BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN005D03

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIC33041.1|  30S ribosomal protein S20                               125   9e-33   Panax ginseng [Asiatic ginseng]
ref|XP_007021563.1|  30S ribosomal protein S20 isoform 1                125   3e-32   
ref|XP_009789256.1|  PREDICTED: 30S ribosomal protein S20, chloro...    124   4e-31   Nicotiana sylvestris
ref|XP_006451780.1|  hypothetical protein CICLE_v10009636mg             122   4e-31   Citrus clementina [clementine]
gb|KDO49243.1|  hypothetical protein CISIN_1g029900mg                   122   4e-31   Citrus sinensis [apfelsine]
ref|XP_010106195.1|  hypothetical protein L484_009619                   120   1e-30   Morus notabilis
ref|XP_009626679.1|  PREDICTED: 30S ribosomal protein S20, chloro...    120   2e-30   Nicotiana tomentosiformis
ref|XP_002285149.1|  PREDICTED: 30S ribosomal protein S20, chloro...    120   2e-30   Vitis vinifera
ref|XP_004244249.1|  PREDICTED: 30S ribosomal protein S20, chloro...    120   2e-30   Solanum lycopersicum
ref|XP_010542295.1|  PREDICTED: 30S ribosomal protein S20, chloro...    120   2e-30   Tarenaya hassleriana [spider flower]
gb|KJB61708.1|  hypothetical protein B456_009G375600                    120   3e-30   Gossypium raimondii
gb|KDP45864.1|  hypothetical protein JCGZ_15308                         119   5e-30   Jatropha curcas
ref|XP_002532240.1|  30S ribosomal protein S20, putative                119   6e-30   Ricinus communis
ref|XP_006298594.1|  hypothetical protein CARUB_v10014678mg             119   9e-30   Capsella rubella
emb|CDP05950.1|  unnamed protein product                                118   1e-29   Coffea canephora [robusta coffee]
gb|KHG14694.1|  30S ribosomal S20, chloroplastic -like protein          117   3e-29   Gossypium arboreum [tree cotton]
gb|EYU26363.1|  hypothetical protein MIMGU_mgv1a014578mg                117   3e-29   Erythranthe guttata [common monkey flower]
emb|CDX75816.1|  BnaC03g38990D                                          115   4e-29   
ref|XP_010272363.1|  PREDICTED: 30S ribosomal protein S20, chloro...    116   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009387860.1|  PREDICTED: 30S ribosomal protein S20, chloro...    117   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX98532.1|  BnaC05g38430D                                          117   5e-29   
ref|XP_010465470.1|  PREDICTED: 30S ribosomal protein S20, chloro...    117   6e-29   Camelina sativa [gold-of-pleasure]
emb|CDX97637.1|  BnaA05g24420D                                          117   8e-29   
ref|NP_188137.1|  30S ribosomal protein S20                             116   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135431.1|  PREDICTED: 30S ribosomal protein S20, chloro...    115   8e-29   Brassica rapa
ref|XP_002882919.1|  hypothetical protein ARALYDRAFT_897793             116   1e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_009135430.1|  PREDICTED: 30S ribosomal protein S20, chloro...    116   1e-28   Brassica rapa
gb|KFK38864.1|  hypothetical protein AALP_AA3G170400                    116   1e-28   Arabis alpina [alpine rockcress]
ref|XP_006348272.1|  PREDICTED: 30S ribosomal protein S20, chloro...    115   1e-28   Solanum tuberosum [potatoes]
emb|CDX82443.1|  BnaA03g33780D                                          116   1e-28   
ref|XP_006407001.1|  hypothetical protein EUTSA_v10021521mg             115   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010487339.1|  PREDICTED: 30S ribosomal protein S20, chloro...    115   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009356774.1|  PREDICTED: 30S ribosomal protein S20, chloro...    114   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_010502610.1|  PREDICTED: 30S ribosomal protein S20, chloro...    114   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010060622.1|  PREDICTED: 30S ribosomal protein S20, chloro...    114   5e-28   Eucalyptus grandis [rose gum]
ref|XP_009146279.1|  PREDICTED: 30S ribosomal protein S20, chloro...    114   6e-28   Brassica rapa
emb|CDY32315.1|  BnaC01g36340D                                          114   6e-28   Brassica napus [oilseed rape]
ref|XP_007212118.1|  hypothetical protein PRUPE_ppa012008mg             114   7e-28   Prunus persica
ref|XP_008367099.1|  PREDICTED: 30S ribosomal protein S20, chloro...    113   8e-28   
ref|XP_009776683.1|  PREDICTED: 30S ribosomal protein S20, chloro...    113   9e-28   Nicotiana sylvestris
ref|XP_009776691.1|  PREDICTED: 30S ribosomal protein S20, chloro...    113   1e-27   Nicotiana sylvestris
ref|XP_010917978.1|  PREDICTED: 30S ribosomal protein S20, chloro...    112   1e-27   
ref|XP_008386206.1|  PREDICTED: 30S ribosomal protein S20, chloro...    112   1e-27   Malus domestica [apple tree]
ref|XP_009340650.1|  PREDICTED: 30S ribosomal protein S20, chloro...    112   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_010917969.1|  PREDICTED: 30S ribosomal protein S20, chloro...    112   2e-27   Elaeis guineensis
ref|XP_003628554.1|  30S ribosomal protein S20                          112   2e-27   Medicago truncatula
ref|XP_008226494.1|  PREDICTED: 30S ribosomal protein S20, chloro...    112   2e-27   Prunus mume [ume]
ref|NP_001237852.1|  uncharacterized protein LOC100499656               112   3e-27   Glycine max [soybeans]
ref|NP_001241947.1|  uncharacterized protein LOC100786192               111   3e-27   
ref|XP_006859051.1|  hypothetical protein AMTR_s00068p00188920          110   3e-27   
ref|XP_008801495.1|  PREDICTED: 30S ribosomal protein S20, chloro...    111   5e-27   Phoenix dactylifera
ref|XP_009116457.1|  PREDICTED: 30S ribosomal protein S20, chloro...    111   5e-27   Brassica rapa
ref|XP_008463697.1|  PREDICTED: 30S ribosomal protein S20, chloro...    110   7e-27   Cucumis melo [Oriental melon]
ref|XP_009592363.1|  PREDICTED: 30S ribosomal protein S20, chloro...    111   7e-27   Nicotiana tomentosiformis
gb|AFK46331.1|  unknown                                                 110   1e-26   Lotus japonicus
ref|XP_004510023.1|  PREDICTED: 30S ribosomal protein S20, chloro...    110   1e-26   
ref|XP_004291502.1|  PREDICTED: 30S ribosomal protein S20, chloro...    110   1e-26   Fragaria vesca subsp. vesca
ref|XP_004510022.1|  PREDICTED: 30S ribosomal protein S20, chloro...    110   1e-26   Cicer arietinum [garbanzo]
ref|XP_004146049.1|  PREDICTED: 30S ribosomal protein S20, chloro...    110   2e-26   Cucumis sativus [cucumbers]
ref|XP_006370215.1|  chloroplast 30S ribosomal protein S20              108   8e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011043839.1|  PREDICTED: 30S ribosomal protein S20, chloro...    108   8e-26   Populus euphratica
gb|EPS64680.1|  hypothetical protein M569_10102                         106   1e-25   Genlisea aurea
ref|XP_007133233.1|  hypothetical protein PHAVU_011G162800g             107   1e-25   Phaseolus vulgaris [French bean]
ref|XP_011098278.1|  PREDICTED: 30S ribosomal protein S20, chloro...    107   1e-25   Sesamum indicum [beniseed]
ref|XP_011098277.1|  PREDICTED: 30S ribosomal protein S20, chloro...    107   2e-25   Sesamum indicum [beniseed]
ref|XP_007021565.1|  30S ribosomal protein S20 isoform 3                106   4e-25   
ref|XP_010675477.1|  PREDICTED: 30S ribosomal protein S20, chloro...    105   1e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK24542.1|  unknown                                                 103   5e-24   Picea sitchensis
gb|ABK23997.1|  unknown                                                 103   6e-24   Picea sitchensis
dbj|BAB02573.1|  unnamed protein product                                103   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644515.1|  PREDICTED: 30S ribosomal protein S20, chloro...  97.4    1e-21   Oryza brachyantha
gb|EAY75367.1|  hypothetical protein OsI_03263                        97.4    1e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001043859.1|  Os01g0678600                                     97.4    1e-21   
gb|KCW67401.1|  hypothetical protein EUGRSUZ_F01167                   95.5    5e-21   Eucalyptus grandis [rose gum]
gb|AFK39838.1|  unknown                                               91.7    1e-20   Lotus japonicus
gb|KHN05309.1|  30S ribosomal protein S20, chloroplastic              92.0    5e-20   Glycine soja [wild soybean]
ref|XP_008351018.1|  PREDICTED: 30S ribosomal protein S20, chloro...  88.2    4e-19   
ref|XP_002456139.1|  hypothetical protein SORBIDRAFT_03g031120        89.7    8e-19   Sorghum bicolor [broomcorn]
ref|NP_001152580.1|  LOC100286220                                     88.6    3e-18   Zea mays [maize]
gb|ACF84630.1|  unknown                                               88.2    3e-18   Zea mays [maize]
ref|XP_003569559.1|  PREDICTED: 30S ribosomal protein S20, chloro...  88.2    3e-18   Brachypodium distachyon [annual false brome]
gb|AGV54866.1|  hypothetical protein                                  88.2    4e-18   Phaseolus vulgaris [French bean]
emb|CDM83937.1|  unnamed protein product                              87.8    4e-18   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ84882.1|  predicted protein                                    87.4    5e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004969532.1|  PREDICTED: 30S ribosomal protein S20, chloro...  87.4    6e-18   Setaria italica
ref|XP_001782187.1|  predicted protein                                77.8    6e-15   
ref|XP_001767505.1|  predicted protein                                73.2    2e-13   
gb|EMS62284.1|  30S ribosomal protein S20, chloroplastic              73.2    1e-12   Triticum urartu
ref|XP_005849993.1|  hypothetical protein CHLNCDRAFT_141918           70.9    3e-12   Chlorella variabilis
ref|XP_002506072.1|  predicted protein                                61.6    8e-09   Micromonas commoda
gb|KIZ06524.1|  30S ribosomal protein S20                             61.2    9e-09   Monoraphidium neglectum
ref|XP_002954236.1|  plastid/chloroplast ribosomal protein S20        60.5    2e-08   Volvox carteri f. nagariensis
ref|XP_011399306.1|  30S ribosomal protein S20, chloroplastic         58.9    6e-08   Auxenochlorella protothecoides
gb|AAP79183.1|  ribosomal protein rpS20                               57.8    2e-07   Bigelowiella natans
ref|XP_003075156.1|  unnamed protein product                          56.6    2e-07   Ostreococcus tauri
ref|XP_003062494.1|  predicted protein                                56.6    3e-07   Micromonas pusilla CCMP1545
ref|XP_001700557.1|  plastid ribosomal protein S20                    56.6    3e-07   Chlamydomonas reinhardtii
ref|XP_007510026.1|  30S ribosomal protein S20                        56.6    3e-07   Bathycoccus prasinos
ref|WP_006632886.1|  30S ribosomal protein S20                        52.0    5e-06   Microcoleus vaginatus
ref|XP_001416366.1|  predicted protein                                51.6    5e-06   Ostreococcus lucimarinus CCE9901
ref|WP_011125792.1|  MULTISPECIES: 30S ribosomal protein S20          50.8    1e-05   Prochlorococcus
ref|WP_006529283.1|  30S ribosomal protein S20                        50.4    2e-05   Gloeocapsa sp. PCC 73106
ref|WP_015179155.1|  30S ribosomal protein S20                        50.1    2e-05   Oscillatoria nigro-viridis
ref|WP_039202355.1|  30S ribosomal protein S20                        50.1    2e-05   Nostocales
ref|WP_035998037.1|  30S ribosomal protein S20                        50.1    2e-05   [Leptolyngbya] sp. JSC-1
ref|WP_042157802.1|  30S ribosomal protein S20                        49.7    4e-05   Planktothrix agardhii
gb|KEI68521.1|  RpsT                                                  49.7    4e-05   Planktothrix agardhii NIVA-CYA 126/8
ref|WP_015160183.1|  30S ribosomal protein S20                        49.7    4e-05   Chamaesiphon minutus
ref|WP_026785759.1|  MULTISPECIES: 30S ribosomal protein S20          49.7    4e-05   Planktothrix
ref|WP_027404245.1|  30S ribosomal protein S20                        49.3    4e-05   Aphanizomenon flos-aquae
ref|WP_009768246.1|  30S ribosomal protein S20                        49.3    5e-05   Oscillatoriales cyanobacterium JSC-12
gb|KIE07616.1|  30S ribosomal protein S20                             49.3    6e-05   Tolypothrix bouteillei VB521301
ref|WP_015228410.1|  30S ribosomal protein S20                        49.3    6e-05   Dactylococcopsis salina
ref|WP_017300689.1|  30S ribosomal protein S20                        48.9    6e-05   Nodosilinea nodulosa
ref|WP_025927023.1|  MULTISPECIES: 30S ribosomal protein S20          48.1    1e-04   
ref|WP_011612463.1|  30S ribosomal protein S20                        48.1    2e-04   Trichodesmium erythraeum
ref|WP_012595073.1|  MULTISPECIES: 30S ribosomal protein S20          47.8    2e-04   Cyanothece
gb|KJB81967.1|  hypothetical protein B456_013G169400                  47.0    3e-04   Gossypium raimondii
ref|WP_015134482.1|  30S ribosomal protein S20                        47.0    3e-04   Leptolyngbya sp. PCC 7376
ref|WP_017660784.1|  30S ribosomal protein S20                        47.0    4e-04   Cyanobacteria [blue-green bacteria]
gb|KGG10819.1|  SSU ribosomal protein S20p                            46.6    4e-04   Prochlorococcus marinus str. LG
ref|WP_009629068.1|  30S ribosomal protein S20                        47.0    4e-04   Pseudanabaena
ref|WP_035990545.1|  30S ribosomal protein S20                        46.6    5e-04   Leptolyngbya sp. KIOST-1
ref|WP_028090342.1|  30S ribosomal protein S20                        46.6    5e-04   Dolichospermum circinale
ref|WP_028085214.1|  30S ribosomal protein S20                        46.6    5e-04   Dolichospermum circinale
ref|WP_017313038.1|  30S ribosomal protein S20                        46.2    6e-04   Fischerella sp. PCC 9339
ref|WP_015083021.1|  30S ribosomal protein S20                        46.2    6e-04   Anabaena sp. 90
gb|ADI63386.1|  ribosomal protein S20                                 46.6    7e-04   'Nostoc azollae' 0708
ref|WP_015198603.1|  30S ribosomal protein S20                        46.2    8e-04   Calothrix parietina
ref|WP_007355842.1|  MULTISPECIES: 30S ribosomal protein S20          45.8    0.001   Kamptonema
ref|WP_041233256.1|  30S ribosomal protein S20                        45.8    0.001   Cylindrospermum stagnale



