 (58%), Gaps = 5/84 (6%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFAS--SDNVLRSIKFTTNAREFGTYGPNVV--TPFNFQAQN  322
            I +   +EYLT +SG + A A   +  V+R + F TN RE+G  G      TPF F   +
Sbjct  1    IKLGFPEEYLTAVSGHYAAVAQGGAPAVIRWLAFRTNRREYGPLGGGAAEGTPFAFPV-D  59

Query  321  GNKIVGFFGRSGYYIDAIGTYNAP  250
            G  IVGF+GRSG  +DA+G + AP
Sbjct  60   GGAIVGFWGRSGRQLDAVGLHVAP  83



>dbj|BAK00987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E+LTE+SGT     S   V+ SI+F TN + +G +G    TPF F      K+VGFFGR 
Sbjct  233  EFLTEVSGTISD--SRCEVVESIQFVTNIQTYGPFGTQDGTPFTFSVPRYKKVVGFFGRG  290

Query  288  GYYIDAIGTYNAP  250
            G ++DAIG Y  P
Sbjct  291  GLFLDAIGIYLQP  303



>ref|XP_004964114.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=118

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            + E++ EIS TFG F  +  V+ S+KF TN R FG +   + TPF+   Q+ + IVGFF 
Sbjct  44   DSEFVKEISRTFGTFDGA-IVVTSLKFVTNVRTFGPWSRGIGTPFSVPVQSRSGIVGFFA  102

Query  294  RSGYYIDAIGTY  259
              G Y+DAIG +
Sbjct  103  HVGKYLDAIGVH  114



>ref|XP_009784520.1| PREDICTED: uncharacterized protein LOC104232941, partial [Nicotiana 
sylvestris]
Length=1047

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP-NVVTPFNFQAQNGNKIVGFFGR  292
            EYLT I+GTFG +  S  V++S+ F TNA+ +G +G  +  TPF+   + G  IVGF G 
Sbjct  94   EYLTGINGTFG-YGGSHLVIKSLCFITNAKSYGPFGSKDGGTPFSLVMKEGVAIVGFHGC  152

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  153  SGLYLDAIGVY  163



>ref|XP_006662272.1| PREDICTED: uncharacterized protein LOC102701759 [Oryza brachyantha]
Length=283

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E++ E+SGT GAF   DNV+ S+K  TN   +G +G    TPFN      N I+GFFGR+
Sbjct  212  EFIREVSGTTGAFLG-DNVVTSLKIITNLNMYGPFGVPFGTPFNVPLHGNNGIIGFFGRA  270

Query  288  GYYIDAIGTY  259
            G +++AIG Y
Sbjct  271  GQFLNAIGVY  280



>gb|AAM46813.1| hessian fly response gene 1 protein [Triticum aestivum]
Length=345

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSD---NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            E +TE+SGT G FA  +   N + S+  TTN R +G +G    TPF+   Q+ N IVGFF
Sbjct  266  EIVTEVSGTVGIFAEDNVEYNAIASLTITTNHRPYGPFGETQSTPFSVPVQDNNNIVGFF  325

Query  297  GRSGYYIDAIGTY  259
              +G Y++A+G Y
Sbjct  326  ACAGKYVEALGVY  338



>ref|XP_008651439.1| PREDICTED: jasmonate-induced protein isoform X1 [Zea mays]
 gb|ACL53153.1| unknown [Zea mays]
 tpg|DAA60180.1| TPA: beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYGPNVVTPFNFQAQNGNKIV  307
            G+ E LTE+SGT G       V+ SIKF T+ +    FG +G    TPF    Q G+ IV
Sbjct  228  GDSEVLTELSGTIGNV-DGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIV  286

Query  306  GFFGRSGYYIDAIGTY  259
            GFF R+G Y+DA+G Y
Sbjct  287  GFFARAGVYLDALGVY  302



>ref|XP_010232948.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=266

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDNVL--RSIKFTTNARE-FGTYGPNVVTPFNFQAQ-NGNKIVG  304
            DEYL  + G  G +   DN L  RS+ F TNAR  FG YG     PF   A   G +I+G
Sbjct  191  DEYLAGVKGHVGHY---DNCLVVRSLTFVTNARRSFGPYGKEEGVPFALPAAVAGGRIIG  247

Query  303  FFGRSGYYIDAIGTY  259
            FFG SG Y+DAIGTY
Sbjct  248  FFGSSGLYLDAIGTY  262



>gb|AHW81907.1| mannose-binding lectin [Morus alba var. atropurpurea]
Length=161

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAF---ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            I +D  +E+L  +SG  G     A+  +V+RS+ F TN + +G YG    TPF+   +NG
Sbjct  80   ITLDFPNEFLVSVSGYTGVLPRLATGKDVIRSLTFKTNKKTYGPYGTEEGTPFSLPIENG  139

Query  318  NKIVGFFGRSGYYIDAIG  265
              IVGF GRSGY +DAIG
Sbjct  140  -LIVGFKGRSGYVVDAIG  156



>ref|XP_009338132.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338133.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
Length=764

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I ++  DEYL  ++G +   A     ++RS+KF +N R FG +G    T F +  + G K
Sbjct  658  IKLEYPDEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIQEGTTFTYNVEGG-K  716

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVG  GR+G+YIDAIG + +P
Sbjct  717  IVGLKGRNGWYIDAIGFHVSP  737



>ref|NP_001141303.1| uncharacterized protein LOC100273394 [Zea mays]
 gb|ACF86025.1| unknown [Zea mays]
Length=306

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYGPNVVTPFNFQAQNGNKIV  307
            G+ E LTE+SGT G       V+ SIKF T+ +    FG +G    TPF    Q G+ IV
Sbjct  228  GDSEVLTELSGTIGNV-DGLTVITSIKFVTSLKTYGPFGAWGDGSDTPFTIPVQQGSAIV  286

Query  306  GFFGRSGYYIDAIGTY  259
            GFF R+G Y+DA+G Y
Sbjct  287  GFFARAGIYLDAVGVY  302



>ref|XP_004977415.1| PREDICTED: uncharacterized protein LOC101784527 isoform X1 [Setaria 
italica]
 ref|XP_004977416.1| PREDICTED: uncharacterized protein LOC101784527 isoform X2 [Setaria 
italica]
Length=306

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFAS-SDNVLRSIKF-TTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            E++T ++GT G F S  D V+ S+ F T+  R +G YG    T F+  A +G  IVGF+G
Sbjct  202  EHVTAVAGTIGHFGSVPDAVITSLTFRTSTGRTYGPYGNKTTTTFSVPAADGACIVGFWG  261

Query  294  RSGYYIDAIGTYNAPD  247
            RSG+ +DAIG Y  P 
Sbjct  262  RSGWLLDAIGVYIKPS  277



>gb|AAL10685.1| mannose-binding lectin [Morus nigra]
Length=161

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAF---ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            I +D  +E+L  +SG  G     A+  +V+RS+ F TN + +G YG    TPF+   +NG
Sbjct  80   ITLDFPNEFLVSVSGYTGVLPRLATGKDVIRSLTFKTNKKTYGPYGKEEGTPFSLPIENG  139

Query  318  NKIVGFFGRSGYYIDAIGTY  259
              IVGF GRSG+ +DAIG +
Sbjct  140  -LIVGFKGRSGFVVDAIGVH  158



>ref|XP_004979670.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Setaria 
italica]
Length=823

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G      F+   ++   IVGFF
Sbjct  592  GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFF  651

Query  297  GRSGYYIDAIGTY  259
            GR+G Y+DAIG Y
Sbjct  652  GRAGRYLDAIGVY  664


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G     PF+ Q Q+   IVGFF
Sbjct  399  GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFF  458

Query  297  GRSGYYIDAIGTYNAPD  247
            G S  Y++AIG Y   D
Sbjct  459  GHSRRYLEAIGFYTDQD  475


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E++ ++SGTF A+    NVL S+   TN  R +G YG    T F+   Q+ ++IVGFF  
Sbjct  749  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  808

Query  291  SGYYIDAIGTY  259
               YI+AIG Y
Sbjct  809  GEDYIEAIGAY  819



>ref|XP_004979671.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Setaria 
italica]
Length=793

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G      F+   ++   IVGFF
Sbjct  562  GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFF  621

Query  297  GRSGYYIDAIGTY  259
            GR+G Y+DAIG Y
Sbjct  622  GRAGRYLDAIGVY  634


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G     PF+ Q Q+   IVGFF
Sbjct  348  GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFF  407

Query  297  GRSGYYIDAIGTYNAPD  247
            G S  Y++AIG Y   D
Sbjct  408  GHSRRYLEAIGFYTDQD  424


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E++ ++SGTF A+    NVL S+   TN  R +G YG    T F+   Q+ ++IVGFF  
Sbjct  719  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  778

Query  291  SGYYIDAIGTY  259
               YI+AIG Y
Sbjct  779  GEDYIEAIGAY  789



>ref|XP_004979669.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Setaria 
italica]
Length=844

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G      F+   ++   IVGFF
Sbjct  613  GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFF  672

Query  297  GRSGYYIDAIGTY  259
            GR+G Y+DAIG Y
Sbjct  673  GRAGRYLDAIGVY  685


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G     PF+ Q Q+   IVGFF
Sbjct  399  GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFF  458

Query  297  GRSGYYIDAIGTYNAPD  247
            G S  Y++AIG Y   D
Sbjct  459  GHSRRYLEAIGFYTDQD  475


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E++ ++SGTF A+    NVL S+   TN  R +G YG    T F+   Q+ ++IVGFF  
Sbjct  770  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  829

Query  291  SGYYIDAIGTY  259
               YI+AIG Y
Sbjct  830  GEDYIEAIGAY  840



>ref|XP_009622525.1| PREDICTED: agglutinin-like isoform X2 [Nicotiana tomentosiformis]
Length=546

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            EYLT I GTFG   S  +V++ + F TNA+ +G +G    TPF+   + G  IVGF GR 
Sbjct  12   EYLTGIKGTFGRCGSY-SVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRC  70

Query  288  GYYIDAIGTY  259
            G Y+DAIG Y
Sbjct  71   GAYLDAIGVY  80


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GTF  F    +V++S+ F TNA  +G +G     TPF+   + G  IVGF GR
Sbjct  401  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  459

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  460  SGLYLDAIGVY  470


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -3

Query  465  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRSG  286
            YLT I GTFG + S  +V++S+ F TNA+ +G +G    TPF+   + G  I GF G   
Sbjct  196  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  254

Query  285  YYIDAIGTY  259
             Y+DAIG Y
Sbjct  255  AYLDAIGVY  263



>gb|KJB58185.1| hypothetical protein B456_009G198200 [Gossypium raimondii]
Length=1244

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
             + +D  DE+LT I G +G+      ++ RS+ F +N + +G +G    T F   + N  K
Sbjct  984   VKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIEQGTSF---SMNKGK  1040

Query  312   IVGFFGRSGYYIDAIGTYNAP  250
             IVGF GRSG+Y+DAIG Y+ P
Sbjct  1041  IVGFRGRSGWYLDAIGVYSKP  1061



>ref|XP_011081586.1| PREDICTED: jacalin-related lectin 19-like [Sesamum indicum]
Length=308

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +   DEYLTE+SG         N + RS+KF +N R +G +G    TPF F  + G  
Sbjct  24   VKLQFPDEYLTEVSGHCSPLGRRGNAMVRSLKFRSNWRTYGPFGVESETPFCFPME-GGM  82

