BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN005C21

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07369.1|  unnamed protein product                                340   3e-110   Coffea canephora [robusta coffee]
emb|CBI19906.3|  unnamed protein product                                331   1e-109   Vitis vinifera
ref|XP_002271105.1|  PREDICTED: uncharacterized protein LOC100259195    334   3e-108   Vitis vinifera
ref|XP_011083457.1|  PREDICTED: uncharacterized protein LOC105165989    333   5e-108   Sesamum indicum [beniseed]
ref|XP_009772832.1|  PREDICTED: uncharacterized protein LOC104223158    325   2e-105   Nicotiana sylvestris
ref|XP_009617737.1|  PREDICTED: uncharacterized protein LOC104110025    324   5e-105   Nicotiana tomentosiformis
ref|XP_002510572.1|  zinc finger protein, putative                      324   3e-104   Ricinus communis
ref|XP_008221229.1|  PREDICTED: uncharacterized protein LOC103321220    322   9e-104   Prunus mume [ume]
ref|XP_007222458.1|  hypothetical protein PRUPE_ppa003456mg             322   1e-103   Prunus persica
ref|XP_003603777.1|  Lateral signaling target protein-like protein      320   2e-103   Medicago truncatula
ref|XP_010026072.1|  PREDICTED: uncharacterized protein LOC104416368    318   5e-103   
ref|XP_006342069.1|  PREDICTED: uncharacterized protein LOC102605585    320   5e-103   Solanum tuberosum [potatoes]
ref|XP_007017867.1|  RING/FYVE/PHD zinc finger superfamily protei...    321   5e-103   
gb|KJB58065.1|  hypothetical protein B456_009G192800                    321   5e-103   Gossypium raimondii
gb|AFK41947.1|  unknown                                                 318   1e-102   Medicago truncatula
ref|XP_002301956.2|  hypothetical protein POPTR_0002s02040g             319   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_008387917.1|  PREDICTED: uncharacterized protein LOC103450...    318   3e-102   Malus domestica [apple tree]
dbj|BAJ53102.1|  JHL20J20.9                                             319   3e-102   Jatropha curcas
ref|XP_003527583.1|  PREDICTED: uncharacterized protein LOC100794840    318   3e-102   Glycine max [soybeans]
gb|KHG09859.1|  WD repeat and FYVE domain-containing 3                  319   4e-102   Gossypium arboreum [tree cotton]
gb|EPS64552.1|  hypothetical protein M569_10227                         317   7e-102   Genlisea aurea
ref|XP_011034988.1|  PREDICTED: uncharacterized protein LOC105132934    317   1e-101   Populus euphratica
ref|XP_010692504.1|  PREDICTED: uncharacterized protein LOC104905615    315   2e-101   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW58236.1|  hypothetical protein EUGRSUZ_H00938                     310   2e-101   Eucalyptus grandis [rose gum]
gb|KHN09075.1|  Early endosome antigen 1                                315   2e-101   Glycine soja [wild soybean]
ref|XP_006579027.1|  PREDICTED: uncharacterized protein LOC100779033    315   2e-101   Glycine max [soybeans]
ref|XP_004238375.1|  PREDICTED: uncharacterized protein LOC101268468    316   3e-101   Solanum lycopersicum
gb|KHN45936.1|  Early endosome antigen 1                                315   3e-101   Glycine soja [wild soybean]
gb|EYU38780.1|  hypothetical protein MIMGU_mgv1a003498mg                316   4e-101   Erythranthe guttata [common monkey flower]
ref|XP_010026065.1|  PREDICTED: uncharacterized protein LOC104416361    311   4e-101   
ref|XP_003603776.1|  Lateral signaling target protein-like protein      315   4e-101   
ref|XP_004136375.1|  PREDICTED: uncharacterized protein LOC101213650    315   6e-101   Cucumis sativus [cucumbers]
ref|XP_009334835.1|  PREDICTED: uncharacterized protein LOC103927616    315   7e-101   Pyrus x bretschneideri [bai li]
gb|KHN12631.1|  WD repeat and FYVE domain-containing protein 3          305   3e-100   Glycine soja [wild soybean]
ref|XP_004500928.1|  PREDICTED: uncharacterized protein LOC101502...    313   3e-100   Cicer arietinum [garbanzo]
ref|XP_010266000.1|  PREDICTED: uncharacterized protein LOC104603633    313   4e-100   Nelumbo nucifera [Indian lotus]
ref|XP_007136103.1|  hypothetical protein PHAVU_009G018000g             313   4e-100   Phaseolus vulgaris [French bean]
emb|CDY62935.1|  BnaA08g31140D                                          311   8e-100   Brassica napus [oilseed rape]
ref|XP_009110240.1|  PREDICTED: uncharacterized protein LOC103835809    311   8e-100   Brassica rapa
ref|XP_008387918.1|  PREDICTED: uncharacterized protein LOC103450...    312   8e-100   Malus domestica [apple tree]
ref|XP_006435220.1|  hypothetical protein CICLE_v10000707mg             312   9e-100   Citrus clementina [clementine]
gb|KDO84921.1|  hypothetical protein CISIN_1g008295mg                   311   1e-99    Citrus sinensis [apfelsine]