>gb|AIC33041.1| 30S ribosomal protein S20, partial [Panax ginseng]
Length=157

 Score =   125 bits (314),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS KSEIRTRM+KVLESLD LR+K DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  67   YNKSHKSEIRTRMKKVLESLDVLRRKPDAQPEEVITIEKLIAEAYSVIDKAVKVGTLHRN  126

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLARRKK VEIHHGWY P+P P A
Sbjct  127  TGARRKSRLARRKKVVEIHHGWYTPSPKPTA  157



>ref|XP_007021563.1| 30S ribosomal protein S20 isoform 1 [Theobroma cacao]
 gb|EOY13088.1| 30S ribosomal protein S20 isoform 1 [Theobroma cacao]
Length=193

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE+RTRM+KVLE+LD LRKK DAQ +E+  IEKLIAEAYS IDKA+K G +HRN
Sbjct  102  YNKARKSEVRTRMKKVLEALDVLRKKPDAQAEEIFSIEKLIAEAYSVIDKAVKVGTLHRN  161

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLARRKKAVEIHHGWY PAPA +A
Sbjct  162  TGARRKSRLARRKKAVEIHHGWYTPAPAGNA  192



>ref|XP_009789256.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Nicotiana 
sylvestris]
Length=248

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK+KKSE++TRM+ VLE+LD L+KK DAQ +EV+ +EKLIAEAYSAIDKA+K G++HRN
Sbjct  152  YNKAKKSEVKTRMKTVLEALDTLKKKTDAQSEEVISVEKLIAEAYSAIDKAVKAGSLHRN  211

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDATPIPLAT  296
            TGARRKSRLARRKKAVEIHHGWYVPAP   A P  +AT
Sbjct  212  TGARRKSRLARRKKAVEIHHGWYVPAPV--AEPALVAT  247



>ref|XP_006451780.1| hypothetical protein CICLE_v10009636mg [Citrus clementina]
 ref|XP_006464806.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Citrus 
sinensis]
 gb|ESR65020.1| hypothetical protein CICLE_v10009636mg [Citrus clementina]
Length=185

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS+KSE++TRM+KVLE+LD LRKK DAQ +EV+ +EKLIAEAYS IDKA+K G +HRN
Sbjct  94   YNKSRKSEVKTRMKKVLEALDGLRKKPDAQPEEVLPVEKLIAEAYSVIDKAVKVGTLHRN  153

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA  266
            TGARRKSRLARRKKAVEIHHGWY P PA
Sbjct  154  TGARRKSRLARRKKAVEIHHGWYTPTPA  181



>gb|KDO49243.1| hypothetical protein CISIN_1g029900mg [Citrus sinensis]
Length=185

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS+KSE++TRM+KVLE+LD LRKK DAQ +EV+ +EKLIAEAYS IDKA+K G +HRN
Sbjct  94   YNKSRKSEVKTRMKKVLEALDGLRKKPDAQPEEVLPVEKLIAEAYSVIDKAVKVGTLHRN  153

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA  266
            TGARRKSRLARRKKAVEIHHGWY P PA
Sbjct  154  TGARRKSRLARRKKAVEIHHGWYTPTPA  181



>ref|XP_010106195.1| hypothetical protein L484_009619 [Morus notabilis]
 gb|EXC08476.1| hypothetical protein L484_009619 [Morus notabilis]
Length=180

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE++TRM+KVLE+LD L+KK+DAQ +EV+ +EKLIAEAYS IDKA+K G +HRN
Sbjct  90   YNKARKSEVKTRMKKVLEALDTLKKKQDAQAEEVLPVEKLIAEAYSIIDKAVKVGTLHRN  149

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLARRKKAVEIHHGWY P PA  A
Sbjct  150  TGARRKSRLARRKKAVEIHHGWYTPTPAATA  180



>ref|XP_009626679.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=190

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 2/92 (2%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK+KKSE++TRM+ VLE+LD L+KK DAQ +EV+ +EKLIAEAYSAIDKA+K G +HRN
Sbjct  94   YNKAKKSEVKTRMKTVLEALDTLKKKTDAQSEEVLSVEKLIAEAYSAIDKAVKAGTLHRN  153

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA--PD  272
            TGARRKSRLARRKKAV IHHGWYVPAP   PD
Sbjct  154  TGARRKSRLARRKKAVAIHHGWYVPAPVAEPD  185



>ref|XP_002285149.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Vitis vinifera]
 emb|CBI20262.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTRM+KVLE LD L+KK DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  93   YNKARKSEIRTRMKKVLEELDGLKKKPDAQAEEVLPIEKLIAEAYSVIDKAVKVGTLHRN  152

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGARRKSRLARRKKAVEIHHGWY PAP
Sbjct  153  TGARRKSRLARRKKAVEIHHGWYTPAP  179



>ref|XP_004244249.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Solanum 
lycopersicum]
Length=184

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 2/92 (2%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++K+KKSE+RTR++ VLE+L+ LRKK DA+ +EVV +EKLIAEAYSAIDKA+K G +HRN
Sbjct  88   YHKAKKSEVRTRIKTVLEALETLRKKTDAESEEVVSVEKLIAEAYSAIDKAVKVGTLHRN  147

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA--PD  272
            TGARRKSRLARRKKAVEIHHGWYVPAPA  PD
Sbjct  148  TGARRKSRLARRKKAVEIHHGWYVPAPATEPD  179



>ref|XP_010542295.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Tarenaya 
hassleriana]
Length=190

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRMRKVLE LD L+KK DAQ +E++++EKLI EAYSAIDKA+K G++HRN
Sbjct  99   YNKSKKSEARTRMRKVLEVLDGLKKKADAQAEEILQVEKLIGEAYSAIDKAVKAGSLHRN  158

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLAR KKAVEIHHGWY P  A  A
Sbjct  159  TGARRKSRLARMKKAVEIHHGWYTPEAAVSA  189



>gb|KJB61708.1| hypothetical protein B456_009G375600 [Gossypium raimondii]
Length=188

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++K+KKSE++TRMRKVLE+LD LRKK DA  +E+  IEKLIAEAYS IDKA+K G++HRN
Sbjct  97   YHKAKKSEVKTRMRKVLEALDVLRKKPDAAAEEIFPIEKLIAEAYSVIDKAVKVGSLHRN  156

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLARRKKA+EIHHGWY PAPA +A
Sbjct  157  TGARRKSRLARRKKAIEIHHGWYAPAPAENA  187