Query  312  IVGFFGRSGYYIDAIG  265
            IVGF GR G Y+DAIG
Sbjct  83   IVGFRGRCGLYVDAIG  98


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   +E+LT ++G         + V+RS+ F +N R FG +G     PF+F  + G +
Sbjct  219  IKLKFPEEFLTTVTGHCSPVVCGGSPVIRSLTFKSNRRTFGPFGVEEGVPFSFPMEGG-Q  277

Query  312  IVGFFGRSGYYIDAIGTYNA  253
            IVGF GR+G+Y+DAIG + A
Sbjct  278  IVGFKGRAGWYLDAIGFHIA  297



>ref|XP_009622524.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Nicotiana 
tomentosiformis]
Length=569

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            EYLT I GTFG   S  +V++ + F TNA+ +G +G    TPF+   + G  IVGF GR 
Sbjct  35   EYLTGIKGTFGRCGSY-SVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRC  93

Query  288  GYYIDAIGTY  259
            G Y+DAIG Y
Sbjct  94   GAYLDAIGVY  103


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GTF  F    +V++S+ F TNA  +G +G     TPF+   + G  IVGF GR
Sbjct  424  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  482

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  483  SGLYLDAIGVY  493


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -3

Query  465  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRSG  286
            YLT I GTFG + S  +V++S+ F TNA+ +G +G    TPF+   + G  I GF G   
Sbjct  219  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  277

Query  285  YYIDAIGTY  259
             Y+DAIG Y
Sbjct  278  AYLDAIGVY  286



>ref|XP_008806712.1| PREDICTED: agglutinin-like isoform X2 [Phoenix dactylifera]
Length=197

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +   +E+LT +SG +       + V+RS+ F +N R FG +G    TPF F   +G  
Sbjct  73   VKLQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTF-PMDGGM  131

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG+Y+DAIG   +P
Sbjct  132  IVGFSGRSGWYLDAIGLCVSP  152



>ref|XP_008806706.1| PREDICTED: agglutinin-like isoform X1 [Phoenix dactylifera]
Length=200

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +   +E+LT +SG +       + V+RS+ F +N R FG +G    TPF F   +G  
Sbjct  76   VKLQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTF-PMDGGM  134

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG+Y+DAIG   +P
Sbjct  135  IVGFSGRSGWYLDAIGLCVSP  155



>gb|AFW81812.1| putative protein kinase superfamily protein [Zea mays]
Length=503

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E+L  +SGT G +A    +V+RS+ F TN R + T G  V  PF  +A  G+ IVGF  R
Sbjct  429  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  488

Query  291  SGYYIDAIGTYNAP  250
            +G+++DA+G Y+ P
Sbjct  489  AGHFLDALGVYHRP  502



>emb|CAE76026.1| B1292H11.12 [Oryza sativa Japonica Group]
 gb|EAZ29534.1| hypothetical protein OsJ_13607 [Oryza sativa Japonica Group]
Length=183

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDN-VLRSIKFTTNA-REFGTYG----PNVVTPFNFQAQNGNKI  310
            DE +T + GT G F   D  V+ S+ F TNA + +G YG        TPF+    NG  +
Sbjct  103  DEQVTSVEGTIGRFRDVDEPVITSLTFRTNAGKTYGPYGGASDKQAGTPFSIPVDNGGVV  162

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            VGF+GR+G+ IDAIG Y +P
Sbjct  163  VGFWGRAGWLIDAIGVYISP  182



>ref|XP_006301377.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
 gb|EOA34275.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
Length=177

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYL  +SG +    SS   V+RS+ F +N + +G YG    TPF F   NG +
Sbjct  75   IKLQYPDEYLIGVSGYYCPLVSSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGR  133

Query  312  IVGFFGRSGYYIDAIG  265
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGMNGRSGWYLDSIG  149



>ref|XP_008656248.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Zea 
mays]
 ref|XP_008656249.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Zea 
mays]
Length=488

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E+L  +SGT G +A    +V+RS+ F TN R + T G  V  PF  +A  G+ IVGF  R
Sbjct  414  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  473

Query  291  SGYYIDAIGTYNAP  250
            +G+++DA+G Y+ P
Sbjct  474  AGHFLDALGVYHRP  487



>ref|XP_002439182.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
 gb|EES17612.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
Length=304

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = -3

Query  486  NIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
             ID +D EY+ E+SGT+G F     VL S K  TN R +G +     TPF+  A   + I
Sbjct  227  RIDLDDAEYVKEVSGTYGTF-EGITVLTSFKLVTNVRTWGPWAIENGTPFSITAPTNSSI  285

Query  309  VGFFGRSGYYIDAIGTYNA  253
            VGF+GR+G  IDAIG Y A
Sbjct  286  VGFYGRAGRLIDAIGVYFA  304



>emb|CAD40628.2| OSJNBa0016N04.16 [Oryza sativa Japonica Group]
 emb|CAD40707.2| OSJNBb0042I07.4 [Oryza sativa Japonica Group]
 emb|CAH66364.1| H0607F01.9 [Oryza sativa Indica Group]
Length=477

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            EY+TE+SGT G F  +   V+ S+ F TN   +G +G    TPF+   Q+   IVGFF R
Sbjct  79   EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  138

Query  291  SGYYIDAIGTYNAP  250
            +G+Y+DA G Y  P
Sbjct  139  AGWYVDAFGIYVNP  152



>gb|EMS51533.1| hypothetical protein TRIUR3_05238 [Triticum urartu]
Length=304

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DE+LT +SG +GA A   + V+RS+ F T    +G +G    TPF F A  G  
Sbjct  167  IKLSFPDEHLTAVSGRYGAVAPGGSPVIRSLAFRTERAAYGPFGAAEGTPFEF-AVEGGV  225

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVG  GRSG+ +DA+G Y  P
Sbjct  226  IVGLCGRSGWQLDAVGMYVTP  246



>ref|XP_002461768.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
 gb|EER98289.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
Length=361

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            E E +TE+SGT G F   + V+ SIKF TN + +G +G     PF    Q G+ IVGFF 
Sbjct  231  ESEVVTEVSGTVGNF-YDNTVITSIKFVTNLQTYGPWGDGQDAPFTIPVQPGSGIVGFFA  289

Query  294  RSGYYIDAIGTY  259
            R+G  +DAIG Y
Sbjct  290  RAGDCLDAIGVY  301



>ref|XP_009367509.1| PREDICTED: agglutinin alpha chain [Pyrus x bretschneideri]
Length=189

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEY+  ++G +G        ++RS+KF +N R FG +G +  TPF +     +K
Sbjct  83   IKLQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGTPFTYTLDR-SK  141

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVG  GR+G+YIDAIG + +P
Sbjct  142  IVGLKGRNGWYIDAIGFHVSP  162



>ref|XP_006651478.1| PREDICTED: horcolin-like [Oryza brachyantha]
Length=165

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E +TE+ GT G F   D+++ S+K  T+ R  G +G    TPF+        +VGFF R+
Sbjct  87   ERVTEVHGTMGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSLPVLGDGAVVGFFARA  146

Query  288  GYYIDAIGTYNAP  250
            G +++AIG Y  P
Sbjct  147  GEHLEAIGVYVNP  159



>gb|KJB58186.1| hypothetical protein B456_009G198200 [Gossypium raimondii]
Length=1512

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
             + +D  DE+LT I G +G+      ++ RS+ F +N + +G +G    T F   + N  K
Sbjct  984   VKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIEQGTSF---SMNKGK  1040

Query  312   IVGFFGRSGYYIDAIGTYNAP  250
             IVGF GRSG+Y+DAIG Y+ P
Sbjct  1041  IVGFRGRSGWYLDAIGVYSKP  1061


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 41/78 (53%), Gaps = 2/78 (3%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
             I  D   E LT I+GTF        NV+RS+ F TN  + G YG      F  +   G K
Sbjct  1219  IMFDYPSEILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPSFTNKMNEG-K  1277

Query  312   IVGFFGRSGYYIDAIGTY  259
             IVGF GR G ++DA+G +
Sbjct  1278  IVGFLGREGLFLDAVGVH  1295


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 3/79 (4%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
             + +D   E L  ISG +G+    +   V+RS+ F T+  ++G +G  V T F      G 
Sbjct  1415  VKLDYPHEVLICISGYYGSINEEEKSKVIRSLTFYTSRGKYGPFGEEVGTYFTSTTTQG-  1473

Query  315   KIVGFFGRSGYYIDAIGTY  259
             K+VGF GR   Y+DAIG +
Sbjct  1474  KVVGFHGRCSSYLDAIGVH  1492



>gb|ABA94728.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ12138.1| hypothetical protein OsJ_02021 [Oryza sativa Japonica Group]
Length=837

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E+L  + GT G F +S  V+ S+ F TN R +G +G    TPF+   Q+  KIVGFF
Sbjct  761  GSSEFLVRVFGTIGPFRASRCVVTSVTFVTNVRSYGPFGQGGGTPFDVPMQSNGKIVGFF  820

Query  297  GRSGYYIDAIGTY  259
            G +  Y++A+G Y
Sbjct  821  GHARSYVEALGVY  833


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGF  301
            G  E+L E+SGT G FA+S  NV+ S+   TN   +G +G     PF    Q    IVGF
Sbjct  441  GPSEFLLEVSGTIGRFANSRSNVITSLTLVTNEDRYGHFGTERGDPFCTTLQTNCSIVGF  500

Query  300  FGRSGYYIDAIGTY  259
            F R+  Y+ AIG Y
Sbjct  501  FARASRYMHAIGVY  514



>ref|NP_001104964.1| beta-glucosidase aggregating factor precursor [Zea mays]
 gb|AAF71261.2|AF232008_1 beta-glucosidase aggregating factor precursor [Zea mays]
Length=306

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYGPNVVTPFNFQAQNGNKIV  307
            G+ E LTE+SGT G       V+ SIKF T+ +    FG +G    TPF    Q G+ IV
Sbjct  228  GDSEVLTELSGTIGNV-DGLTVITSIKFVTSLKTYGPFGAWGNGSDTPFAIPVQQGSAIV  286

Query  306  GFFGRSGYYIDAIGTY  259
            GFF R+G Y+DA+G Y
Sbjct  287  GFFARAGVYLDALGVY  302



>ref|XP_003577374.2| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Brachypodium 
distachyon]
Length=588

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E+LT +SGT G + S+   V++S+ F T A  +G +G    TPF    Q+   IVGFF R
Sbjct  191  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  250

Query  291  SGYYIDAIGTYNAP  250
            +G+Y+DA G Y  P
Sbjct  251  AGWYLDAFGIYVKP  264


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 40/75 (53%), Gaps = 2/75 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAF--ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            E+LT + GT G F  ASSD ++ S+   TN   +G +G    T F         IVGFFG
Sbjct  346  EFLTGVRGTTGPFDPASSDVIVTSLTLITNTHSYGPFGQGRGTSFQIPLWGKGSIVGFFG  405

Query  294  RSGYYIDAIGTYNAP  250
             S  YI+AIG Y  P
Sbjct  406  CSESYINAIGVYVNP  420



>gb|ABF96452.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH01034.1| unnamed protein product [Oryza sativa Japonica Group]
Length=176

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E +TE+ GT G F   D+++ S+K  T+ R  G +G    TPF+   +    +VGFF R+
Sbjct  98   ERVTEVHGTVGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFFVRA  157

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y  P
Sbjct  158  GAYLEAIGVYVNP  170