ref|XP_006473695.1|  PREDICTED: uncharacterized protein LOC102614...    311   1e-99    Citrus sinensis [apfelsine]
ref|XP_006601708.1|  PREDICTED: uncharacterized protein LOC100788920    304   2e-99    Glycine max [soybeans]
ref|XP_010480552.1|  PREDICTED: phosphatidylinositol 3-phosphate-...    299   3e-99    
gb|KJB29663.1|  hypothetical protein B456_005G112600                    308   9e-99    Gossypium raimondii
emb|CDY54337.1|  BnaCnng26830D                                          308   1e-98    Brassica napus [oilseed rape]
ref|NP_564103.1|  RING/FYVE/PHD zinc finger-containing protein          309   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416434.1|  hypothetical protein EUTSA_v10007122mg             309   3e-98    
ref|XP_006416433.1|  hypothetical protein EUTSA_v10007122mg             309   3e-98    Eutrema salsugineum [saltwater cress]
ref|XP_007017866.1|  RING/FYVE/PHD zinc finger superfamily protei...    308   7e-98    
ref|XP_010498443.1|  PREDICTED: uncharacterized protein LOC104776128    307   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_004291340.2|  PREDICTED: formin-like protein 16 isoform X2       308   1e-97    Fragaria vesca subsp. vesca
ref|XP_010459693.1|  PREDICTED: uncharacterized protein LOC104740711    306   3e-97    Camelina sativa [gold-of-pleasure]
ref|XP_008466469.1|  PREDICTED: lipoma-preferred partner homolog        305   3e-97    Cucumis melo [Oriental melon]
ref|XP_006435219.1|  hypothetical protein CICLE_v10000707mg             305   3e-97    Citrus clementina [clementine]
gb|KDO84922.1|  hypothetical protein CISIN_1g008295mg                   305   3e-97    Citrus sinensis [apfelsine]
ref|XP_006473696.1|  PREDICTED: uncharacterized protein LOC102614...    305   3e-97    Citrus sinensis [apfelsine]
ref|XP_010477242.1|  PREDICTED: fidgetin-like                           306   5e-97    Camelina sativa [gold-of-pleasure]
ref|XP_006307043.1|  hypothetical protein CARUB_v10008630mg             305   6e-97    Capsella rubella
ref|XP_010266837.1|  PREDICTED: uncharacterized protein LOC104604260    305   9e-97    Nelumbo nucifera [Indian lotus]
ref|XP_006840644.1|  hypothetical protein AMTR_s00084p00172980          299   9e-97    
ref|XP_010536417.1|  PREDICTED: uncharacterized protein LOC104811427    304   2e-96    Tarenaya hassleriana [spider flower]
emb|CAA61964.1|  hypothetical protein                                   296   5e-96    Phoenix dactylifera
ref|XP_008806595.1|  PREDICTED: anther-specific proline-rich prot...    303   7e-96    Phoenix dactylifera
ref|XP_004500927.1|  PREDICTED: uncharacterized protein LOC101502...    302   8e-96    
ref|XP_002890371.1|  hypothetical protein ARALYDRAFT_312939             310   1e-95    
ref|XP_002306947.2|  hypothetical protein POPTR_0005s26420g             302   1e-95    
emb|CDY44204.1|  BnaC05g15610D                                          295   1e-95    Brassica napus [oilseed rape]
ref|XP_011459098.1|  PREDICTED: formin-like protein 16 isoform X1       302   2e-95    Fragaria vesca subsp. vesca
ref|XP_011003061.1|  PREDICTED: uncharacterized protein LOC105109...    300   4e-95    Populus euphratica
ref|XP_009414441.1|  PREDICTED: uncharacterized protein LOC103995562    299   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF79901.1|AC022472_10  Contains similarity to an unknown mRNA...    307   2e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CDP01863.1|  unnamed protein product                                294   1e-93    Coffea canephora [robusta coffee]
ref|XP_010935134.1|  PREDICTED: uncharacterized protein LOC105055...    297   1e-93    
ref|XP_010935133.1|  PREDICTED: uncharacterized protein LOC105055...    297   1e-93    Elaeis guineensis
ref|XP_008811519.1|  PREDICTED: uncharacterized protein LOC103722657    296   3e-93    Phoenix dactylifera
ref|XP_010026073.1|  PREDICTED: uncharacterized protein LOC104416370    290   1e-92    Eucalyptus grandis [rose gum]
ref|XP_011003062.1|  PREDICTED: uncharacterized protein LOC105109...    294   1e-92    Populus euphratica
ref|XP_006656502.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    284   2e-92    
gb|AFW69535.1|  putative RING/FYVE/PHD zinc finger family protein       283   3e-92    
ref|XP_010533922.1|  PREDICTED: uncharacterized protein LOC104809587    291   2e-91    Tarenaya hassleriana [spider flower]
ref|XP_010229705.1|  PREDICTED: protein transport protein SEC31-like    285   1e-90    
dbj|BAD62529.1|  zinc finger protein-like                               285   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004233566.1|  PREDICTED: uncharacterized protein LOC101254660    284   4e-90    Solanum lycopersicum
ref|NP_001058609.2|  Os06g0724100                                       285   4e-90    