>gb|KDP45864.1| hypothetical protein JCGZ_15308 [Jatropha curcas]
Length=183

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTRM+KV+E+LD L+KK DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  93   YNKARKSEIRTRMKKVMEALDDLKKKPDAQAEEVLPIEKLIAEAYSVIDKAVKVGTLHRN  152

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGARRKSRLARRKK VEIHHGWY PAP
Sbjct  153  TGARRKSRLARRKKDVEIHHGWYTPAP  179



>ref|XP_002532240.1| 30S ribosomal protein S20, putative [Ricinus communis]
 gb|EEF30134.1| 30S ribosomal protein S20, putative [Ricinus communis]
Length=185

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++K+ KSE+RTRM+KVLE+LD LRKK DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  93   YHKAHKSEVRTRMKKVLEALDDLRKKSDAQAEEVLPIEKLIAEAYSVIDKAVKVGTLHRN  152

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDATPI  284
            TGARRKSRLARRKKAVEIHHGWY PAPA +AT +
Sbjct  153  TGARRKSRLARRKKAVEIHHGWYTPAPA-EATAV  185



>ref|XP_006298594.1| hypothetical protein CARUB_v10014678mg [Capsella rubella]
 gb|EOA31492.1| hypothetical protein CARUB_v10014678mg [Capsella rubella]
Length=200

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+L+ L+KK DAQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  103  YNKSKKSEARTRMKKVLEALEGLKKKADAQPDEIVSVEKLIGEAYSAIDKAVKVKALHKN  162

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDATPIPLA  293
            TGARRKSRLARRKKAVEIHHGWYVP  A  +  + +A
Sbjct  163  TGARRKSRLARRKKAVEIHHGWYVPDAAAASEAVTMA  199



>emb|CDP05950.1| unnamed protein product [Coffea canephora]
Length=179

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTRM+KVL+ L+ LRKK DAQ DEV+ IE LIAEAYS IDKA+K G +HR 
Sbjct  89   YNKARKSEIRTRMKKVLDELEVLRKKPDAQPDEVLSIEALIAEAYSVIDKAVKVGTLHRK  148

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLARRKKAVE+HHGWY PAP P A
Sbjct  149  TGARRKSRLARRKKAVEVHHGWYTPAPVPMA  179



>gb|KHG14694.1| 30S ribosomal S20, chloroplastic -like protein [Gossypium arboreum]
Length=188

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++K+KKSE++TRM+KVLE+LD LRKK DA  +E+  IEKLIAEAYS IDKA+K G++HRN
Sbjct  97   YHKAKKSEVKTRMKKVLEALDVLRKKPDAAAEEIFPIEKLIAEAYSVIDKAVKVGSLHRN  156

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLARRKKAVEIHHGWY P PA +A
Sbjct  157  TGARRKSRLARRKKAVEIHHGWYAPVPAENA  187



>gb|EYU26363.1| hypothetical protein MIMGU_mgv1a014578mg [Erythranthe guttata]
Length=185

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK+KKSE+RTRM+KVLE+L+ L KK DAQ +EV+ +EK+IAEAYS IDKAIK G +HRN
Sbjct  92   YNKAKKSEVRTRMKKVLEALEVLVKKSDAQPEEVLPVEKMIAEAYSVIDKAIKVGTLHRN  151

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLARRKKAVEIHHGWY P+P   A
Sbjct  152  TGARRKSRLARRKKAVEIHHGWYTPSPTETA  182



>emb|CDX75816.1| BnaC03g38990D [Brassica napus]
Length=137

 Score =   115 bits (288),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK +AQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  39   YNKSKKSEARTRMKKVLEALDGLKKKSEAQPDEIVTVEKLIGEAYSAIDKAVKVRALHKN  98

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  99   TGARRKSRLARRKKAVEIHHGWYVP  123



>ref|XP_010272363.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Nelumbo 
nucifera]
Length=182

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 1/88 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE++TRM+KVLE+LD LRKK DAQ +E++ IEKLIAEAYS IDKA+K G +HRN
Sbjct  93   YNKARKSEVKTRMKKVLEALDVLRKKADAQTEEILPIEKLIAEAYSVIDKAVKVGTLHRN  152

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA  266
            TGARRKSRLARRKKAVEIHHGWY P PA
Sbjct  153  TGARRKSRLARRKKAVEIHHGWYTP-PA  179



>ref|XP_009387860.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=193

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TRM+KVLE+LD LRKK DAQ +E++ IEKLIA+AYSAIDKAI+ G +H N
Sbjct  104  YNKARKSEIKTRMKKVLEALDVLRKKSDAQAEEILPIEKLIADAYSAIDKAIQVGTLHGN  163

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA  266
            TGARRKSRLARRKKAVEIHHGWY+PA A
Sbjct  164  TGARRKSRLARRKKAVEIHHGWYIPAAA  191



>emb|CDX98532.1| BnaC05g38430D [Brassica napus]
Length=214

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK DAQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  107  YNKSKKSEARTRMKKVLEALDGLKKKPDAQPDEIVTVEKLIGEAYSAIDKALKVRALHKN  166

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  167  TGARRKSRLARRKKAVEIHHGWYVP  191



>ref|XP_010465470.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Camelina 
sativa]
Length=200

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+L+ L+KK +AQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  101  YNKSKKSEARTRMKKVLEALEGLKKKTEAQPDEIVSVEKLIGEAYSAIDKAVKVKALHKN  160

Query  183  TGarrksrlarrkkaVEIHHGWYVP-APAPDAT  278
            TGARRKSRLARRKKAVEIHHGWYVP A AP A+
Sbjct  161  TGARRKSRLARRKKAVEIHHGWYVPDAAAPVAS  193



>emb|CDX97637.1| BnaA05g24420D [Brassica napus]
Length=213

 Score =   117 bits (292),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK DAQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  107  YNKSKKSEARTRMKKVLEALDGLKKKPDAQPDEIVTVEKLIGEAYSAIDKAVKVRALHKN  166

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  167  TGARRKSRLARRKKAVEIHHGWYVP  191



>ref|NP_188137.1| 30S ribosomal protein S20 [Arabidopsis thaliana]
 sp|Q9ASV6.1|RR20_ARATH RecName: Full=30S ribosomal protein S20, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 pdb|3BBN|T Chain T, Homology Model For The Spinach Chloroplast 30s Subunit 
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome.
 gb|AAK32820.1|AF361807_1 AT3g15190/F4B12_10 [Arabidopsis thaliana]
 gb|AAK48982.1|AF370555_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL05905.1| AT3g15190/F4B12_10 [Arabidopsis thaliana]
 gb|AAL66937.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64420.1| 30S ribosomal protein S20 [Arabidopsis thaliana]
 gb|AEE75630.1| 30S ribosomal protein S20 [Arabidopsis thaliana]
Length=202

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+L+ L+KK DAQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  103  YNKSKKSEARTRMKKVLEALEGLKKKTDAQADEIVTVEKLIGEAYSAIDKAVKVKALHKN  162

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  163  TGARRKSRLARRKKAVEIHHGWYVP  187



>ref|XP_009135431.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like isoform 
X2 [Brassica rapa]
Length=177

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK +AQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  79   YNKSKKSEARTRMKKVLEALDGLKKKAEAQPDEIVTVEKLIGEAYSAIDKAVKVRALHKN  138

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  139  TGARRKSRLARRKKAVEIHHGWYVP  163



>ref|XP_002882919.1| hypothetical protein ARALYDRAFT_897793 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59178.1| hypothetical protein ARALYDRAFT_897793 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+L+ L+KK DAQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  101  YNKSKKSEARTRMKKVLEALEGLKKKTDAQPDEIVTVEKLIGEAYSAIDKAVKVKALHKN  160

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  161  TGARRKSRLARRKKAVEIHHGWYVP  185



>ref|XP_009135430.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like isoform 
X1 [Brassica rapa]
Length=201

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK +AQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  103  YNKSKKSEARTRMKKVLEALDGLKKKAEAQPDEIVTVEKLIGEAYSAIDKAVKVRALHKN  162

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  163  TGARRKSRLARRKKAVEIHHGWYVP  187



>gb|KFK38864.1| hypothetical protein AALP_AA3G170400 [Arabis alpina]
Length=204

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+L+ L+KK DAQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  103  YNKSKKSEARTRMKKVLEALEGLKKKADAQPDEIVSVEKLIGEAYSAIDKAVKVKALHKN  162

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  163  TGARRKSRLARRKKAVEIHHGWYVP  187



>ref|XP_006348272.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Solanum 
tuberosum]
Length=184

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 81/92 (88%), Gaps = 2/92 (2%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++K+KKSE+RTR++ VLE+L+ LRKK DA+ +EVV +EKLIAEAYSAIDKA+K G +HRN
Sbjct  88   YHKAKKSEVRTRIKTVLEALETLRKKTDAESEEVVSVEKLIAEAYSAIDKAVKVGTLHRN  147

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA--PD  272
            TGARRKSRLARRKKAVEIHHGWYVP  A  PD
Sbjct  148  TGARRKSRLARRKKAVEIHHGWYVPVAATEPD  179



>emb|CDX82443.1| BnaA03g33780D [Brassica napus]
Length=201

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK +AQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  103  YNKSKKSEARTRMKKVLEALDGLKKKAEAQPDEIVTVEKLIGEAYSAIDKAVKVRALHKN  162

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  163  TGARRKSRLARRKKAVEIHHGWYVP  187



>ref|XP_006407001.1| hypothetical protein EUTSA_v10021521mg [Eutrema salsugineum]
 dbj|BAJ33842.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48454.1| hypothetical protein EUTSA_v10021521mg [Eutrema salsugineum]
Length=209

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+L+ L+KK DAQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  110  YNKSKKSEARTRMKKVLEALEGLKKKADAQPDEIVTVEKLIGEAYSAIDKAVKVRALHKN  169

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  170  TGARRKSRLARRKKAVEIHHGWYVP  194



>ref|XP_010487339.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Camelina 
sativa]
Length=202

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+L+ L+KK +AQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  103  YNKSKKSEARTRMKKVLEALEGLKKKTEAQPDEIVSVEKLIGEAYSAIDKAVKVKALHKN  162

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  163  TGARRKSRLARRKKAVEIHHGWYVP  187



>ref|XP_009356774.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009339298.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Pyrus 
x bretschneideri]
Length=184

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS+KSEI+TRM+KVLE+LD L+KK DA  +EV+ IEKLI EAYS IDKA+K G +HRN
Sbjct  93   YNKSRKSEIKTRMKKVLEALDGLKKKPDAAPEEVLSIEKLIGEAYSIIDKAVKVGTLHRN  152

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGARRKSRLARRKKAVE+HHGWY P P
Sbjct  153  TGARRKSRLARRKKAVEVHHGWYTPTP  179



>ref|XP_010502610.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Camelina 
sativa]
Length=203