>gb|ABJ97445.1| beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYGPNVVTPFNFQAQNGNKIV  307
            G+ E LTE+SGT G       V+ SIKF T+ +    FG +G    TPF    Q G+ IV
Sbjct  228  GDSEVLTELSGTIGNV-DGLTVITSIKFVTSLKTYGPFGAWGNGSDTPFAIPVQQGSAIV  286

Query  306  GFFGRSGYYIDAIGTY  259
            GFF R+G Y+DA+G Y
Sbjct  287  GFFARAGVYLDALGVY  302



>ref|XP_007216928.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
 gb|EMJ18127.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
Length=351

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I +   DE+L  +SG +    F     ++RS+KF +N R FG YG    TPF F   +G 
Sbjct  247  IKLQYPDEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGG  305

Query  315  KIVGFFGRSGYYIDAIGTYNAP  250
            KIVG  GR G+Y+DAIG + +P
Sbjct  306  KIVGLKGRDGWYLDAIGFHVSP  327


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I +   DE+L  +SG +    F     ++RS+KF +N R FG YG    TPF F   +G 
Sbjct  92   IKLQYPDEHLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGG  150

Query  315  KIVGFFGRSGYYIDAIGTYNAP  250
            +IVG  GR G+Y+DAIG + +P
Sbjct  151  QIVGLKGRDGWYLDAIGFHVSP  172



>ref|NP_001052560.1| Os04g0369100 [Oryza sativa Japonica Group]
 dbj|BAF14474.1| Os04g0369100 [Oryza sativa Japonica Group]
Length=770

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            EY+TE+SGT G F  +   V+ S+ F TN   +G +G    TPF+   Q+   IVGFF R
Sbjct  372  EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  431

Query  291  SGYYIDAIGTYNAP  250
            +G+Y+DA G Y  P
Sbjct  432  AGWYVDAFGIYVNP  445



>gb|EEE60834.1| hypothetical protein OsJ_14451 [Oryza sativa Japonica Group]
Length=736

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            EY+TE+SGT G F  +   V+ S+ F TN   +G +G    TPF+   Q+   IVGFF R
Sbjct  338  EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  397

Query  291  SGYYIDAIGTYNAP  250
            +G+Y+DA G Y  P
Sbjct  398  AGWYVDAFGIYVNP  411



>ref|XP_009400545.1| PREDICTED: agglutinin alpha chain [Musa acuminata subsp. malaccensis]
Length=200

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I ++  +EYLT ISG +   A     V+RS+ F +N R FG +G     PF    + G  
Sbjct  76   IKLEHPEEYLTTISGHYCPMAYGGSPVIRSLTFKSNQRTFGPFGVQDGIPFTLPMEGG-M  134

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GR G+Y+DAIG   +P
Sbjct  135  IVGFSGRCGWYLDAIGWCISP  155



>ref|NP_001068257.2| Os11g0607900 [Oryza sativa Japonica Group]
 dbj|BAF28620.2| Os11g0607900, partial [Oryza sativa Japonica Group]
Length=107

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
             EYLT ISGT  A +    ++ S+   TN R +G YG    TPF    Q    IVGFFGR
Sbjct  23   SEYLTGISGTI-ASSPYGVIITSLTLVTNTRTYGPYGQVGGTPFQIPIQIKGSIVGFFGR  81

Query  291  SGYYIDAIGTYNAPD  247
             G+Y+DA G Y  P+
Sbjct  82   VGWYVDAFGIYVNPN  96



>gb|AAK55472.1|AC084295_5 putative salt-induced protein [Oryza sativa Japonica Group]
 gb|AAP12924.1| putative salt-induced protein [Oryza sativa Japonica Group]
 gb|EAY90358.1| hypothetical protein OsI_11938 [Oryza sativa Indica Group]
Length=191

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E +TE+ GT G F   D+++ S+K  T+ R  G +G    TPF+   +    +VGFF R+
Sbjct  113  ERVTEVHGTVGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFFVRA  172

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y  P
Sbjct  173  GAYLEAIGVYVNP  185



>ref|XP_002467725.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
 gb|EER94723.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
Length=149

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  EY+TE++G+ G      + + S+KF TN   +G +G    TPFN    N   +VG F
Sbjct  73   GAHEYVTEVAGSVGPIGDLTHTITSLKFVTNRGTYGPFGRGDGTPFNVPVLNNGSVVGMF  132

Query  297  GRSGYYIDAIGTYNAP  250
             R+  Y+DAIG Y  P
Sbjct  133  ARADQYLDAIGFYVLP  148



>ref|XP_010092355.1| hypothetical protein L484_023733 [Morus notabilis]
 gb|EXB51031.1| hypothetical protein L484_023733 [Morus notabilis]
Length=185

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAF---ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            I +D  +E+L  +SG  G     A+  +V+RS+ F TN + +G YG    TPF+   +NG
Sbjct  104  ITLDFPNEFLVSVSGHTGVLPRLATGKDVIRSLTFKTNQKTYGPYGKEEGTPFSLPIENG  163

Query  318  NKIVGFFGRSGYYIDAIG  265
              IVGF GRSG+ +DAIG
Sbjct  164  -LIVGFKGRSGFVVDAIG  180



>ref|XP_010237569.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Brachypodium 
distachyon]
Length=690

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E+LT +SGT G + S+   V++S+ F T A  +G +G    TPF    Q+   IVGFF R
Sbjct  293  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  352

Query  291  SGYYIDAIGTYNAP  250
            +G+Y+DA G Y  P
Sbjct  353  AGWYLDAFGIYVKP  366


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 40/75 (53%), Gaps = 2/75 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAF--ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            E+LT + GT G F  ASSD ++ S+   TN   +G +G    T F         IVGFFG
Sbjct  448  EFLTGVRGTTGPFDPASSDVIVTSLTLITNTHSYGPFGQGRGTSFQIPLWGKGSIVGFFG  507

Query  294  RSGYYIDAIGTYNAP  250
             S  YI+AIG Y  P
Sbjct  508  CSESYINAIGVYVNP  522



>ref|XP_006372713.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
 gb|ERP50510.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
Length=173

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVG  304
            I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G    TPF+    N N +VG
Sbjct  94   INWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGSGTPFSIPINN-NTVVG  151

Query  303  FFGRSGYYIDAIGTYNAPD  247
            F GR+G+Y+DAIG +  P+
Sbjct  152  FHGRAGHYLDAIGIFVKPE  170



>ref|NP_001050311.2| Os03g0399800 [Oryza sativa Japonica Group]
 dbj|BAF12225.2| Os03g0399800, partial [Oryza sativa Japonica Group]
Length=199

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E +TE+ GT G F   D+++ S+K  T+ R  G +G    TPF+   +    +VGFF R+
Sbjct  121  ERVTEVHGTVGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFFVRA  180

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y  P
Sbjct  181  GAYLEAIGVYVNP  193



>sp|P83304.1|LEC_PARPC RecName: Full=Mannose/glucose-specific lectin, partial [Parkia 
platycephala]
 pdb|1ZGR|A Chain A, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGR|B Chain B, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGS|A Chain A, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
 pdb|1ZGS|B Chain B, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
Length=447

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            ++I+   EYLT ISGT+G +   D    + S+ FTTN   +G +G    T F+    N N
Sbjct  363  VSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHN-N  421

Query  315  KIVGFFGRSGYYIDAIGTYNAPD  247
             +VGF GR+G Y+DAIG +  PD
Sbjct  422  MVVGFHGRAGDYLDAIGIFVKPD  444


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            + IDG  E+L  ISGT+G +   + V+ S+ F TN  + G +G    T F+   + G+ +
Sbjct  217  VEIDGNLEHLKSISGTYGNYKGFE-VVTSLSFITNVTKHGPFGIASGTSFSIPIE-GSLV  274

Query  309  VGFFGRSGYYIDAIGTYNAP  250
             GF G+SGYY+D+IG Y  P
Sbjct  275  TGFHGKSGYYLDSIGIYVKP  294



>gb|AAZ73664.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73665.1| At1g19715, partial [Arabidopsis thaliana]
Length=172

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            +  D   EYL  ++GT+G+F     + +RS+ F +N R++G +G +  T F    ++G+K
Sbjct  1    VKFDYPHEYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSK  59

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+Y+DAIG +  P
Sbjct  60   IIGFHGKAGWYLDAIGVHTQP  80



>gb|AAZ73661.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73662.1| At1g19715, partial [Arabidopsis thaliana]
Length=175

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            +  D   EYL  ++GT+G+F     + +RS+ F +N R++G +G +  T F    ++G+K
Sbjct  1    VKFDYPHEYLISVNGTYGSFDVWGTICIRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSK  59

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+Y+DAIG +  P
Sbjct  60   IIGFHGKAGWYLDAIGVHTQP  80



>pdb|1XXQ|A Chain A, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|B Chain B, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|C Chain C, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|D Chain D, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXR|A Chain A, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|B Chain B, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|C Chain C, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|D Chain D, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
Length=161

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA---SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            I +D  +E+L  +SG  G  A   +  +V+RS+ F TN + +G YG    TPF+   +NG
Sbjct  80   ITLDFPNEFLVSVSGYTGVLARLATGKDVIRSLTFKTNKKTYGPYGKEEGTPFSLPIENG  139

Query  318  NKIVGFFGRSGYYIDAIG  265
              IVGF GRSG+ +DAIG
Sbjct  140  -LIVGFKGRSGFVVDAIG  156



>ref|XP_008804538.1| PREDICTED: uncharacterized protein LOC103717797 [Phoenix dactylifera]
Length=602

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            + +D   E LT +SG FG+ +S   ++RS+ F +N  ++G +G      F+F   +G KI
Sbjct  74   VKLDHPHEILTSVSGYFGSLSSGSPLIRSLTFESNQAKYGPFGFEQGMRFSF-PMSGGKI  132

Query  309  VGFFGRSGYYIDAIGTY  259
            VGF GRSG+Y+D+IG Y
Sbjct  133  VGFHGRSGWYLDSIGFY  149



>ref|XP_004984089.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=151

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I +D   EY+TE++GT G    + + + S+KF TN   +G +G    TPFN    N + +
Sbjct  73   ITLDAS-EYVTEVAGTIGPIGDAPHTISSLKFVTNRATYGPFGRGAGTPFNVPLDNAS-V  130

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            V  F R+G Y+DAIG Y  P
Sbjct  131  VAMFARAGDYLDAIGFYVLP  150



>gb|AAZ73652.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73653.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73654.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73655.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73656.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73657.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73658.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73659.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73660.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73663.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73666.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73667.1| At1g19715, partial [Arabidopsis thaliana]
 gb|AAZ73668.1| At1g19715, partial [Arabidopsis thaliana]
Length=175

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            +  D   EYL  ++GT+G+F     + +RS+ F +N R++G +G +  T F    ++G+K
Sbjct  1    VKFDYPHEYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSK  59

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+Y+DAIG +  P
Sbjct  60   IIGFHGKAGWYLDAIGVHTQP  80



>ref|XP_008466548.1| PREDICTED: agglutinin-like [Cucumis melo]
Length=476

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFG---AFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
            + +D  +EYL  I G +G    +  + NV+RS+ F TN + +G +G      F+F    G
Sbjct  75   VVLDYPNEYLISIYGYYGYIGKWGLAHNVIRSLTFQTNRKTYGPFGKEEGVKFSFPIM-G  133

Query  318  NKIVGFFGRSGYYIDAIGTYNAP  250
             KIVGF GRSG+Y+DAIG Y  P
Sbjct  134  AKIVGFHGRSGWYLDAIGLYIQP  156



>ref|XP_006390600.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
 gb|ESQ27886.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
Length=176

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYL  +SG +     S + V+RSI F +N + +G YG    TPF F   NG +
Sbjct  75   IKLQYPDEYLIGVSGYYWPVVHSGSPVIRSITFKSNKQVYGPYGVEQGTPFTFSV-NGGR  133

Query  312  IVGFFGRSGYYIDAIG  265
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGINGRSGWYLDSIG  149



>ref|XP_009588771.1| PREDICTED: agglutinin-like [Nicotiana tomentosiformis]
Length=345

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GT G   S   V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  84   EYLTGIKGTLGHHGSH-LVVKSLSFITNAKNYGPFGTEGGGTPFSLVMKEGGAIVGFHGR  142

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  143  SGLYLDAIGVY  153


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I+IDGE E L  I G +     +   + +R I F TN  ++G YG  + T F+  A  G 
Sbjct  264  IHIDGESEILVGIEGFYSPVDDNGGLDTIRQIAFYTNKGKYGPYGTEIGTYFSSSAARG-  322

Query  315  KIVGFFGRSGYYIDAIGTY  259
            KIVGF G+SG +++AIG +
Sbjct  323  KIVGFHGKSGVFLNAIGVH  341



>gb|EMS53468.1| hypothetical protein TRIUR3_21407 [Triticum urartu]
Length=135

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            DE+ T + G +G F  S  V+RS+ F +NAR FG YG     PF   A  G KI+GF  R
Sbjct  54   DEHFTGVVGHYGEFDGS-FVVRSLTFVSNARSFGPYGQEDGVPFALPAA-GGKILGFHAR  111

Query  291  SGYYIDAIGTY  259
            SG  +DA+GTY
Sbjct  112  SGRRLDALGTY  122



>ref|XP_004986922.1| PREDICTED: horcolin-like [Setaria italica]
Length=132

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E+LTE+SGTF    +   + + S+ F TN R+ G +G    TPF+   ++G +IV  FGR
Sbjct  55   EFLTEVSGTFAYIGTQPTDAVTSLTFVTNLRKHGPFGDVDGTPFSVPVRDGGRIVALFGR  114

Query  291  SGYYIDAIGTY  259
               YIDAIG Y
Sbjct  115  GWDYIDAIGVY  125



>gb|ABA94721.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
Length=734

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E++T++ GT G F    +V+ SI FTTNA  +G +G    T F     +   IVGFF
Sbjct  658  GPSEFVTKVYGTIGPFGKFSSVITSIHFTTNADRYGPFGQGTGTRFEAPMHSDGSIVGFF  717

Query  297  GRSGYYIDAIGTYNAP  250
            GR+  Y+DAIG Y  P
Sbjct  718  GRTSSYVDAIGFYVVP  733


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            EYLT ISGT  A +    ++ S+   TN R +G YG    TPF    Q    IVGFFGR 
Sbjct  352  EYLTGISGTI-ASSPYGVIITSLTLVTNTRTYGPYGQVGGTPFQIPIQIKGSIVGFFGRV  410

Query  288  GYYIDAIGTYNAPD  247
            G+Y+DA G Y  P+
Sbjct  411  GWYVDAFGIYVNPN  424


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 1/78 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGF  301
            G  E+L   SGT G  ++ + +V+ S+   TNAR +G +G    +PF    +N   I+GF
Sbjct  502  GSSEFLIGFSGTTGPSSTLAKDVVTSLTLITNARSYGPFGQVEGSPFQVPMRNNASIIGF  561

Query  300  FGRSGYYIDAIGTYNAPD  247
            FGR   Y++AIG Y  P+
Sbjct  562  FGRGDLYVNAIGVYINPE  579



>ref|NP_177447.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|Q9SSM3.1|JAL19_ARATH RecName: Full=Jacalin-related lectin 19 [Arabidopsis thaliana]
 gb|AAD55651.1|AC008017_24 Similar to jacalin [Arabidopsis thaliana]
 gb|AAX49365.1| At1g73040 [Arabidopsis thaliana]
 gb|ABR46196.1| At1g73040 [Arabidopsis thaliana]
 gb|AEE35407.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=176

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   +EYLT +SG +    +S   V+RS+ F +N + +G YG    TPF F   NG +
Sbjct  75   IKLQYPEEYLTGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGR  133

Query  312  IVGFFGRSGYYIDAIG  265
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGMNGRSGWYLDSIG  149



>gb|AAZ73669.1| At1g19715-like protein [Arabidopsis lyrata]
Length=175

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D   EYL  I+GT+G+F     + +RS+ F +N R++G +G    T F    ++G+K
Sbjct  1    VKLDYPHEYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSK  59

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+Y+DAIG +  P
Sbjct  60   IIGFHGKAGWYLDAIGVHIQP  80



>ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1218

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DEYL  +SG +G+      V +RS+ F +N R +G +G    T F+F    G +
Sbjct  695  VKLDYPDEYLASVSGHYGSLNQWGPVFVRSLTFQSNKRTYGPFGVEQGTYFSF-PMTGGR  753

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF G+ GY++DAIG Y  P
Sbjct  754  IVGFHGKGGYFVDAIGIYLKP  774


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D   E LT ISGT+G       N+++S+ F TN  + G +G      F+ +  NG K
Sbjct  925  ITFDYPYEILTHISGTYGPLMFMGPNIIKSLTFYTNKGKHGPFGDEQGPSFSTKP-NGGK  983

Query  312  IVGFFGRSGYYIDAIG  265
            IVGF G+ G ++DAIG
Sbjct  984  IVGFHGKEGLFLDAIG  999


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 5/80 (6%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSD---NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNG  319
             + ++   E LT ISG +G  AS D    V++S+ F T+  ++G +G  + T F      G
Sbjct  1121  VKLEYPHEVLTRISGYYGP-ASRDERPTVVKSLTFYTSRGQYGPFGEEIGTFFTSTTTEG  1179

Query  318   NKIVGFFGRSGYYIDAIGTY  259
              K+VGF GR G Y+DAIG +
Sbjct  1180  -KVVGFHGRCGAYLDAIGVH  1198



>ref|XP_009391787.1| PREDICTED: agglutinin-like [Musa acuminata subsp. malaccensis]
Length=256

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = -3

Query  480  DGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGF  301
            D  DEYL  +SG +G       V++S+ F TN R +G +G     PF   A  G +IVGF
Sbjct  183  DERDEYLACLSGRYG-ICGGYLVIKSLTFATNKRTYGPFGVEDGAPFKLDA-GGQRIVGF  240

Query  300  FGRSGYYIDAIGTYNA  253
            F R+G ++DAIG Y A
Sbjct  241  FARAGQFLDAIGVYTA  256



>ref|XP_002300741.2| hypothetical protein POPTR_0002s03180g [Populus trichocarpa]
 gb|EEE80014.2| hypothetical protein POPTR_0002s03180g [Populus trichocarpa]
Length=587

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT + G +G+      V +RS+ F +N + +G +G    T F+F   +G K
Sbjct  72   VKLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVEQGTYFSF-PMSGGK  130

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF G+SG+Y+DAIG Y  P
Sbjct  131  IVGFHGKSGWYLDAIGIYLKP  151



>gb|AFW74546.1| hypothetical protein ZEAMMB73_667809 [Zea mays]
Length=145

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKF-TTNAREFGTYGPNVVTPFNFQAQNGNKIVGF  301
            G+DEY+ EISGT+G + +  N++ S+    TN   F ++G      F+   +NG +I GF
Sbjct  70   GDDEYVREISGTYGPYDNVLNLVTSLNIIVTNVASF-SFGNAQGDTFSIPVENGGQIAGF  128

Query  300  FGRSGYYIDAIGTYNAP  250
            +GRSG+ IDAIG Y  P
Sbjct  129  YGRSGWLIDAIGVYIHP  145



>ref|XP_010471351.1| PREDICTED: jacalin-related lectin 19 [Camelina sativa]
Length=177

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DEYL  +SG +    +S   V+RS+ F +N + +G YG    TPF F   NG +
Sbjct  75   IKLQYPDEYLIGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGR  133

Query  312  IVGFFGRSGYYIDAIG  265
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGMNGRSGWYLDSIG  149



>ref|XP_004974871.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=242

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  474  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
             DE+LT + G  G F   + V+RS+ F +N R +G YG     PF   A  G +IVGF  
Sbjct  66   PDEHLTSVEGHCGEF-EGNFVVRSLTFVSNRRAYGPYGRPDGVPFALPAAGG-RIVGFHA  123

Query  294  RSGYYIDAIGTY  259
            RSG ++DAIGTY
Sbjct  124  RSGRHLDAIGTY  135



>ref|XP_008648490.1| PREDICTED: salt stress-induced protein-like [Zea mays]
Length=144

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKF-TTNAREFGTYGPNVVTPFNFQAQNGNKIVGF  301
            G+DEY+ EISGT+G + +  N++ S+    TN   F ++G      F+   +NG +I GF
Sbjct  69   GDDEYVREISGTYGPYDNVLNLVTSLNIIVTNVASF-SFGNAQGDTFSIPVENGGQIAGF  127

Query  300  FGRSGYYIDAIGTYNAP  250
            +GRSG+ IDAIG Y  P
Sbjct  128  YGRSGWLIDAIGVYIHP  144



>emb|CDP17400.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 51/84 (61%), Gaps = 9/84 (11%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQA----QN  322
            I I    EYLT I+GT+G F +   V+ S+ F TN + +G +G    +P + QA     +
Sbjct  92   ITIQWPSEYLTSITGTYGDF-NGLLVIYSLSFVTNQKAYGPFG----SPSSGQAFSSPPD  146

Query  321  GNKIVGFFGRSGYYIDAIGTYNAP  250
            GN IVGF GRSG+YIDAIG Y  P
Sbjct  147  GNVIVGFHGRSGWYIDAIGIYVQP  170


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PNVVTPFNFQAQNGNK  313
            I I    EYLT I GTFG F + D V+ S+ F TN + +G +G  N    F      GN 
Sbjct  236  ITIQWPSEYLTSIKGTFGNF-NGDVVIYSLSFITNNKTYGPFGSANSGQAFTASPPAGNV  294

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            +VGF G SG++IDA+G Y  P
Sbjct  295  VVGFHGMSGWFIDALGIYVRP  315



>gb|ABA94732.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=597

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E++  +SGT G+F    NV+ S+KFTTN  R +G YG    TPF    ++   IVGFFGR
Sbjct  522  EHIKGLSGTVGSFGMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVGFFGR  581

Query  291  SGYYIDAIGTY  259
            +G  ++A+G Y
Sbjct  582  AGPCVEAVGVY  592


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGF  301
            G  E+LTEISGT G +  +  +V++S+   TN+  +G +G    T F+    NG+ IVGF
Sbjct  359  GPSEFLTEISGTTGPYVCAVADVVKSLTLVTNSGSYGPFGQGGGTAFHTSQSNGS-IVGF  417

Query  300  FGRSGYYIDAIGTYNAPD  247
            FGR+G ++ +IG Y +P+
Sbjct  418  FGRAGGFLHSIGVYVSPN  435



>ref|XP_008348484.1| PREDICTED: agglutinin-like isoform X2 [Malus domestica]
Length=174

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASS---DNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGF  301
            DEY+  ++G +     +     ++RS+KF +N R FG +G +  TPF +   +G KIVG 
Sbjct  69   DEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFGRDQGTPFTYTL-DGGKIVGL  127