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+L+ L+KK +AQ DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  103  YNKSKKSEARTRMKKVLEALEGLKKKTEAQPDEIVSVEKLIGEAYSAIDKAVKVKALHKN  162

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  163  TGARRKSRLARRKKAVEIHHGWYVP  187



>ref|XP_010060622.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67403.1| hypothetical protein EUGRSUZ_F01167 [Eucalyptus grandis]
 gb|KCW67404.1| hypothetical protein EUGRSUZ_F01167 [Eucalyptus grandis]
Length=194

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE+RTRM+KVLE LD LRKK DAQ +E++ IEKLIAEAYS IDKA+K G +HRN
Sbjct  96   YNKARKSEVRTRMKKVLEELDGLRKKPDAQAEEILSIEKLIAEAYSVIDKAVKVGTLHRN  155

Query  183  TGarrksrlarrkkaVEIHHGWYV  254
            TGARRKSRLARRKKAVEIHHGWY 
Sbjct  156  TGARRKSRLARRKKAVEIHHGWYT  179



>ref|XP_009146279.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Brassica 
rapa]
Length=205

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK DAQ DE+V +EKLI EAYSAIDKA+K  A+H+ 
Sbjct  107  YNKSKKSEARTRMKKVLEALDGLKKKPDAQPDEIVTVEKLIGEAYSAIDKAVKVRALHKK  166

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDAT  278
             GARRKSRLARRKKAVEIHHGWYVP  A  AT
Sbjct  167  PGARRKSRLARRKKAVEIHHGWYVPDTASAAT  198



>emb|CDY32315.1| BnaC01g36340D [Brassica napus]
Length=199

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK DA  DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  102  YNKSKKSEARTRMKKVLEALDGLKKKADAVPDEIVTVEKLIGEAYSAIDKAVKVRALHKN  161

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWYVP
Sbjct  162  TGARRKSRLARRKKAVEIHHGWYVP  186



>ref|XP_007212118.1| hypothetical protein PRUPE_ppa012008mg [Prunus persica]
 gb|EMJ13317.1| hypothetical protein PRUPE_ppa012008mg [Prunus persica]
Length=187

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++KS+KSEI+TRM+KVLE+LD LRKK DA  +EV+ IEKLI EAYS IDKA+K G +HRN
Sbjct  97   YHKSRKSEIKTRMKKVLEALDVLRKKPDATPEEVLSIEKLIGEAYSIIDKAVKVGTLHRN  156

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGARRKSRLARRKKAVEIHHGWY P P
Sbjct  157  TGARRKSRLARRKKAVEIHHGWYTPNP  183



>ref|XP_008367099.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Malus 
domestica]
Length=180

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS+KSEI+TRM+KVLE+LD L+KK DA  +EV+ IEKLI EAYS IDKA K G +HRN
Sbjct  89   YNKSRKSEIKTRMKKVLEALDGLKKKPDAAPEEVLSIEKLIGEAYSIIDKAXKVGTLHRN  148

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGARRKSRLARRKKAVE+HHGWY P+P
Sbjct  149  TGARRKSRLARRKKAVEVHHGWYTPSP  175



>ref|XP_009776683.1| PREDICTED: 30S ribosomal protein S20, chloroplastic isoform X1 
[Nicotiana sylvestris]
Length=188

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE++TRM+KVLE LD LRKK DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  92   YNKARKSEVKTRMKKVLEELDMLRKKPDAQPEEVLTIEKLIAEAYSVIDKAVKVGTLHRN  151

Query  183  TGarrksrlarrkkaVEIHHGWYV  254
            TGARRKSRLARRKKAVEIHHGWYV
Sbjct  152  TGARRKSRLARRKKAVEIHHGWYV  175



>ref|XP_009776691.1| PREDICTED: 30S ribosomal protein S20, chloroplastic isoform X2 
[Nicotiana sylvestris]
Length=186

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE++TRM+KVLE LD LRKK DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  90   YNKARKSEVKTRMKKVLEELDMLRKKPDAQPEEVLTIEKLIAEAYSVIDKAVKVGTLHRN  149

Query  183  TGarrksrlarrkkaVEIHHGWYV  254
            TGARRKSRLARRKKAVEIHHGWYV
Sbjct  150  TGARRKSRLARRKKAVEIHHGWYV  173



>ref|XP_010917978.1| PREDICTED: 30S ribosomal protein S20, chloroplastic isoform X2 
[Elaeis guineensis]
Length=174

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TRM+KV E+LD ++KK DAQ +E++ IEKLIAEAYS IDKA+K G +HRN
Sbjct  86   YNKARKSEIKTRMKKVFEALDVVKKKSDAQAEEILPIEKLIAEAYSVIDKAVKVGTLHRN  145

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA  266
            TGA RKSRLARRKKAVEIHHGWY P  A
Sbjct  146  TGAHRKSRLARRKKAVEIHHGWYTPVAA  173



>ref|XP_008386206.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Malus 
domestica]
Length=184

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS+KSEI+TRM+KVLE+LD L+KK DA  +EV+ IEKLI EAYS IDKA+K G +HRN
Sbjct  93   YNKSRKSEIKTRMKKVLEALDGLKKKPDAAPEEVLSIEKLIGEAYSIIDKAVKVGTLHRN  152

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWY P
Sbjct  153  TGARRKSRLARRKKAVEIHHGWYTP  177



>ref|XP_009340650.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Pyrus 
x bretschneideri]
Length=184

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS+KSEI+TRM+KVLE+LD L+KK DA  +EV+ IEKLI EAYS IDKA+K G +HRN
Sbjct  93   YNKSRKSEIKTRMKKVLEALDGLKKKPDAAPEEVLSIEKLIGEAYSIIDKAVKVGTLHRN  152

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGARRKSRLARRKKAVEIHHGWY P
Sbjct  153  TGARRKSRLARRKKAVEIHHGWYTP  177



>ref|XP_010917969.1| PREDICTED: 30S ribosomal protein S20, chloroplastic isoform X1 
[Elaeis guineensis]
Length=185

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TRM+KV E+LD ++KK DAQ +E++ IEKLIAEAYS IDKA+K G +HRN
Sbjct  97   YNKARKSEIKTRMKKVFEALDVVKKKSDAQAEEILPIEKLIAEAYSVIDKAVKVGTLHRN  156

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA  266
            TGA RKSRLARRKKAVEIHHGWY P  A
Sbjct  157  TGAHRKSRLARRKKAVEIHHGWYTPVAA  184



>ref|XP_003628554.1| 30S ribosomal protein S20 [Medicago truncatula]
 gb|AET03030.1| 30S ribosomal protein S20 [Medicago truncatula]
Length=173

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTR +KVLE+L+ L+KK DAQ +E+  IEK+I EAYS IDKA+K G +HRN
Sbjct  83   YNKARKSEIRTRTKKVLEALELLKKKSDAQAEEITSIEKMIGEAYSIIDKAVKVGTLHRN  142

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGA RKSRLARRKKAVEIHHGWY P P
Sbjct  143  TGANRKSRLARRKKAVEIHHGWYAPVP  169



>ref|XP_008226494.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Prunus mume]
Length=187

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++KS+KSEI+TRM+KVLE+LD L+KK DA  +EV+ IEKLI EAYS IDKA+K G +HRN
Sbjct  97   YHKSRKSEIKTRMKKVLEALDVLKKKPDATPEEVLSIEKLIGEAYSIIDKAVKVGTLHRN  156

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGARRKSRLARRK+AVEIHHGWY P P
Sbjct  157  TGARRKSRLARRKQAVEIHHGWYTPNP  183



>ref|NP_001237852.1| uncharacterized protein LOC100499656 [Glycine max]
 gb|ACU13133.1| unknown [Glycine max]
Length=180

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TR +KVLE+L+ L+KK DAQ +E++ IEKLI EAYS IDKA++ G +HRN
Sbjct  90   YNKARKSEIKTRTKKVLEALEVLKKKSDAQAEEILPIEKLIGEAYSIIDKAVRVGTLHRN  149

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGA RKSRLARRKKAVEIHHGWY PAP
Sbjct  150  TGANRKSRLARRKKAVEIHHGWYTPAP  176



>ref|NP_001241947.1| uncharacterized protein LOC100786192 [Glycine max]
 gb|ACU20521.1| unknown [Glycine max]
Length=164

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TR +KVLE+L+ L+KK+DAQ +E++ IEKLI EAYS IDKA++ G +HRN
Sbjct  74   YNKARKSEIKTRTKKVLEALEVLKKKQDAQAEEILSIEKLIGEAYSIIDKAVRVGTLHRN  133

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            TGA RKSRLARRKKAVEIHHGWY P P
Sbjct  134  TGANRKSRLARRKKAVEIHHGWYTPTP  160



>ref|XP_006859051.1| hypothetical protein AMTR_s00068p00188920 [Amborella trichopoda]
 gb|ERN20518.1| hypothetical protein AMTR_s00068p00188920 [Amborella trichopoda]
Length=122

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS+KSEI+TRM+KV ++LD L+KK +AQ DE++ +EKLIAEAYSAIDKA++ G +HRNT
Sbjct  34   NKSRKSEIKTRMKKVFDALDELKKKTEAQADEILPVEKLIAEAYSAIDKAVQKGTLHRNT  93

Query  186  GarrksrlarrkkaVEIHHGWYVPAP  263
            GA RKSRLARRKKAVEIHH WY P P
Sbjct  94   GAHRKSRLARRKKAVEIHHAWYTPQP  119



>ref|XP_008801495.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Phoenix 
dactylifera]
Length=185

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TRM+KV E+LD L+KK DAQ +E++  EKLIAEAYS ID+A+K G +HRN
Sbjct  97   YNKARKSEIKTRMKKVFEALDVLKKKTDAQAEEILPTEKLIAEAYSIIDRAVKVGTLHRN  156

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPA  266
            TGARRKSRLARRKKAVEIHHGWY P  A
Sbjct  157  TGARRKSRLARRKKAVEIHHGWYTPGAA  184



>ref|XP_009116457.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Brassica 
rapa]
 emb|CDY20104.1| BnaA01g28980D [Brassica napus]
Length=199

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKSKKSE RTRM+KVLE+LD L+KK DA  DE+V +EKLI EAYSAIDKA+K  A+H+N
Sbjct  100  YNKSKKSEARTRMKKVLEALDGLKKKADAVPDEIVTVEKLIGEAYSAIDKAVKVRALHKN  159

Query  183  TGarrksrlarrkkaVEIHHGWYV  254
            TGARRKSRLARRKKAVEIHHGWYV
Sbjct  160  TGARRKSRLARRKKAVEIHHGWYV  183



>ref|XP_008463697.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Cucumis 
melo]
Length=184

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TRM+KVLE+LD L+KK +AQ +EV+ IEKL+AEAYS IDKA++ G +HRN
Sbjct  94   YNKARKSEIKTRMKKVLEALDGLKKKAEAQSEEVLPIEKLMAEAYSVIDKAVRAGTLHRN  153

Query  183  TGarrksrlarrkkaVEIHHGWYVP-APA  266
            T ARRKSRLARRKKAVEIHHGWY P +PA
Sbjct  154  TAARRKSRLARRKKAVEIHHGWYTPDSPA  182



>ref|XP_009592363.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=188

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE++TRM+KVLE LD LRKK DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  92   YNKARKSEVKTRMKKVLEELDMLRKKPDAQPEEVLTIEKLIAEAYSVIDKAVKVGTLHRN  151

Query  183  TGarrksrlarrkkaVEIHHGWYV  254
            TGARRKSRLARRKKAVEI+HGWYV
Sbjct  152  TGARRKSRLARRKKAVEIYHGWYV  175



>gb|AFK46331.1| unknown [Lotus japonicus]
 gb|AFK46938.1| unknown [Lotus japonicus]
Length=177

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TRM+KVLE+L++L+KK DAQ +E++ IEKLI EAYS IDKAI+ G +HRN
Sbjct  87   YNKARKSEIKTRMKKVLEALESLKKKSDAQPEEILPIEKLIGEAYSVIDKAIRVGTLHRN  146

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TG  RKSRLARRKK VEIHHGWY P
Sbjct  147  TGGHRKSRLARRKKVVEIHHGWYTP  171



>ref|XP_004510023.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=172

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTR +KVL++L+ LRKK DAQ +E+V IEK+I EAYS IDKA+K G +HRN
Sbjct  82   YNKARKSEIRTRTKKVLDALELLRKKPDAQSEEIVSIEKMIGEAYSIIDKAVKVGTLHRN  141

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGA RKSRLARRKKAVEIHHGWY P
Sbjct  142  TGANRKSRLARRKKAVEIHHGWYAP  166



>ref|XP_004291502.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=186

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS+KSEI+TRM+KVLE+LD L+KK DAQ +EV+ IEKLI EAYS IDKA+K G +HRN
Sbjct  95   YNKSRKSEIKTRMKKVLEALDVLKKKPDAQAEEVLSIEKLIGEAYSIIDKAVKVGTLHRN  154

Query  183  TGarrksrlarrkkaVEIHHGWYVPA  260
            TGARRKSRLARRKKAVEI  GWY PA
Sbjct  155  TGARRKSRLARRKKAVEIQKGWYTPA  180



>ref|XP_004510022.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=172

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTR +KVL++L+ LRKK DAQ +E+V IEK+I EAYS IDKA+K G +HRN
Sbjct  82   YNKARKSEIRTRTKKVLDALELLRKKPDAQSEEIVSIEKMIGEAYSIIDKAVKVGTLHRN  141

Query  183  TGarrksrlarrkkaVEIHHGWYVP  257
            TGA RKSRLARRKKAVEIHHGWY P
Sbjct  142  TGANRKSRLARRKKAVEIHHGWYAP  166



>ref|XP_004146049.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162928.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Cucumis 
sativus]
 gb|KGN55105.1| hypothetical protein Csa_4G630000 [Cucumis sativus]
Length=184

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TRM+KVLE+LD L+KK +AQ +EV+ IE LIAEAYS IDKA++ G +HRN
Sbjct  94   YNKARKSEIKTRMKKVLEALDGLKKKAEAQSEEVLPIETLIAEAYSVIDKAVRAGTLHRN  153

Query  183  TGarrksrlarrkkaVEIHHGWYVP-APA  266
            T ARRKSRLARRKKAVEIHHGWY P +PA
Sbjct  154  TAARRKSRLARRKKAVEIHHGWYTPDSPA  182



>ref|XP_006370215.1| chloroplast 30S ribosomal protein S20 [Populus trichocarpa]
 gb|ERP66784.1| chloroplast 30S ribosomal protein S20 [Populus trichocarpa]
Length=182

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE++TRM+KVLE+LD L+KK +AQ +EV+ IEKLIAEAYS IDKAIK G +HRN
Sbjct  90   YNKARKSEVKTRMKKVLEALDDLKKKPEAQFEEVLPIEKLIAEAYSVIDKAIKVGTLHRN  149

Query  183  TGarrksrlarrkkaVEIHHGWY  251
            TGARRKSRLARRKKAVEIHHGWY
Sbjct  150  TGARRKSRLARRKKAVEIHHGWY  172



>ref|XP_011043839.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Populus 
euphratica]
Length=182

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE++TRM+KVLE+LD L+KK +AQ +EV+ IEKLIAEAYS IDKAIK G +HRN
Sbjct  90   YNKARKSEVKTRMKKVLEALDDLKKKPEAQFEEVLPIEKLIAEAYSVIDKAIKVGTLHRN  149

Query  183  TGarrksrlarrkkaVEIHHGWY  251
            TGARRKSRLARRKKAVEIHHGWY
Sbjct  150  TGARRKSRLARRKKAVEIHHGWY  172



>gb|EPS64680.1| hypothetical protein M569_10102, partial [Genlisea aurea]
Length=123

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTRM+KVLE+L+ L KK DAQ +EVV +EKLI EAYS IDKA+K G VHRN
Sbjct  34   YNKARKSEIRTRMKKVLEALEVLGKKPDAQPEEVVPVEKLIGEAYSVIDKAVKVGTVHRN  93

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAP  269
            TGARRKSRLARRKKAVEI  GWY P P P
Sbjct  94   TGARRKSRLARRKKAVEIQFGWYKP-PEP  121



>ref|XP_007133233.1| hypothetical protein PHAVU_011G162800g [Phaseolus vulgaris]
 gb|ESW05227.1| hypothetical protein PHAVU_011G162800g [Phaseolus vulgaris]
Length=178

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI+TR +KVLE+L+ L+KK+DA  +E++ IEKLI EAYS IDKA+++G +HRN
Sbjct  88   YNKARKSEIKTRTKKVLEALEVLKKKQDAASEEILPIEKLIGEAYSTIDKAVRSGTLHRN  147

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP  263
            T A RK+RLARRKKAVEIHHGWY P P
Sbjct  148  TAANRKARLARRKKAVEIHHGWYTPVP  174



>ref|XP_011098278.1| PREDICTED: 30S ribosomal protein S20, chloroplastic isoform X2 
[Sesamum indicum]
Length=179

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTRM+KVLE+L+ L KK DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  87   YNKARKSEIRTRMKKVLEALEVLGKKADAQPEEVLPIEKLIAEAYSVIDKAVKVGTLHRN  146

Query  183  TGarrksrlarrkkaVEIHHGWY  251
            TGARRKSRLARRKKAVEI+HGWY
Sbjct  147  TGARRKSRLARRKKAVEIYHGWY  169



>ref|XP_011098277.1| PREDICTED: 30S ribosomal protein S20, chloroplastic isoform X1 
[Sesamum indicum]
Length=181

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEIRTRM+KVLE+L+ L KK DAQ +EV+ IEKLIAEAYS IDKA+K G +HRN
Sbjct  89   YNKARKSEIRTRMKKVLEALEVLGKKADAQPEEVLPIEKLIAEAYSVIDKAVKVGTLHRN  148

Query  183  TGarrksrlarrkkaVEIHHGWY  251
            TGARRKSRLARRKKAVEI+HGWY
Sbjct  149  TGARRKSRLARRKKAVEIYHGWY  171



>ref|XP_007021565.1| 30S ribosomal protein S20 isoform 3 [Theobroma cacao]
 gb|EOY13090.1| 30S ribosomal protein S20 isoform 3 [Theobroma cacao]
Length=186

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 74/91 (81%), Gaps = 7/91 (8%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE       VLE+LD LRKK DAQ +E+  IEKLIAEAYS IDKA+K G +HRN
Sbjct  102  YNKARKSE-------VLEALDVLRKKPDAQAEEIFSIEKLIAEAYSVIDKAVKVGTLHRN  154

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGARRKSRLARRKKAVEIHHGWY PAPA +A
Sbjct  155  TGARRKSRLARRKKAVEIHHGWYTPAPAGNA  185



>ref|XP_010675477.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=186

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK++KSE++TRMRKV E+LD L+KK     +E+V I+ L+AEAYSAIDKA+  G++HRNT
Sbjct  96   NKARKSEVKTRMRKVFEALDVLKKKTGPAPEELVPIDNLLAEAYSAIDKAVVKGSLHRNT  155

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAP  269
             ARRKSRLAR KK VEIHHGWY PA AP
Sbjct  156  AARRKSRLARNKKVVEIHHGWYTPASAP  183



>gb|ABK24542.1| unknown [Picea sitchensis]
Length=178

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS KSEI+TRMRKV E+L  L+K      ++++ IEKLIAEAYS+IDKA+K G +HRN
Sbjct  90   YNKSHKSEIKTRMRKVFEALGKLKKATSPSPEDLIPIEKLIAEAYSSIDKAVKVGTLHRN  149

Query  183  TGarrksrlarrkkaVEIHHGWYVPA  260
            TG  RKSRL+RRKKAVEIHHGWY PA
Sbjct  150  TGGHRKSRLSRRKKAVEIHHGWYKPA  175



>gb|ABK23997.1| unknown [Picea sitchensis]
 gb|ABK26614.1| unknown [Picea sitchensis]
Length=178

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS KSEI+TRMRKV E+L  L+K      ++++ IEKLIAEAYS+IDKA+K G +HRN
Sbjct  90   YNKSHKSEIKTRMRKVFEALGKLKKATSPSPEDLIPIEKLIAEAYSSIDKAVKVGTLHRN  149

Query  183  TGarrksrlarrkkaVEIHHGWYVPA  260
            TG  RKSRL+RRKK VEIHHGWY PA
Sbjct  150  TGGHRKSRLSRRKKVVEIHHGWYKPA  175



>dbj|BAB02573.1| unnamed protein product [Arabidopsis thaliana]
Length=223

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 77/106 (73%), Gaps = 21/106 (20%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRK---------------------VLESLDALRKKRDAQQDEVVEIEK  119
            +NKSKKSE RTRM+K                     VLE+L+ L+KK DAQ DE+V +EK
Sbjct  103  YNKSKKSEARTRMKKQPMNNTEHWNPNESKIHLSKQVLEALEGLKKKTDAQADEIVTVEK  162

Query  120  LIAEAYSAIDKAIKTGAVHRNTGarrksrlarrkkaVEIHHGWYVP  257
            LI EAYSAIDKA+K  A+H+NTGARRKSRLARRKKAVEIHHGWYVP
Sbjct  163  LIGEAYSAIDKAVKVKALHKNTGARRKSRLARRKKAVEIHHGWYVP  208



>ref|XP_006644515.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Oryza 
brachyantha]
Length=190