Query  300  FGRSGYYIDAIGTYNAP  250
             GR G YIDAIG + +P
Sbjct  128  KGRDGLYIDAIGFHVSP  144



>ref|XP_010459648.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Camelina sativa]
 ref|XP_010459649.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Camelina sativa]
Length=570

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D   EYL  ++GT+G+F A  +  +RS+   +N R++G +G    T F    ++G+K
Sbjct  46   VKLDYPHEYLISVNGTYGSFDAWGNTCVRSLTLESNHRKYGPFGCESGTFFAL-PKSGSK  104

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+YIDAIG +  P
Sbjct  105  IIGFHGKAGWYIDAIGVHIQP  125


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D   E LT ++GT+G       NV++S+ F TN  + G +G      F  +   G K
Sbjct  273  IVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-K  331

Query  312  IVGFFGRSGYYIDAIGTY  259
            +VGF GR G ++DAIG +
Sbjct  332  VVGFLGREGLFLDAIGVH  349



>gb|EEC79620.1| hypothetical protein OsI_20824 [Oryza sativa Indica Group]
Length=202

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFAS--SDNVLRSIKFTTNAREFGTYGPNVV--TPFNFQAQN  322
            I +   +EYLT +SG + A A   +   +R + F TN RE+G  G      TPF F   +
Sbjct  70   IKLGFPEEYLTAVSGHYAAVAQGGAPAAIRWLAFRTNRREYGPLGGGAAEGTPFAFPV-D  128

Query  321  GNKIVGFFGRSGYYIDAIGTYNAP  250
            G  IVGF+GRSG  +DA+G + AP
Sbjct  129  GGAIVGFWGRSGRQLDAVGLHVAP  152



>ref|XP_011030089.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
 ref|XP_011030090.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
Length=191

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   +EYLT +SG +         V+RS+ F++N R FG +G    TPF   + +G  
Sbjct  78   IKLRYPEEYLTSVSGHYCPVVYGGSPVIRSLTFSSNKRTFGPFGVEEGTPFTL-SMDGAS  136

Query  312  IVGFFGRSGYYIDAIG  265
            IVGF GRSG+Y+DAIG
Sbjct  137  IVGFKGRSGWYLDAIG  152



>ref|XP_009398855.1| PREDICTED: protein GOS9-like [Musa acuminata subsp. malaccensis]
Length=143

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = -3

Query  486  NIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
            N+D +DE L  I G +G F    ++LRS+ F +N R +G +G      F  +A  G++IV
Sbjct  69   NLD-DDETLRSIRGHYGRFDGV-SILRSLTFVSNKRTYGPFGREEGVAFTLEAP-GSRIV  125

Query  306  GFFGRSGYYIDAIGTYNA  253
            GF GRSG Y+DA+G Y A
Sbjct  126  GFTGRSGLYLDALGIYVA  143



>gb|EAY90359.1| hypothetical protein OsI_11939 [Oryza sativa Indica Group]
Length=150

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            EY+ E+ G+ G      +V+ S+K  TN R  G +G    TPF     N   +VGFF R+
Sbjct  77   EYVKEVHGSVGPIGDYTHVVTSLKLVTNQRTIGPFGNGAGTPFAVPVLNNGSVVGFFARA  136

Query  288  GYYIDAIGTYNAP  250
            G Y+++IG Y  P
Sbjct  137  GPYLESIGIYVHP  149



>ref|XP_008348483.1| PREDICTED: agglutinin-like isoform X1 [Malus domestica]
Length=194

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASS---DNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGF  301
            DEY+  ++G +     +     ++RS+KF +N R FG +G +  TPF +   +G KIVG 
Sbjct  89   DEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFGRDQGTPFTYTL-DGGKIVGL  147

Query  300  FGRSGYYIDAIGTYNAP  250
             GR G YIDAIG + +P
Sbjct  148  KGRDGLYIDAIGFHVSP  164



>ref|XP_010236764.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=168

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I +   DE+ T ++G +G      +V+RS+ F +N R FG +G     PF   A  G +I
Sbjct  80   ICLRDPDEHFTSVTGHYGDLDGGLSVVRSLTFVSNRRSFGPFGKEEGVPFALPA-CGGRI  138

Query  309  VGFFGRSGYYIDAIGTY  259
            +GF  RSG ++ AIGTY
Sbjct  139  LGFHARSGTHLHAIGTY  155



>gb|EEE52450.1| hypothetical protein OsJ_34606 [Oryza sativa Japonica Group]
Length=370

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E++  +SGT G+F    NV+ S+KFTTN  R +G YG    TPF    ++   IVGFFGR
Sbjct  295  EHIKGLSGTVGSFGMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVGFFGR  354

Query  291  SGYYIDAIGTY  259
            +G  ++A+G Y
Sbjct  355  AGPCVEAVGVY  365



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GT G F    +V++S+ FTTN + +G +G     TPF+   + G  IVGF GR
Sbjct  83   EHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHGR  141

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  142  CGAYLDAIGVY  152


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG + +   V++S+ F TNA  +G +G +   TPF+   + G  IVGF G 
Sbjct  289  EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFSLVMKEGVAIVGFHGL  347

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  348  CGAYLDAIGIY  358



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GT G F    +V++S+ FTTN + +G +G     TPF+   + G  IVGF GR
Sbjct  219  EHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHGR  277

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  278  CGAYLDAIGVY  288


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG + +   V++S+ F TNA  +G +G +   TPF+   + G  IVGF G 
Sbjct  425  EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFSLVMKEGVAIVGFHGL  483

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  484  CGAYLDAIGIY  494


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP-NVVTPFNFQAQNGNKIVGFFGR  292
            EYLT I GTF        V+ S+ F TNA+ +G +G  +  TPF+F  + G  I GF GR
Sbjct  35   EYLTGIKGTFRG-CGIHLVINSLCFITNAKNYGPFGSKDGGTPFSFAMKEGGAIEGFQGR  93

Query  291  SGYYIDAIGTY  259
             G Y+DAIG Y
Sbjct  94   CGAYLDAIGVY  104



>ref|XP_008466552.1| PREDICTED: agglutinin-like [Cucumis melo]
Length=170

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFG----AFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQN  322
            + ++  DEYL  I G  G     F +  +V+RS+ F TN +  G YG      F+F    
Sbjct  82   VRLNCPDEYLISIHGYHGDIYDRFGNPTHVIRSLTFETNEQSLGPYGIEERIKFSFPTTG  141

Query  321  GNKIVGFFGRSGYYIDAIGTYNAP  250
              KIVGF GRSG+++DAIG +  P
Sbjct  142  LIKIVGFHGRSGWFLDAIGFHYLP  165



>gb|AAQ07258.1| jacalin-like lectin [Ananas comosus]
Length=145

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            EYL  I GT GA  +  N++RS+ F +N R +G +G    TPF+    +G +IV F+GR 
Sbjct  73   EYLIAIKGTTGALGAVTNLVRSLTFISNMRTYGPFGLEHGTPFSVPVASG-RIVAFYGRF  131

Query  288  GYYIDAIGTYNAP  250
            G  +DA G Y  P
Sbjct  132  GSLVDAFGIYLMP  144



>ref|XP_006853910.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
 gb|ERN15377.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
Length=191

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            +E++TE+SG +         V+RS+KFTTN R +G YG    TPF+    +G  IVGF G
Sbjct  90   EEFITEVSGHYCPVVHGGTPVIRSLKFTTNMRTYGPYGVEEGTPFSC-PMDGGLIVGFKG  148

Query  294  RSGYYIDAI  268
            R+G+Y+D+I
Sbjct  149  RNGWYLDSI  157



>gb|EMT07336.1| hypothetical protein F775_29709 [Aegilops tauschii]
Length=345

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSD---NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            E +TE+SGT G FA  +   N + S+  TTN   +G +G    TPF+   Q+ N IVGFF
Sbjct  266  EIVTEVSGTVGIFAEDNVEYNAIASLTITTNLCPYGPFGETQSTPFSVPVQDNNNIVGFF  325

Query  297  GRSGYYIDAIGTY  259
              +G Y++A+G Y
Sbjct  326  ACAGKYVEALGVY  338



>gb|KHG26998.1| Agglutinin [Gossypium arboreum]
Length=600

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT I G +G+      ++ RS+ F +N + +G +G    T F+    N  K
Sbjct  72   VKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIEQGTSFSM---NKGK  128

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GRSG+Y+DAIG Y+ P
Sbjct  129  IVGFRGRSGWYLDAIGVYSKP  149


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 41/78 (53%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D   E LT I+GTF        NV+RS+ F TN  + G YG      F  +   G K
Sbjct  307  IMFDYPSEILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPSFTNKMNEG-K  365

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G ++DA+G +
Sbjct  366  IVGFLGREGLFLDAVGVH  383



>ref|XP_006306414.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
 gb|EOA39312.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
Length=1361

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D   EYL  +SGT+G+F +  N+ +RS+   +N R++G +G    T F    ++G K
Sbjct  837  VKLDYPHEYLISVSGTYGSFDAWGNICVRSLTLESNHRKYGPFGVESGTFFAL-PKSGTK  895

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+Y DAIG +  P
Sbjct  896  IIGFHGKAGWYTDAIGVHIQP  916


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
             I ++  +E LT ISG +G   +SD  NV++S+ F T+  ++G YG    T F+     G 
Sbjct  1263  IKLEYPNETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEENGTFFSSTTTQG-  1321

Query  315   KIVGFFGRSGYYIDAIGTY  259
             K++GF GRS   +DAIG +
Sbjct  1322  KVLGFHGRSSCNLDAIGVH  1340


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
             I  D   E LT ++GT+G       NV++S+ F TN  + G +G      F  +   G +
Sbjct  1064  IVFDYPSEVLTHVTGTYGPLIYMGPNVIKSLTFRTNKGKHGPFGEEQGPSFTHKMDEG-R  1122

Query  312   IVGFFGRSGYYIDAIGTY  259
             +VGF GR G ++D+IG +
Sbjct  1123  VVGFLGREGLFLDSIGVH  1140



>ref|XP_010030255.1| PREDICTED: agglutinin-like [Eucalyptus grandis]
Length=414

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I++   DEYLT ISG   + +S   V+RS+ F +N R+ G +G      F+     G K+
Sbjct  3    IDLYDSDEYLTSISGYIRSSSSCPTVIRSLTFQSNKRKIGPFGDEKGVYFS-SPTTGGKV  61

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            +GF+GRSG ++DAIG Y  P
Sbjct  62   IGFYGRSGDHLDAIGVYFEP  81



>ref|XP_006853909.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
 gb|ERN15376.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
Length=196

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   +E++TE+SG +         V+RS+KF T+ R +G YG    TPF+F   +G  
Sbjct  86   IKLQYPEEFITEVSGHYCPVVHGGTPVIRSLKFITSKRTYGPYGVEEGTPFSF-LMDGGL  144

Query  312  IVGFFGRSGYYIDAI  268
            IVGF GR+G+Y+DAI
Sbjct  145  IVGFKGRNGWYLDAI  159



>pdb|4MQ0|A Chain A, Crystal Structure Of Parkia Biglobosa Seed Lectin (pbl) 
In Complex With Methyl Alpha D-mannopyranoside
Length=446

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            ++I    EYLT I GT+G +   D    + S+ FTTN   +G +G   +T F+    N N
Sbjct  362  VSIKWPSEYLTSIDGTYGQYKFKDVFTTVTSLSFTTNLATYGPFGKASLTSFSIPIHN-N  420

Query  315  KIVGFFGRSGYYIDAIGTYNAPD  247
             +VGF GR+G Y+DAIG +  PD
Sbjct  421  MVVGFHGRAGDYLDAIGIFVKPD  443


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            + IDG  E+LT ISGT+G +   + VL S+ F TN  + G +G    T F+ +   G+ +
Sbjct  216  VEIDGNLEHLTSISGTYGNYKGFE-VLTSLSFITNVTKHGPFGIASGTSFS-RPIEGSLV  273

Query  309  VGFFGRSGYYIDAIGTYNAP  250
             GF G+ GYY+D+IG Y  P
Sbjct  274  TGFHGKGGYYLDSIGIYVKP  293



>gb|EEE59214.1| hypothetical protein OsJ_11170 [Oryza sativa Japonica Group]
Length=339

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRS  289
            E +TE+ GT G F   D+++ S+K  T+ R  G +G    TPF+   +    +VGFF R+
Sbjct  261  ERVTEVHGTVGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFFVRA  320

Query  288  GYYIDAIGTYNAP  250
            G Y++AIG Y  P
Sbjct  321  GAYLEAIGVYVNP  333



>ref|XP_010477195.1| PREDICTED: jacalin-related lectin 3-like isoform X2 [Camelina 
sativa]
Length=573

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D   EYL  ++GT+G+F A  +  +RS+   +N R++G +G    T F    ++G+K
Sbjct  49   VKLDYPHEYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSGSK  107

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+YIDAIG +  P
Sbjct  108  IIGFHGKAGWYIDAIGVHIQP  128


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D   E LT ++GT+G       NV++S+ F TN  + G +G      F  +   G K
Sbjct  276  IVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-K  334

Query  312  IVGFFGRSGYYIDAIGTY  259
            +VGF GR G ++DAIG +
Sbjct  335  VVGFLGREGLFLDAIGVH  352


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I ++  +E LT ISG +G   +SD  NV++S+ F T+  ++G YG    T F     +G 
Sbjct  475  IKLEYPNETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEECGTFFTSTTTHG-  533

Query  315  KIVGFFGRSGYYIDAIGTY  259
            K++GF GR G  +DAIG +
Sbjct  534  KVLGFHGRCGCNLDAIGVH  552



>ref|XP_010498396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Camelina sativa]
Length=1235

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D   EYL  ++GT+G+F A  +  +RS+   +N R++G +G    T F    ++G+K
Sbjct  711  VKLDYPHEYLISVNGTYGSFDAWGNTCVRSLTLESNHRKYGPFGCESGTFFAL-PKSGSK  769

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+YIDAIG +  P
Sbjct  770  IIGFHGKAGWYIDAIGVHIQP  790


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
             I  D   E LT ++GT+G       NV++S+ F TN  + G +G      F  +   G K
Sbjct  938   IVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-K  996

Query  312   IVGFFGRSGYYIDAIGTY  259
             +VGF GR G ++DAIG +
Sbjct  997   VVGFLGREGLFLDAIGVH  1014



>ref|XP_006372325.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
 gb|ERP50122.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
Length=446

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            + I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G    TPF+    N N +
Sbjct  365  VLINWPSEHLISISGTYGKF-STLLTITSLSFTTNRATYGPFGTGSGTPFSIPINN-NTV  422

Query  309  VGFFGRSGYYIDAIGTYNAPD  247
            VGF GR+G+Y+DAIG +  P+
Sbjct  423  VGFHGRAGHYLDAIGIFVKPE  443


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I I    EYL  ISGT+G +     V+ S+ FTTN    G +G     PF+    +G  +
Sbjct  72   IAIQWPTEYLKSISGTYGRYKGVLAVITSLSFTTNLTTHGPFGTAPGEPFSIPIADG-VV  130

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            VGF GR GYY+DA+G +  P
Sbjct  131  VGFHGRCGYYLDALGVFVTP  150


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I IDG  E+LT I+GT+G +A    V+ S+ F TN   +G +G    T F+   + G+ +
Sbjct  219  IEIDGLSEHLTSITGTYGDYAGMV-VITSLAFQTNLTTYGPFGNATGTSFSIPIE-GSVV  276

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            +GF GR G+Y+DAIG +  P
Sbjct  277  IGFHGRGGHYLDAIGIHVKP  296



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYLT I GTFG +    +V++S+ F TN + +G +G     TPF+   + G  IVGF GR
Sbjct  78   EYLTGIKGTFGHYCGL-SVIKSLCFITNVKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  136

Query  291  SGYYIDAIGTY  259
             G ++DAIG Y
Sbjct  137  CGAFLDAIGVY  147



>gb|KDO84683.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=528

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G    T F+F    G K
Sbjct  73   VKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTGGK  131

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G+Y+DAIG Y
Sbjct  132  IVGFHGRCGWYLDAIGIY  149


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E LT+I+GT+G       N++RS+ F T   + G +G      F+ +   G KIVGF GR
Sbjct  333  EILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  391

Query  291  SGYYIDAIGTY  259
             G ++DAIG Y
Sbjct  392  DGLFLDAIGVY  402



>gb|KDO84682.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=619

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G    T F+F    G K
Sbjct  73   VKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTGGK  131

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G+Y+DAIG Y
Sbjct  132  IVGFHGRCGWYLDAIGIY  149


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  V T F      G 
Sbjct  522  IKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  580

Query  315  KIVGFFGRSGYYIDAIGTY  259
            K+VGF GRS +Y+DAIG +
Sbjct  581  KVVGFHGRSSFYLDAIGVH  599


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E LT+I+GT+G       N++RS+ F T   + G +G      F+ +   G KIVGF GR
Sbjct  333  EILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  391

Query  291  SGYYIDAIGTY  259
             G ++DAIG Y
Sbjct  392  DGLFLDAIGVY  402



>ref|XP_004961574.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=595

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            + +D  DE L  +SG +G+   +  ++RS+ F +N+ ++G +G    TPF+    +G KI
Sbjct  75   VKLDFPDEALVSVSGHYGSVCGTPVIIRSLTFQSNSSKYGPFGTEDGTPFSLPVSSG-KI  133

Query  309  VGFFGRSGYYIDAIGTY  259
            +GF GRSG Y+++IG Y
Sbjct  134  IGFHGRSGSYLNSIGFY  150


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D   E LT I+G    A      V+RS+ F TN R +G YG    T F+    NG +
Sbjct  309  IVFDFPSEVLTHITGFLDSAIIMGPTVVRSLTFHTNKRTYGPYGDESGTYFSTSFTNG-R  367

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G+YID IG +
Sbjct  368  IVGFHGREGWYIDGIGVH  385



>ref|XP_009622527.1| PREDICTED: agglutinin-like isoform X4 [Nicotiana tomentosiformis]
Length=490

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GTF  F    +V++S+ F TNA  +G +G     TPF+   + G  IVGF GR
Sbjct  345  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  403

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  404  SGLYLDAIGVY  414


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -3

Query  465  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRSG  286
            YLT I GTFG + S  +V++S+ F TNA+ +G +G    TPF+   + G  I GF G   
Sbjct  140  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  198

Query  285  YYIDAIGTY  259
             Y+DAIG Y
Sbjct  199  AYLDAIGVY  207



>ref|XP_009622526.1| PREDICTED: agglutinin-like isoform X3 [Nicotiana tomentosiformis]
Length=539

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GTF  F    +V++S+ F TNA  +G +G     TPF+   + G  IVGF GR
Sbjct  394  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  452

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  453  SGLYLDAIGVY  463


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = -3

Query  453  ISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRSGYYID  274
            I GTFG   S  +V++ + F TNA+ +G +G    TPF+   + G  IVGF GR G Y+D
Sbjct  10   IKGTFGRCGSY-SVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRCGAYLD  68

Query  273  AIGTY  259
            AIG Y
Sbjct  69   AIGVY  73


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -3

Query  465  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRSG  286
            YLT I GTFG + S  +V++S+ F TNA+ +G +G    TPF+   + G  I GF G   
Sbjct  189  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  247

Query  285  YYIDAIGTY  259
             Y+DAIG Y
Sbjct  248  AYLDAIGVY  256



>tpg|DAA39774.1| TPA: hypothetical protein ZEAMMB73_034611 [Zea mays]
Length=151

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 5/77 (6%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNARE----FGTYGPNVVTPFNFQAQNGNKI  310
             + E +TE+SGT G       V+ SIKF TN ++    +G YG +  T F    Q G+ I
Sbjct  38   AKSEVVTELSGTIGK-VDDRTVITSIKFVTNLKKTYGPWGAYGDDRDTQFIVPMQPGSGI  96

Query  309  VGFFGRSGYYIDAIGTY  259
            VGFFG +G Y+DAIG Y
Sbjct  97   VGFFGHAGDYLDAIGIY  113



>ref|XP_009622528.1| PREDICTED: agglutinin-like isoform X5 [Nicotiana tomentosiformis]
Length=460

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            E+LT I GTF  F    +V++S+ F TNA  +G +G     TPF+   + G  IVGF GR
Sbjct  315  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  373

Query  291  SGYYIDAIGTY  259
            SG Y+DAIG Y
Sbjct  374  SGLYLDAIGVY  384


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -3

Query  465  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGRSG  286
            YLT I GTFG + S  +V++S+ F TNA+ +G +G    TPF+   + G  I GF G   
Sbjct  110  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  168

Query  285  YYIDAIGTY  259
             Y+DAIG Y
Sbjct  169  AYLDAIGVY  177



>ref|XP_002888904.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65163.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=176

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            DEYLT +SG +     S   V+RS+ F +N + +G YG    TPF F   NG +IVG   
Sbjct  81   DEYLTGVSGYYSIVVDSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMSS  139

Query  294  RSGYYIDAIG  265
            RSG+Y+D+IG
Sbjct  140  RSGWYLDSIG  149



>ref|XP_004164005.1| PREDICTED: agglutinin-like [Cucumis sativus]
 gb|KGN59969.1| hypothetical protein Csa_3G857590 [Cucumis sativus]
Length=169

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFG----AFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQN  322
            I ++  DEYL  + G  G     F +  +V+RS+ F TN +  G YG      F+F    
Sbjct  81   IGLNCPDEYLISVHGYHGNIYDQFGNPTHVIRSLTFETNKQSLGPYGIEEGIKFSFPTTG  140

Query  321  GNKIVGFFGRSGYYIDAIGTYNAP  250
              KIVGF GRSG+++DAIG +  P
Sbjct  141  LIKIVGFHGRSGWFLDAIGFHFLP  164



>ref|XP_004961357.1| PREDICTED: agglutinin-like [Setaria italica]
Length=208

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            DE+LT +SG +   A+  + V+RS+ F +N R +G +G      F F   +G  IVGF G
Sbjct  83   DEHLTGVSGHYSPIAAGGSPVIRSLAFRSNQRAYGPFGVAEGAAFTFPV-DGGVIVGFCG  141

Query  294  RSGYYIDAIGTYNAP  250
            RSG+ +DA+G Y AP
Sbjct  142  RSGWQLDAVGLYVAP  156



>gb|KCW56701.1| hypothetical protein EUGRSUZ_I02393, partial [Eucalyptus grandis]
Length=481

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I++   DEYLT ISG   + +S   V+RS+ F +N R  G  G      F+     G KI
Sbjct  101  IDLSDSDEYLTSISGYIRSSSSCPTVIRSLTFQSNKRTIGPVGDEKGVYFS-SPTTGGKI  159

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            +GF+GRSG ++DAIG Y  P
Sbjct  160  IGFYGRSGDHLDAIGVYFEP  179