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KVL++L+ LRKK DA  +++++IEK I+EAY AIDK +K GA+HRNT
Sbjct  99   NHARKAEMRTRMKKVLKALEKLRKKPDATPEDIIQIEKWISEAYKAIDKTVKVGAMHRNT  158

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDAT  278
            G  RKS LARRKKA+EI  GWYVP   P AT
Sbjct  159  GNHRKSILARRKKAIEILRGWYVPNAEPAAT  189



>gb|EAY75367.1| hypothetical protein OsI_03263 [Oryza sativa Indica Group]
Length=196

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KVL++L+ LRKK DA  +++++IEK I+EAY AIDK +K GA+HRNT
Sbjct  105  NHARKAEMRTRMKKVLKALEKLRKKADATPEDIIQIEKWISEAYKAIDKTVKVGAMHRNT  164

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDAT  278
            G  RKS LARRKKA+EI  GWYVP   P AT
Sbjct  165  GNHRKSLLARRKKAIEILRGWYVPNAEPAAT  195



>ref|NP_001043859.1| Os01g0678600 [Oryza sativa Japonica Group]
 dbj|BAF05773.1| Os01g0678600 [Oryza sativa Japonica Group]
 gb|EAZ13084.1| hypothetical protein OsJ_03005 [Oryza sativa Japonica Group]
 dbj|BAG88521.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00100.1| unnamed protein product [Oryza sativa Japonica Group]
Length=196

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KVL++L+ LRKK DA  +++++IEK I+EAY AIDK +K GA+HRNT
Sbjct  105  NHARKAEMRTRMKKVLKALEKLRKKADATPEDIIQIEKWISEAYKAIDKTVKVGAMHRNT  164

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDAT  278
            G  RKS LARRKKA+EI  GWYVP   P AT
Sbjct  165  GNHRKSLLARRKKAIEILRGWYVPNAEPAAT  195



>gb|KCW67401.1| hypothetical protein EUGRSUZ_F01167 [Eucalyptus grandis]
 gb|KCW67402.1| hypothetical protein EUGRSUZ_F01167 [Eucalyptus grandis]
Length=187

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 7/84 (8%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSE       VLE LD LRKK DAQ +E++ IEKLIAEAYS IDKA+K G +HRN
Sbjct  96   YNKARKSE-------VLEELDGLRKKPDAQAEEILSIEKLIAEAYSVIDKAVKVGTLHRN  148

Query  183  TGarrksrlarrkkaVEIHHGWYV  254
            TGARRKSRLARRKKAVEIHHGWY 
Sbjct  149  TGARRKSRLARRKKAVEIHHGWYT  172



>gb|AFK39838.1| unknown [Lotus japonicus]
Length=79

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  39   MRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNTGarrksrlarr  218
            M+KVLE+L++L+KK DAQ +E++ IEKLI EAYS IDKAI+ G +HRNTG  RK RLARR
Sbjct  1    MKKVLEALESLKKKSDAQPEEILPIEKLIGEAYSVIDKAIRVGTLHRNTGGHRKPRLARR  60

Query  219  kkaVEIHHGWYVP  257
            KK VEIHHGWY P
Sbjct  61   KKVVEIHHGWYTP  73



>gb|KHN05309.1| 30S ribosomal protein S20, chloroplastic [Glycine soja]
Length=152

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  48   VLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNTGarrksrlarrkka  227
            VLE+L+ L+KK DAQ +E++ IEKLI EAYS IDKA++ G +HRNTGA RKSRLARRKKA
Sbjct  77   VLEALEVLKKKSDAQAEEILPIEKLIGEAYSIIDKAVRVGTLHRNTGANRKSRLARRKKA  136

Query  228  VEIHHGWYVPAP  263
            VEIHHGWY PAP
Sbjct  137  VEIHHGWYTPAP  148



>ref|XP_008351018.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Malus 
domestica]
Length=84

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  39   MRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNTGarrksrlarr  218
            + +VLE+LD L+KK DA  +EV+ IEKLI EAYS IDKA+K G +HRNTGARRKSRLARR
Sbjct  5    LYQVLEALDGLKKKPDAAPEEVLSIEKLIGEAYSIIDKAVKVGTLHRNTGARRKSRLARR  64

Query  219  kkaVEIHHGWYVP  257
            KKAVEIHHGWY P
Sbjct  65   KKAVEIHHGWYTP  77



>ref|XP_002456139.1| hypothetical protein SORBIDRAFT_03g031120 [Sorghum bicolor]
 gb|EES01259.1| hypothetical protein SORBIDRAFT_03g031120 [Sorghum bicolor]
Length=194

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KVL +L+ LRKK DAQ +E++EIEKLI+EAY AIDK +K GA+HRNT
Sbjct  103  NHARKAEMRTRMKKVLRALEKLRKKPDAQPEEIIEIEKLISEAYKAIDKTVKVGAMHRNT  162

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            G  RKSRLARRKKA+EI  GWYVP   P A
Sbjct  163  GNHRKSRLARRKKAIEILRGWYVPNAEPVA  192



>ref|NP_001152580.1| LOC100286220 [Zea mays]
 gb|ACG48335.1| ribosomal protein rpS20 [Zea mays]
Length=194

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KVL +L+ LRKK DAQ +E++EIEKLIAEAY AIDK +K GA+HRNT
Sbjct  103  NHARKAEMRTRMKKVLRALEKLRKKPDAQPEEIIEIEKLIAEAYKAIDKTVKVGAMHRNT  162

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDA  275
               RKSRLARRKKA+EI  GWYVP   P A
Sbjct  163  ANHRKSRLARRKKAIEILRGWYVPNAEPVA  192



>gb|ACF84630.1| unknown [Zea mays]
 gb|AFW83573.1| ribosomal protein rpS20 [Zea mays]
Length=194

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KVL +L+ LRKK DAQ +E++EIEKLIAEAY AIDK +K GA+HRNT
Sbjct  103  NHARKAEMRTRMKKVLRALEKLRKKPDAQPEEIIEIEKLIAEAYKAIDKTVKVGAMHRNT  162

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDA  275
               RKSRLARRKKA+EI  GWYVP   P A
Sbjct  163  ANHRKSRLARRKKAIEILRGWYVPNAEPVA  192



>ref|XP_003569559.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Brachypodium 
distachyon]
Length=186

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KV  +L+ LRKK DAQ +E++EIEK+I+EAY AIDK +K GA+HRNT
Sbjct  95   NHARKAEMRTRMKKVFRALEKLRKKADAQPEEIIEIEKMISEAYKAIDKTVKVGAMHRNT  154

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            G  RKSRLARRKKA+EI  GWYVP   P A
Sbjct  155  GDHRKSRLARRKKAIEILRGWYVPNAEPTA  184



>gb|AGV54866.1| hypothetical protein [Phaseolus vulgaris]
Length=206

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  45   KVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNTGarrksrlarrkk  224
            +VLE+L+ L+KK+DA  +E++ IEKLI EAYS IDKA+++G +HRNT A RK+RLARRKK
Sbjct  130  QVLEALEVLKKKQDAASEEILPIEKLIGEAYSTIDKAVRSGTLHRNTAANRKARLARRKK  189

Query  225  aVEIHHGWYVPAP  263
            AVEIHHGWY P P
Sbjct  190  AVEIHHGWYTPVP  202



>emb|CDM83937.1| unnamed protein product [Triticum aestivum]
Length=188

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KV  +L+ LRKK DAQ +E++EIEK+I+EAY AIDK +K GA+HRNT
Sbjct  97   NHARKAEMRTRMKKVFRALEKLRKKADAQPEEIIEIEKMISEAYKAIDKTVKVGAMHRNT  156

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            G  RKSRLARRKKA+EI  GWYVP   P A
Sbjct  157  GDHRKSRLARRKKAIEIIRGWYVPNAEPAA  186



>dbj|BAJ84882.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86628.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KV  +L+ LRKK DAQ +E++EIEK+I+EAY AIDK +K GA+HRNT
Sbjct  97   NHARKAEMRTRMKKVFRALEKLRKKADAQPEEIIEIEKMISEAYKAIDKTVKVGAMHRNT  156

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            G  RKSRLARRKKA+EI  GWYVP   P A
Sbjct  157  GDHRKSRLARRKKAIEIIRGWYVPNAEPAA  186



>ref|XP_004969532.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Setaria 
italica]
Length=192

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KV  +L+ LRKK DAQ +E++EIEK+IAEAY AIDK ++ GA+HRNT
Sbjct  101  NHARKAEMRTRMKKVFRALEKLRKKADAQPEEIIEIEKMIAEAYKAIDKTVQVGALHRNT  160

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            G  RKSRLARRKKA+EI  GWYVP   P A
Sbjct  161  GNHRKSRLARRKKAIEILRGWYVPNAEPVA  190



>ref|XP_001782187.1| predicted protein [Physcomitrella patens]
 gb|EDQ53010.1| predicted protein, partial [Physcomitrella patens]
Length=125

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++K+KKSE+ TRM+KV  +LD L+KK DA +++   IEKLI EA+  IDKA K G++HRN
Sbjct  31   YHKAKKSEVSTRMKKVFVALDGLKKKTDATEEDFKPIEKLIGEAFKIIDKAAKVGSLHRN  90

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDATP  281
                +KSRL+R K+ + I  G Y P+ AP + P
Sbjct  91   KAGHQKSRLSRAKRTMMIQLGLYTPS-APSSEP  122



>ref|XP_001767505.1| predicted protein [Physcomitrella patens]
 gb|EDQ67640.1| predicted protein, partial [Physcomitrella patens]
Length=123

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            ++KSKKSEI TRM+KV  +LD L+KK DA +++   +EKLI+EA+  IDKA +  ++H N
Sbjct  31   YHKSKKSEISTRMKKVFVALDVLKKKTDASEEDFKHVEKLISEAFKIIDKAAQVSSIHVN  90

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
                +KSRL+R K+ V I  G Y P  A  A
Sbjct  91   KAGHQKSRLSRAKRTVLIQLGMYTPTSASSA  121



>gb|EMS62284.1| 30S ribosomal protein S20, chloroplastic [Triticum urartu]
Length=285

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N ++K+E+RTRM+KV  +L+ LRKK DAQ +E++EIEK+I+EAY AIDK +K GA+HRNT
Sbjct  97   NHARKAEMRTRMKKVFRALEKLRKKADAQPEEIIEIEKMISEAYKAIDKTVKVGAMHRNT  156

Query  186  G  188
            G
Sbjct  157  G  157



>ref|XP_005849993.1| hypothetical protein CHLNCDRAFT_141918 [Chlorella variabilis]
 gb|EFN57891.1| hypothetical protein CHLNCDRAFT_141918 [Chlorella variabilis]
Length=153