>ref|XP_008391447.1| PREDICTED: uncharacterized protein LOC103453663 [Malus domestica]
Length=353

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I ++  DEYL  ++G +   A     ++RS+KF +N R FG +G    T F +  + G K
Sbjct  240  IKLEYPDEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIEEGTTFTYNVEGG-K  298

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVG  GR+G+YIDAIG + +P
Sbjct  299  IVGLKGRNGWYIDAIGFHVSP  319



>ref|XP_010088386.1| hypothetical protein L484_008121 [Morus notabilis]
 gb|EXB34860.1| hypothetical protein L484_008121 [Morus notabilis]
Length=193

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I ++  +EYL  +SG +       + V+RS+   +N R FG YG    TPF+F  Q G  
Sbjct  78   IKLNYPEEYLVSVSGYYCPVVHGGSPVIRSLTLKSNKRTFGPYGVEEGTPFSFPIQ-GGL  136

Query  312  IVGFFGRSGYYIDAIG  265
            IVGF GR+G+Y+DAIG
Sbjct  137  IVGFKGRNGWYLDAIG  152



>ref|XP_011001797.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
Length=445

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -3

Query  483  IDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVG  304
            I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G    TPF+    N N +VG
Sbjct  366  INWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGSGTPFSIPINN-NTVVG  423

Query  303  FFGRSGYYIDAIGTYNAPD  247
            F GR+G+Y+DAIG +  P+
Sbjct  424  FHGRAGHYLDAIGIFVKPE  442


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G    T F+   + G+ +
Sbjct  218  IEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSFSIPIE-GSVV  275

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            +GF GR G+Y+DAIG +  P
Sbjct  276  IGFHGRGGHYLDAIGIHVKP  295


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I I    EYL  ISGT+G++     V+ S+ F TN   +G +G  +   F+    + + +
Sbjct  72   IEIQWPSEYLKSISGTYGSYKGLL-VITSLSFITNLTTYGPFGTALGETFSIPIAD-SAV  129

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            VGF GR GYY+DA+G +  P
Sbjct  130  VGFHGRCGYYLDALGIFVTP  149



>ref|XP_010100192.1| hypothetical protein L484_015337 [Morus notabilis]
 gb|EXB81863.1| hypothetical protein L484_015337 [Morus notabilis]
Length=153

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAF--ASSDNVLRSIKFTTNAREFGTYGPNV-VTPFNFQAQNG  319
            I +   DEYL ++SG       AS    ++S+ F TN R FG YGP    TPF+   +NG
Sbjct  72   IELQFPDEYLVKVSGIVNNVPGASPSPTIQSLTFQTNQRTFGPYGPETGGTPFSLPIRNG  131

Query  318  NKIVGFFGRSGYYIDAIGTYNA  253
              IVGF GR+G  +DAIG + A
Sbjct  132  -LIVGFSGRTGEVLDAIGVHLA  152



>ref|XP_010533565.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Tarenaya hassleriana]
Length=601

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + ++  DEYLT + GT+G+F     + +RS+ F +N R++G +G    T F+       K
Sbjct  76   VKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSLPKSEA-K  134

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF G++G+Y+DAIG +  P
Sbjct  135  IVGFHGKTGWYLDAIGVHIQP  155


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E LT I+GT+G+      NV+RS+ F TN  + G YG      F  +   G KIVGF GR
Sbjct  313  EVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIGEG-KIVGFLGR  371

Query  291  SGYYIDAIGTY  259
             G ++DAIG +
Sbjct  372  EGLFLDAIGVH  382


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I ++   E LT +SG +G  ++SD   V++S+ F T+  ++G YG    T +      G 
Sbjct  505  IKLECPHEVLTCLSGYYGPVSNSDTTKVVKSVSFYTSRGKYGPYGEENGTYYTSTKTEG-  563

Query  315  KIVGFFGRSGYYIDAIGTY  259
            K+VGF GRS  Y+DAIG +
Sbjct  564  KVVGFHGRSSSYLDAIGVH  582



>ref|NP_001176790.1| Os12g0144100 [Oryza sativa Japonica Group]
 dbj|BAH95518.1| Os12g0144100, partial [Oryza sativa Japonica Group]
Length=89

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 5/75 (7%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  EY+ E+SGT+GA+ +S+ V+ S++  TN R +G +G    T F        ++VGFF
Sbjct  20   GLSEYVMEVSGTYGAY-NSNVVVMSLRVATNLRAYGPFGRAEGTSFTASG----RVVGFF  74

Query  297  GRSGYYIDAIGTYNA  253
            GRSG  +D+IG Y A
Sbjct  75   GRSGELLDSIGVYTA  89



>ref|XP_010477196.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X3 [Camelina sativa]
Length=1240

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D   EYL  ++GT+G+F A  +  +RS+   +N R++G +G    T F    ++G+K
Sbjct  716  VKLDYPHEYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSGSK  774

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            I+GF G++G+YIDAIG +  P
Sbjct  775  IIGFHGKAGWYIDAIGVHIQP  795


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
             I  D   E LT ++GT+G       NV++S+ F TN  + G +G      F  +   G K
Sbjct  943   IVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-K  1001

Query  312   IVGFFGRSGYYIDAIGTY  259
             +VGF GR G ++DAIG +
Sbjct  1002  VVGFLGREGLFLDAIGVH  1019


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
             I ++  +E LT ISG +G   +SD  NV++S+ F T+  ++G YG    T F     +G 
Sbjct  1142  IKLEYPNETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEECGTFFTSTTTHG-  1200

Query  315   KIVGFFGRSGYYIDAIGTY  259
             K++GF GR G  +DAIG +
Sbjct  1201  KVLGFHGRCGCNLDAIGVH  1219



>ref|XP_010029744.1| PREDICTED: jacalin-related lectin 4-like [Eucalyptus grandis]
Length=1327

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
             I++   DEYLT ISG   + +S   V+RS+ F +N R  G  G      F+     G KI
Sbjct  947   IDLSDSDEYLTSISGYIRSSSSCPTVIRSLTFQSNKRTIGPVGDEKGVYFS-SPTTGGKI  1005

Query  309   VGFFGRSGYYIDAIGTYNAP  250
             +GF+GRSG ++DAIG Y  P
Sbjct  1006  IGFYGRSGDHLDAIGVYFEP  1025


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            + +D  +EYLT ISG    +     V++S+KF TN + +G +G      F+F   +G +I
Sbjct  496  VKLDYPNEYLTSISGHIRDYQIP-IVIQSLKFHTNRKTYGPFGFERGQFFHFPQVDGGRI  554

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            +GF G+ G ++D+IG +  P
Sbjct  555  IGFHGKCGSHLDSIGAHFGP  574



>ref|XP_010533571.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Tarenaya hassleriana]
Length=598

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + ++  DEYLT + GT+G+F     + +RS+ F +N R++G +G    T F+       K
Sbjct  73   VKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSLPKSEA-K  131

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF G++G+Y+DAIG +  P
Sbjct  132  IVGFHGKTGWYLDAIGVHIQP  152


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E LT I+GT+G+      NV+RS+ F TN  + G YG      F  +   G KIVGF GR
Sbjct  310  EVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIGEG-KIVGFLGR  368

Query  291  SGYYIDAIGTY  259
             G ++DAIG +
Sbjct  369  EGLFLDAIGVH  379


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I ++   E LT +SG +G  ++SD   V++S+ F T+  ++G YG    T +      G 
Sbjct  502  IKLECPHEVLTCLSGYYGPVSNSDTTKVVKSVSFYTSRGKYGPYGEENGTYYTSTKTEG-  560

Query  315  KIVGFFGRSGYYIDAIGTY  259
            K+VGF GRS  Y+DAIG +
Sbjct  561  KVVGFHGRSSSYLDAIGVH  579



>ref|XP_002318228.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
 gb|EEE96448.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
Length=237

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   +EYLT +SG +         V+RS+ F++N R FG +G    TPF   + +G  
Sbjct  124  IKLQYPEEYLTSVSGHYCPVVYGGSPVIRSLAFSSNKRTFGPFGVEEGTPFTL-SMDGAS  182

Query  312  IVGFFGRSGYYIDAIG  265
            IVGF GR G+Y+DAIG
Sbjct  183  IVGFKGRGGWYLDAIG  198



>ref|XP_010924946.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Elaeis 
guineensis]
Length=197

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            +E+LT +SG +       + V+RS+ F +N R FG +G    TPF F   +G  IVGF G
Sbjct  79   EEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEEGTPFTF-PMDGGMIVGFSG  137

Query  294  RSGYYIDAIGTYNAP  250
            R G+Y+DAIG   +P
Sbjct  138  RGGWYLDAIGLCLSP  152



>ref|XP_004960702.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=306

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = -3

Query  477  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            G  E++  ISGT G + S   V+ S+ F TN R  G YG    TPF    ++ + +VGFF
Sbjct  231  GPSEFVKGISGTVGLYRSC-KVIASLTFVTNVRTCGPYGLGDGTPFTVPVEDNHSVVGFF  289

Query  297  GRSGYYIDAIGTYNAPD  247
             RS  Y+DAIG Y  P 
Sbjct  290  VRSKTYLDAIGVYVQPQ  306



>ref|XP_009127966.1| PREDICTED: agglutinin [Brassica rapa]
Length=176

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   +EYL  +SG +     S   V+RS+ F +N + +G YG    TPF+F   NG +
Sbjct  75   IKLQYPEEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-NGGR  133

Query  312  IVGFFGRSGYYIDAIG  265
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGMNGRSGWYLDSIG  149



>gb|EEE60415.1| hypothetical protein OsJ_13609 [Oryza sativa Japonica Group]
Length=105

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDN-VLRSIKFTTNA-REFGTYGPNVV--TPFNFQAQNGNKIVGF  301
            E +T + GT G F   D  V+ S+ F TNA R++G YG N    TPF+     G  +VGF
Sbjct  27   EQVTAVEGTVGNFRDVDEPVITSLTFYTNAGRKYGPYGGNGKQGTPFSIPVGKGCIVVGF  86

Query  300  FGRSGYYIDAIGTYNAPD  247
            +GR G+ +DAIG Y +P 
Sbjct  87   WGRCGWLLDAIGVYVSPQ  104



>ref|XP_009608047.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104102120 
[Nicotiana tomentosiformis]
Length=1799

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVV-TPFNFQAQNGNKIVGFFGR  292
            EYL  I+GTFG +    +V++S+ F TNA+ +G +G     TPF+   + G  IVGF GR
Sbjct  67   EYLKGINGTFGCYYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  125

Query  291  SGYYIDAIGTY  259
            S  Y++AIG Y
Sbjct  126  SELYLNAIGVY  136



>ref|XP_011028923.1| PREDICTED: jacalin-related lectin 3-like isoform X1 [Populus 
euphratica]
Length=643

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT + G +G+      V +RS+ F +N + +G +G    T F+    +G K
Sbjct  72   VKLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVEQGTYFSL-PMSGGK  130

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF G+SG+Y+DAIG Y  P
Sbjct  131  IVGFHGKSGWYLDAIGIYLKP  151



>ref|XP_002510454.1| hypothetical protein RCOM_1595950 [Ricinus communis]
 gb|EEF52641.1| hypothetical protein RCOM_1595950 [Ricinus communis]
Length=540

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFAS--SDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            +  D  DEYL  +SG +G+        ++RS+ F TN R++G +G    T F+F    G 
Sbjct  77   VKFDYPDEYLVSVSGHYGSVVEYYGPVLVRSLMFQTNRRKYGPFGIQQGTQFSFPL-TGG  135