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS+KSEI TRM+KV  +LD  +    A + ++  ++ LI EAY  IDKA+KTG +H NT
Sbjct  68   NKSRKSEIATRMKKVFVALDGYKAAPPAAEADLAPVQTLINEAYQVIDKAVKTGCLHSNT  127

Query  186  GarrksrlarrkkaVEIHHGWYVPA  260
             ARRK+RLA  ++ V +  G Y PA
Sbjct  128  AARRKARLAAARRNVLVAAGLYTPA  152



>ref|XP_002506072.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67330.1| predicted protein [Micromonas sp. RCC299]
Length=208

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK +KSEI TRM+KV     AL  +    ++E+ ++EKLI+EA  A+DKAI  G +H+N
Sbjct  124  YNKMRKSEITTRMKKVFLKATALGAQEACSEEEIGDLEKLISEATKAVDKAIAKGVLHKN  183

Query  183  TG  188
            TG
Sbjct  184  TG  185



>gb|KIZ06524.1| 30S ribosomal protein S20 [Monoraphidium neglectum]
Length=170

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK +KS I TR++KVL+  + L K  +   ++V  +EKL+AEAY  ID A   G +H NT
Sbjct  62   NKGRKSAIATRIKKVLKLSETLVKAPEGAAEQVPALEKLVAEAYKEIDTAAVKGVIHANT  121

Query  186  GarrksrlarrkkaVEIHHGWYVPAP  263
             ARRK+R+AR K+ V I  G Y PAP
Sbjct  122  AARRKARVARYKQQVLISAGLYTPAP  147



>ref|XP_002954236.1| plastid/chloroplast ribosomal protein S20 [Volvox carteri f. 
nagariensis]
 gb|EFJ44660.1| plastid/chloroplast ribosomal protein S20 [Volvox carteri f. 
nagariensis]
Length=190

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDA-QQDEVVEIEKLIAEAYSAIDKAIKTGAVHR  179
            +NKS+KS   TR++KV++  ++L    DA  +D+V  +EKL++EAY+ IDKA+  G +H 
Sbjct  71   YNKSRKSACATRVKKVIKMAESLMSTADAHSEDQVKALEKLVSEAYTEIDKAVVKGILHE  130

Query  180  NTGarrksrlarrkkaVEIHHGWYVPA  260
            NT AR+K+R AR KK V +  G Y PA
Sbjct  131  NTAARKKARCARYKKHVLMFAGLYKPA  157



>ref|XP_011399306.1| 30S ribosomal protein S20, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26410.1| 30S ribosomal protein S20, chloroplastic [Auxenochlorella protothecoides]
Length=181

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK + SEI+TR++KVL ++DA +      + ++ E+  L++EAY  IDK +  G +H+NT
Sbjct  70   NKGRTSEIKTRIKKVLTAVDAAQADLPKAESDLSELAALMSEAYRVIDKGVSKGVLHKNT  129

Query  186  GarrksrlarrkkaVEIHHGWYVPAPAPDATP-IPLATV  299
             ARRK+R+AR ++ + I  G Y    AP++TP +P A++
Sbjct  130  AARRKARIARARQNLLISAGLY---KAPESTPDVPEASL  165



>gb|AAP79183.1| ribosomal protein rpS20 [Bigelowiella natans]
Length=194

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK+ KS ++TR +K L ++D  +K   + + ++   +KL++EAY  IDKAI  G + +N
Sbjct  103  YNKAIKSAVKTRTKKALRAIDEAKKGGISNEADLQASDKLMSEAYKEIDKAITKGVMKKN  162

Query  183  TGarrksrlarrkkaVEIHHGWYVPAPAPDA  275
            TGAR+KSR+A  +K + I +G Y P  AP +
Sbjct  163  TGARQKSRIATWRKKLLIENGLYSPEAAPQS  193



>ref|XP_003075156.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL52428.1| Ribosomal protein S20 [Ostreococcus tauri]
Length=136

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS+KSEI TRM+KV      L         ++  +EKLI+EA  A+DKA++ G +H+N
Sbjct  52   YNKSRKSEITTRMKKVFVEATRLNASSAVSDADIGGLEKLISEATKAVDKAVQKGVLHKN  111

Query  183  TG  188
            TG
Sbjct  112  TG  113



>ref|XP_003062494.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53313.1| predicted protein [Micromonas pusilla CCMP1545]
Length=151

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI TRM+KV     AL++    ++D +  +E LI+EA  A+DKA+  G +H+N
Sbjct  68   YNKARKSEITTRMKKVFVKASALKEGACTEED-IGALETLISEATKAVDKAVAKGVLHKN  126

Query  183  TG  188
            TG
Sbjct  127  TG  128



>ref|XP_001700557.1| plastid ribosomal protein S20 [Chlamydomonas reinhardtii]
 gb|EDO98001.1| plastid ribosomal protein S20 [Chlamydomonas reinhardtii]
Length=166

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (65%), Gaps = 1/91 (1%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NKS KS   TR++KV++  + L       ++EV  +EKLI+EAY+ IDKA+  G +H N
Sbjct  66   YNKSHKSACATRVKKVVKLAETLVAAPSKTEEEVKNLEKLISEAYTEIDKAVVKGILHEN  125

Query  183  TGarrksrlarrkkaVEIHHGWYVPAP-APD  272
            T AR+K+R AR KK V +  G Y PA  +PD
Sbjct  126  TAARKKARCARWKKTVLMAAGLYKPAADSPD  156



>ref|XP_007510026.1| 30S ribosomal protein S20 [Bathycoccus prasinos]
 emb|CCO19141.1| 30S ribosomal protein S20 [Bathycoccus prasinos]
Length=159

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI TR++KV    + L     A +D V E+EKLI+EA  ++DKA+  G +H+N
Sbjct  76   YNKARKSEIATRIKKVRTLAEILLP--AATEDNVAELEKLISEATKSVDKAVSKGVLHKN  133

Query  183  TG  188
            TG
Sbjct  134  TG  135



>ref|WP_006632886.1| 30S ribosomal protein S20 [Microcoleus vaginatus]
 gb|EGK88105.1| 30S ribosomal protein S20 [Microcoleus vaginatus FGP-2]
Length=99

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVV-EIEKLIAEAYSAIDKAIKTGAVHR  179
            +NKS KS ++T M+K   ++D   K   A   E++ E+++ ++EAYS IDKA+K G +HR
Sbjct  20   YNKSYKSAVKTLMKKYFAAVD---KYAAAPSPELMQEVQQRMSEAYSKIDKAVKKGVLHR  76

Query  180  NTG  188
            N G
Sbjct  77   NNG  79



>ref|XP_001416366.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO94659.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=84

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRN  182
            +NK++KSEI TRM+KV  +   L       + ++  +E LI+EA  ++DKA+  G +H+N
Sbjct  11   YNKARKSEITTRMKKVFVNASELMAADACTEADISGLETLISEATKSVDKAVARGILHKN  70

Query  183  TG  188
            TG
Sbjct  71   TG  72



>ref|WP_011125792.1| MULTISPECIES: 30S ribosomal protein S20 [Prochlorococcus]
 ref|NP_876033.1| Ribosomal protein S20 [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 sp|Q7VA27.1|RS20_PROMA RecName: Full=30S ribosomal protein S20 [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gb|AAQ00686.1| Ribosomal protein S20 [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 gb|KGG20397.1| SSU ribosomal protein S20p [Prochlorococcus marinus str. SS2]
 gb|KGG34742.1| SSU ribosomal protein S20p [Prochlorococcus sp. SS52]
Length=99

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 6/63 (10%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKK--RDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHR  179
            N++ KS +RT M++  E+  A  +K   DA++D    I+  + +A+S IDKA+KTG +HR
Sbjct  21   NRTYKSAMRTLMKRCFEACGAYSEKPSEDAKKD----IQNSMNDAFSKIDKAVKTGVLHR  76

Query  180  NTG  188
            NTG
Sbjct  77   NTG  79



>ref|WP_006529283.1| 30S ribosomal protein S20 [Gloeocapsa sp. PCC 73106]
 gb|ELR97859.1| ribosomal protein S20 [Gloeocapsa sp. PCC 73106]
Length=99

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+K L++++      +   + +  +E+ ++ AYS IDKA+KTG  HRN 
Sbjct  21   NKSYKSAVKTLMKKYLQAVEVY--ATNPTPESLTTVEQSMSAAYSKIDKAVKTGVYHRNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_015179155.1| 30S ribosomal protein S20 [Oscillatoria nigro-viridis]
 gb|AFZ09952.1| 30S ribosomal protein S20 [Oscillatoria nigro-viridis PCC 7112]
Length=99

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVV-EIEKLIAEAYSAIDKAIKTGAVHR  179
            +NKS KS ++T M+K   +++   K   A   E++ E+++ ++EAYS IDKA+K G +HR
Sbjct  20   YNKSYKSAVKTLMKKYFAAVE---KYAAAPSPELMQEVQQRMSEAYSKIDKAVKKGVLHR  76

Query  180  NTG  188
            N G
Sbjct  77   NNG  79



>ref|WP_039202355.1| 30S ribosomal protein S20 [Aphanizomenon flos-aquae]
 gb|KHG40893.1| 30S ribosomal protein S20 [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=95

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS +RT M+K   S++A       +  +  E+E  ++EAYS IDKA+KTG +H N 
Sbjct  21   NKAYKSAVRTLMKKYFSSVEACAANPTTELKQ--EVEARMSEAYSKIDKAVKTGVLHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_035998037.1| 30S ribosomal protein S20 [Leptolyngbya sp. JSC-1]
Length=98

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS +RT M++ L ++DA     +   + + E+++ ++ AYS IDKA+K G +H N 
Sbjct  21   NKSYKSAVRTLMKRYLTAVDAYAA--NPTPEAMAEVQRTMSAAYSKIDKAVKRGVLHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_042157802.1| 30S ribosomal protein S20 [Planktothrix agardhii]
Length=98

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+K L S+D      D   D +  + + +++A+S IDKA+K G +H N 
Sbjct  21   NKSYKSAVKTLMKKCLTSVDKF--GTDPTTDNLTTVNQQMSDAFSKIDKAVKKGVLHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>gb|KEI68521.1| RpsT [Planktothrix agardhii NIVA-CYA 126/8]
Length=106

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+K L S+D      D   D +  + + +++A+S IDKA+K G +H N 
Sbjct  29   NKSYKSAVKTLMKKCLTSVDKF--GTDPTTDNLTTVNQQMSDAFSKIDKAVKKGVLHPNN  86

Query  186  G  188
            G
Sbjct  87   G  87



>ref|WP_015160183.1| 30S ribosomal protein S20 [Chamaesiphon minutus]
 gb|AFY94040.1| ribosomal protein S20 [Chamaesiphon minutus PCC 6605]
Length=93