Query  315  KIVGFFGRSGYYIDAIGTYNAP  250
            ++VGF GRS +Y+D+IG Y  P
Sbjct  136  QVVGFHGRSSWYLDSIGVYLKP  157


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I ++   E LT I G +G+F   D+  V++S+ F TN  ++G +G  V T F      G 
Sbjct  440  IKLEYPHETLTSICGYYGSFTGEDSNSVIKSLTFYTNKGKYGPFGEEVGTFFTSSNTEG-  498

Query  315  KIVGFFGRSGYYIDAIGTY  259
            KIVGF GRSG Y++AIG +
Sbjct  499  KIVGFHGRSGCYLNAIGVH  517


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D   E LT ++G +G+       V++S+ F TN R++G +G      F+    NG  
Sbjct  270  IAFDYPSEILTHVTGYYGSTILRGPTVVKSLTFHTNKRKYGPFGDEQGISFSSGPNNG-I  328

Query  312  IVGFFGRSGYYIDAIGTYNA  253
            +VGF GR G++ID+IG + A
Sbjct  329  VVGFHGRKGWFIDSIGVHVA  348



>ref|XP_010924945.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Elaeis 
guineensis]
Length=200

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = -3

Query  471  DEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFG  295
            +E+LT +SG +       + V+RS+ F +N R FG +G    TPF F   +G  IVGF G
Sbjct  82   EEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEEGTPFTF-PMDGGMIVGFSG  140

Query  294  RSGYYIDAIGTYNAP  250
            R G+Y+DAIG   +P
Sbjct  141  RGGWYLDAIGLCLSP  155



>ref|XP_003576339.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=285

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = -3

Query  471  DEYLTEISGTFGAFAS-SDNVLRSIKFTTN-AREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
            DE++T + GTFG   S +  V+ S+ F T+  R  G YG     PF+    NG  IVGF+
Sbjct  203  DEHITTVEGTFGRCRSVTQVVVTSLTFRTDKGRTHGPYGEPTGLPFSVPVANGC-IVGFW  261

Query  297  GRSGYYIDAIGTYNAP  250
            GRSG+ +DAIG Y AP
Sbjct  262  GRSGWLLDAIGVYVAP  277



>ref|XP_006473572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X2 [Citrus sinensis]
Length=1252

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G    T F+F    G K
Sbjct  706  VKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTGGK  764

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G+Y+DAIG Y
Sbjct  765  IVGFHGRCGWYLDAIGIY  782


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
             I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  V T F      G 
Sbjct  1155  IKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGEEVGTFFTSTTTEG-  1213

Query  315   KIVGFFGRSGYYIDAIGTY  259
             K+VGF GRS +Y+DAIG +
Sbjct  1214  KVVGFHGRSSFYLDAIGVH  1232


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  468   EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
             E LT+I+GT+G       N++RS+ F T   + G +G      F+ +   G KIVGF GR
Sbjct  966   EILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  1024

Query  291   SGYYIDAIGTY  259
              G ++DAIG Y
Sbjct  1025  DGLFLDAIGVY  1035



>ref|NP_001140746.1| hypothetical protein [Zea mays]
 gb|ACF84532.1| unknown [Zea mays]
 gb|AFW78609.1| hypothetical protein ZEAMMB73_243066 [Zea mays]
Length=596

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            + +D  DE L  +SG +G+   +  ++RS+ F +N+  +G +G    TPF+    +G KI
Sbjct  75   VKLDFPDEVLVSVSGHYGSVCGTPVIIRSLTFQSNSSTYGPFGTEDGTPFSLPVSSG-KI  133

Query  309  VGFFGRSGYYIDAIGTY  259
            +GF GRSG Y+++IG Y
Sbjct  134  IGFHGRSGSYLNSIGFY  150


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 43/78 (55%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D   E LT I+G +  A      V+RS+ F TN R +G YG    T F+    NG +
Sbjct  310  IIFDFPSEVLTHITGFYDSAIIMGPTVVRSLTFHTNKRTYGPYGDEYGTYFSTSFTNG-R  368

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G+YID IG +
Sbjct  369  IVGFHGREGWYIDGIGVH  386



>ref|XP_002461766.1| hypothetical protein SORBIDRAFT_02g007740 [Sorghum bicolor]
 gb|EER98287.1| hypothetical protein SORBIDRAFT_02g007740 [Sorghum bicolor]
Length=312

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 8/82 (10%)
 Frame = -3

Query  477  GEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGP-----NVVTPFNFQAQNGN  316
            GE E +TE+SGT G  ++ ++ ++ SIKF TN  +  TYGP         PF    Q GN
Sbjct  232  GESEVVTEVSGTVGNPYSGTNKLITSIKFVTNLNK--TYGPWGDGKEKDAPFTIPVQPGN  289

Query  315  KIVGFFGRSGYYIDAIGTYNAP  250
             I+GFF R G +++AIG Y  P
Sbjct  290  GIMGFFARGGEFVEAIGVYVRP  311



>ref|XP_002893064.1| hypothetical protein ARALYDRAFT_472198 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69323.1| hypothetical protein ARALYDRAFT_472198 [Arabidopsis lyrata subsp. 
lyrata]
Length=1490

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = -3

Query  483   IDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIV  307
             +D   EYL  I+GT+G+F     + +RS+ F +N R++G +G    T F    ++G+KIV
Sbjct  966   LDYPHEYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSKIV  1024

Query  306   GFFGRSGYYIDAIGTYNAP  250
             GF G++G+Y+DAIG +  P
Sbjct  1025  GFHGKAGWYLDAIGVHIQP  1043


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = -3

Query  489   INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
             I  D   E LT ++GT+G       NV++S+ F TN  + G YG      F  Q   G K
Sbjct  1191  IVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQIDEG-K  1249

Query  312   IVGFFGRSGYYIDAIGTY  259
             +VGF GR G ++D+IG +
Sbjct  1250  VVGFLGREGLFLDSIGVH  1267



>ref|XP_006473571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X1 [Citrus sinensis]
Length=619

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G    T F+F    G K
Sbjct  73   VKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTGGK  131

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G+Y+DAIG Y
Sbjct  132  IVGFHGRCGWYLDAIGIY  149


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  V T F      G 
Sbjct  522  IKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGEEVGTFFTSTTTEG-  580

Query  315  KIVGFFGRSGYYIDAIGTY  259
            K+VGF GRS +Y+DAIG +
Sbjct  581  KVVGFHGRSSFYLDAIGVH  599


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E LT+I+GT+G       N++RS+ F T   + G +G      F+ +   G KIVGF GR
Sbjct  333  EILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  391

Query  291  SGYYIDAIGTY  259
             G ++DAIG Y
Sbjct  392  DGLFLDAIGVY  402



>ref|XP_006435072.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
 gb|ESR48312.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
Length=619

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G    T F+F    G K
Sbjct  73   VKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTGGK  131

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G+Y+DAIG Y
Sbjct  132  IVGFHGRCGWYLDAIGIY  149


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGN  316
            I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  V T F      G 
Sbjct  522  IKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  580

Query  315  KIVGFFGRSGYYIDAIGTY  259
            K+VGF GRS +Y+DAIG +
Sbjct  581  KVVGFHGRSSFYLDAIGVH  599


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  468  EYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFFGR  292
            E LT+I+GT+G       N++RS+ F T   + G +G      F+ +   G KIVGF GR
Sbjct  333  EILTQITGTYGPLMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGEG-KIVGFHGR  391

Query  291  SGYYIDAIGTY  259
             G ++DAIG Y
Sbjct  392  DGLFLDAIGVY  402



>ref|XP_011028924.1| PREDICTED: uncharacterized protein LOC105128794 isoform X2 [Populus 
euphratica]
Length=1277

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            + +D  DE+LT + G +G+      V +RS+ F +N + +G +G    T F+    +G K
Sbjct  706  VKLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVEQGTYFSL-PMSGGK  764

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF G+SG+Y+DAIG Y  P
Sbjct  765  IVGFHGKSGWYLDAIGIYLKP  785


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = -3

Query  468   EYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKIVGFF  298
             E L  +SG +G   S  N   V++S+ F T    +G +G  + T F   A  G K+VGF 
Sbjct  1185  EVLVCLSGYYGPIGSDGNGPKVIKSLTFHTTRGNYGPFGEEIGTFFTSTATEG-KVVGFH  1243

Query  297   GRSGYYIDAIGTY  259
             GRS  Y+DAIG +
Sbjct  1244  GRSSAYMDAIGVH  1256



>ref|XP_010026053.1| PREDICTED: jacalin-related lectin 3-like [Eucalyptus grandis]
Length=247

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = -3

Query  507  FMMCG*INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQA  328
            FM CG + +D   E+LT +SG       +D+V++S+ F +N R  G +G    + F+   
Sbjct  19   FMQCGKVTLDYPHEFLTSVSG---CIRDNDSVIQSLTFESNIRRHGPFGKEEGSFFSCTL  75

Query  327  QNGNKIVGFFGRSGYYIDAIGTYNAP  250
               +KI+GF GRSG  +DA+G Y+ P
Sbjct  76   AC-SKIIGFHGRSGIQLDALGVYSEP  100


 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            I +D   EYLT  SG  G F     V+RS+ F +N R +G +G      F F +  G KI
Sbjct  170  IKLDDPQEYLTSFSGHSGCFCGH-IVVRSLTFQSNERTYGPFGDEFGKYFYFPSI-GKKI  227

Query  309  VGFFGRSGYYIDAIGTYNAP  250
            VGF+GRSG ++D+ G +  P
Sbjct  228  VGFYGRSGLWLDSFGAHFEP  247



>ref|XP_002440040.1| hypothetical protein SORBIDRAFT_09g024950 [Sorghum bicolor]
 gb|EES18470.1| hypothetical protein SORBIDRAFT_09g024950 [Sorghum bicolor]
Length=594

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNKI  310
            + +D  DE L  +SG +G+   +  ++RS+ F +N+  +G +G    TPF+    +G KI
Sbjct  75   VKLDFPDEVLVSVSGHYGSVCGTPVIIRSLTFQSNSSTYGPFGTEDGTPFSLPVSSG-KI  133

Query  309  VGFFGRSGYYIDAIGTY  259
            +GF GRSG Y+++IG Y
Sbjct  134  IGFHGRSGSYLNSIGFY  150


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 43/78 (55%), Gaps = 2/78 (3%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I  D   E LT I+G +  A      V+RS+ F TN R +G YG    T F+    NG +
Sbjct  308  IIFDFPSEVLTHITGFYDSAIIMGPTVVRSLTFHTNKRTYGPYGDEYGTYFSTSFTNG-R  366

Query  312  IVGFFGRSGYYIDAIGTY  259
            IVGF GR G+YID IG +
Sbjct  367  IVGFHGREGWYIDGIGVH  384



>emb|CAJ38387.1| jacalin-domain protein [Plantago major]
Length=197

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  489  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVVTPFNFQAQNGNK  313
            I +   DE LT +SG         + V+RS+ F +N R FG +G    +PF+F  + G +
Sbjct  86   IKLQFPDEVLTSVSGHCCPVVHGGSPVIRSLTFKSNKRTFGPFGVEEGSPFSFPMEGG-Q  144

Query  312  IVGFFGRSGYYIDAIGTYNAP  250
            IVGF GR+G+++DAIG + +P
Sbjct  145  IVGFKGRNGWFVDAIGFHISP  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510