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS +RT M+K   ++D       A+     E++K ++EAY  IDKA++ G +HRN 
Sbjct  21   NKSHKSAVRTLMKKYFTAVDKHTAAPTAESS--AEVQKCMSEAYQKIDKAVQKGVLHRNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_026785759.1| MULTISPECIES: 30S ribosomal protein S20 [Planktothrix]
Length=98

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+K L S+D      D   D +  + + +++A+S IDKA+K G +H N 
Sbjct  21   NKSYKSAVKTLMKKCLTSVDKF--GTDPTTDNLTNVNQQMSDAFSKIDKAVKKGILHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_027404245.1| 30S ribosomal protein S20 [Aphanizomenon flos-aquae]
Length=95

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS +RT M+K   S++A       +  +  E+E  ++EAYS IDKA+KTG +H N 
Sbjct  21   NKAYKSAVRTLMKKYFSSVEACAVNPTTELKQ--EVEARMSEAYSKIDKAVKTGVLHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_009768246.1| 30S ribosomal protein S20 [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ67447.1| SSU ribosomal protein S20P [Oscillatoriales cyanobacterium JSC-12]
Length=101

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+K   ++D      D   D   E+++ +A AYS ID+A+K GA+H N 
Sbjct  21   NKSYKSAVKTLMKKYFAAVDTYAA--DPSPDSRQEVQQRLAAAYSKIDRAVKRGALHSNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>gb|KIE07616.1| 30S ribosomal protein S20 [Tolypothrix bouteillei VB521301]
Length=101

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+K   ++D       A+Q +  E+ K ++EAYS IDKA+K G +H N 
Sbjct  21   NKSYKSAVKTLMKKYFAAVDTYAANPTAEQKQ--EVLKHMSEAYSKIDKAVKRGVLHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_015228410.1| 30S ribosomal protein S20 [Dactylococcopsis salina]
 gb|AFZ49398.1| ribosomal protein S20 [Dactylococcopsis salina PCC 8305]
Length=96

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+K    +D      D+++++  +++K +A AYS IDKA+K  A+H+N 
Sbjct  21   NKSYKSAVKTLMKKYFAVVDDYASNPDSEKEQ--QVQKAMAAAYSKIDKAVKVNALHKNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_017300689.1| 30S ribosomal protein S20 [Nodosilinea nodulosa]
Length=100

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N+S KS ++T  +  L ++DA R   D   D   ++E  +A AYS IDKA+K G +H NT
Sbjct  21   NRSYKSAVKTLTKNYLSAVDAHRA--DPSADTQKQVEATMAAAYSKIDKAVKRGVLHPNT  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_025927023.1| MULTISPECIES: 30S ribosomal protein S20 [Prochlorococcus]
Length=97

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS +RT  +K LE+ +  + K+D  +D  + +   + +A+S IDKA+K   +H+NT
Sbjct  21   NKSYKSTVRTLTKKTLENCE--KYKKDPNEDNKILVTTSLNKAFSLIDKAVKKNVLHKNT  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_011612463.1| 30S ribosomal protein S20 [Trichodesmium erythraeum]
 gb|ABG52105.1| SSU ribosomal protein S20P [Trichodesmium erythraeum IMS101]
Length=112

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEV-VEIEKLIAEAYSAIDKAIKTGAVHRN  182
            NKS KS +RT M+K   +++   K      DE+ +E+E+ +++AYS IDKA+K G +H+N
Sbjct  21   NKSYKSAVRTLMKKYFTTVE---KYASNPTDELKIEVEQQMSKAYSKIDKAVKRGVLHKN  77

Query  183  TG  188
             G
Sbjct  78   NG  79



>ref|WP_012595073.1| MULTISPECIES: 30S ribosomal protein S20 [Cyanothece]
 sp|B7JWV1.1|RS20_CYAP8 RecName: Full=30S ribosomal protein S20 [Cyanothece sp. PCC 8801]
 gb|ACK65800.1| ribosomal protein S20 [Cyanothece sp. PCC 8801]
 gb|ACV00680.1| ribosomal protein S20 [Cyanothece sp. PCC 8802]
Length=97

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS +RT M+K  E++ A     +   D +  +E+ ++ AYS IDKA+K   +HRN 
Sbjct  21   NKAYKSAVRTLMKKYFEAVQAY--GNNPTPDNLSVVEQCMSAAYSKIDKAVKRHVLHRNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>gb|KJB81967.1| hypothetical protein B456_013G169400 [Gossypium raimondii]
Length=80

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    FNKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEI  113
            +NK+KK +++TRM+KVLE+LD LRKK +AQ  E+ ++
Sbjct  42   YNKAKKFQVKTRMKKVLEALDVLRKKPEAQAKEIYQL  78



>ref|WP_015134482.1| 30S ribosomal protein S20 [Leptolyngbya sp. PCC 7376]
 gb|AFY38724.1| SSU ribosomal protein S20P [Leptolyngbya sp. PCC 7376]
Length=96

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T  +K  ++++A     +       E ++ I+E YS IDKA+K G  HRNT
Sbjct  21   NKSYKSAVKTLTKKAFQAIEAC--ATEPSDTAKAEAQQCISETYSKIDKAVKRGVYHRNT  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_017660784.1| 30S ribosomal protein S20 [Geitlerinema sp. PCC 7105]
Length=101

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+    +++A     +   D + ++++ +A+AYS IDKA+K G +H NT
Sbjct  21   NKSYKSAVKTLMKNYFAAVEAY--GSNPSDDAMQDVQQRMAQAYSKIDKAVKRGVLHTNT  78

Query  186  G  188
            G
Sbjct  79   G  79



>gb|KGG10819.1| SSU ribosomal protein S20p [Prochlorococcus marinus str. LG]
 gb|KGG24066.1| SSU ribosomal protein S20p [Prochlorococcus marinus str. SS35]
 gb|KGG31675.1| SSU ribosomal protein S20p [Prochlorococcus marinus str. SS51]
Length=72

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 6/56 (11%)
 Frame = +3

Query  27   IRTRMRKVLESLDALRKK--RDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNTG  188
            +RT M++  E+  A  +K   DA++D    I+  + +A+S IDKA+KTG +HRNTG
Sbjct  1    MRTLMKRCFEACGAYSEKPSEDAKKD----IQNSMNDAFSKIDKAVKTGVLHRNTG  52



>ref|WP_009629068.1| 30S ribosomal protein S20 [Pseudanabaena biceps]
 gb|ELS30865.1| 30S ribosomal protein S20 [Pseudanabaena biceps PCC 7429]
Length=97

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS ++T M+  LE+++A +     +  E V  ++ +A  YS ID+A+K G +H NT
Sbjct  21   NKSYKSAVKTLMKSYLEAVEAYKANPTPEALEAVNAKQSLA--YSKIDRAVKCGVLHNNT  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_035990545.1| 30S ribosomal protein S20 [Leptolyngbya sp. KIOST-1]
Length=101

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            N+S KS ++T  +  L ++DA R    +  D   +++  +A AYS IDKA+K G +H NT
Sbjct  21   NRSYKSAVKTLTKNYLSAVDAYRAN-PSSADAKQQVDATMAAAYSKIDKAVKRGVLHPNT  79

Query  186  G  188
            G
Sbjct  80   G  80



>ref|WP_028090342.1| 30S ribosomal protein S20 [Dolichospermum circinale]
Length=95

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS ++T M+K   S++A       +  + VE++  ++EAYS IDKA+K G +H N 
Sbjct  21   NKAYKSAVKTLMKKYFSSVEAYAANPTTELKQEVEVK--MSEAYSKIDKAVKKGVLHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_028085214.1| 30S ribosomal protein S20 [Dolichospermum circinale]
Length=95

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS ++T M+K   S++A       +  + VE++  ++EAYS IDKA+K G +H N 
Sbjct  21   NKAYKSAVKTLMKKYFSSVEAYAANPTTELKQEVEVK--MSEAYSKIDKAVKKGVLHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_017313038.1| 30S ribosomal protein S20 [Fischerella sp. PCC 9339]
Length=101

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLD--ALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHR  179
            NKS KS ++T M+K L +++  A     ++QQ    E++  ++EAYS IDKA+K G +H 
Sbjct  21   NKSYKSAVKTLMKKYLAAVETYAANPSPESQQ----EVQTRMSEAYSKIDKAVKRGVLHP  76

Query  180  NTG  188
            N G
Sbjct  77   NNG  79



>ref|WP_015083021.1| 30S ribosomal protein S20 [Anabaena sp. 90]
 gb|AFW96465.1| ribosomal protein S20 [Anabaena sp. 90]
Length=95

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS ++T M+K   S++A       +  +  E+E  ++EAYS IDKA+K G +H N 
Sbjct  21   NKAYKSAVKTLMKKYFSSVEACAANPTTELKQ--EVETRMSEAYSKIDKAVKAGVLHANN  78

Query  186  G  188
            G
Sbjct  79   G  79



>gb|ADI63386.1| ribosomal protein S20 ['Nostoc azollae' 0708]
Length=116

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS ++T M+K   +++        +  + VE  + I+EAYS IDKA+K G +H NT
Sbjct  43   NKAYKSAVKTLMKKYFAAVEVYTANPTPESKQAVE--ERISEAYSKIDKAVKRGVLHPNT  100

Query  186  G  188
            G
Sbjct  101  G  101



>ref|WP_015198603.1| 30S ribosomal protein S20 [Calothrix parietina]
 gb|AFZ01974.1| SSU ribosomal protein S20P [Calothrix sp. PCC 6303]
Length=100

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NKS KS +RT M+    +L         +Q++  E++  +++AYS IDKA+K G +H N 
Sbjct  21   NKSYKSAVRTLMKNYFAALTTYAANPSPEQEK--EVQSRMSDAYSKIDKAVKRGVIHPNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_007355842.1| MULTISPECIES: 30S ribosomal protein S20 [Kamptonema]
 emb|CBN56631.1| 30S ribosomal protein S20 [ [[Oscillatoria] sp. PCC 6506]
Length=99

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS ++T M+K L ++D        +  E  ++++ ++EA+S IDKA+K G +HRN 
Sbjct  21   NKAYKSAVKTLMKKYLAAVDTYAAAPTPESME--QVQQRMSEAFSKIDKAVKRGVLHRNN  78

Query  186  G  188
            G
Sbjct  79   G  79



>ref|WP_041233256.1| 30S ribosomal protein S20 [Cylindrospermum stagnale]
Length=109

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  6    NKSKKSEIRTRMRKVLESLDALRKKRDAQQDEVVEIEKLIAEAYSAIDKAIKTGAVHRNT  185
            NK+ KS ++T M+K L +++    K +   +   E++  I+EAYS IDKA+K G +H N 
Sbjct  32   NKTYKSAVKTLMKKYLSAVEV--HKANPTPESQQEVQARISEAYSKIDKAVKRGILHPNN  89

Query  186  G  188
            G
Sbjct  90   G  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600