ref|XP_006361943.1|  PREDICTED: uncharacterized protein LOC102586445    283   1e-89    Solanum tuberosum [potatoes]
ref|XP_002437607.1|  hypothetical protein SORBIDRAFT_10g030410          284   1e-89    
ref|XP_010941331.1|  PREDICTED: uncharacterized protein LOC105059649    286   1e-89    Elaeis guineensis
ref|NP_001141076.1|  uncharacterized protein LOC100273158               283   2e-89    Zea mays [maize]
ref|XP_009779608.1|  PREDICTED: uncharacterized protein LOC104228772    281   4e-89    Nicotiana sylvestris
ref|XP_009612727.1|  PREDICTED: uncharacterized protein LOC104105988    281   1e-88    Nicotiana tomentosiformis
ref|XP_009611040.1|  PREDICTED: uncharacterized protein LOC104104610    282   1e-88    Nicotiana tomentosiformis
ref|XP_009776341.1|  PREDICTED: uncharacterized protein LOC104226144    281   2e-88    Nicotiana sylvestris
ref|NP_001060066.1|  Os07g0573300                                       273   2e-88    
ref|XP_011099882.1|  PREDICTED: uncharacterized protein LOC105178178    276   1e-86    Sesamum indicum [beniseed]
dbj|BAJ99198.1|  predicted protein                                      276   1e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006658722.1|  PREDICTED: lateral signaling target protein ...    274   3e-86    Oryza brachyantha
gb|EAZ04421.1|  hypothetical protein OsI_26566                          275   7e-86    Oryza sativa Indica Group [Indian rice]
dbj|BAC83151.1|  unknown protein                                        274   8e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010679884.1|  PREDICTED: uncharacterized protein LOC104895153    275   8e-86    Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ40379.1|  hypothetical protein OsJ_24826                          273   2e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EEC81326.1|  hypothetical protein OsI_24498                          270   2e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_002460900.1|  hypothetical protein SORBIDRAFT_02g037120          272   8e-85    Sorghum bicolor [broomcorn]
gb|KJB58066.1|  hypothetical protein B456_009G192800                    273   1e-84    Gossypium raimondii
gb|EYU30816.1|  hypothetical protein MIMGU_mgv1a004755mg                271   1e-84    Erythranthe guttata [common monkey flower]
ref|NP_001145816.1|  uncharacterized LOC100279323                       269   2e-84    Zea mays [maize]
ref|XP_008651302.1|  PREDICTED: uncharacterized LOC100279323 isof...    270   4e-84    Zea mays [maize]
ref|XP_010648990.1|  PREDICTED: uncharacterized protein LOC100241024    270   6e-84    Vitis vinifera
dbj|BAJ97354.1|  predicted protein                                      268   9e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010105285.1|  Arrestin domain-containing protein A               258   1e-83    
ref|XP_003562854.1|  PREDICTED: formin-like protein 16                  268   2e-83    Brachypodium distachyon [annual false brome]
gb|AAD10234.1|  unknown                                                 267   4e-83    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004958101.1|  PREDICTED: uncharacterized protein LOC101784792    266   9e-83    Setaria italica
ref|XP_006340768.1|  PREDICTED: uncharacterized protein LOC102600420    266   1e-82    Solanum tuberosum [potatoes]
gb|ACJ86305.1|  unknown                                                 255   2e-82    Medicago truncatula
gb|EMT02175.1|  Lateral signaling target 2-like protein                 268   2e-82    
ref|XP_008651303.1|  PREDICTED: uncharacterized LOC100279323 isof...    264   1e-81    Zea mays [maize]
gb|EMS65439.1|  Lateral signaling target protein 2-like protein         266   8e-81    Triticum urartu
ref|XP_002974610.1|  hypothetical protein SELMODRAFT_13721              239   5e-74    
ref|XP_002963320.1|  hypothetical protein SELMODRAFT_23867              238   7e-74    
gb|EMS56851.1|  Cysteine-rich receptor-like protein kinase 10           246   8e-74    Triticum urartu
gb|KCW58254.1|  hypothetical protein EUGRSUZ_H009522                    232   9e-74    Eucalyptus grandis [rose gum]
gb|ABK24454.1|  unknown                                                 243   2e-73    Picea sitchensis
gb|ACN40997.1|  unknown                                                 242   4e-73    Picea sitchensis
gb|KCW58255.1|  hypothetical protein EUGRSUZ_H009522                    228   7e-72    Eucalyptus grandis [rose gum]
emb|CAN63053.1|  hypothetical protein VITISV_027811                     234   3e-70    Vitis vinifera
gb|KJB29664.1|  hypothetical protein B456_005G112600                    229   4e-69    Gossypium raimondii
emb|CAN71844.1|  hypothetical protein VITISV_036264                     219   2e-67    Vitis vinifera
gb|KDO84923.1|  hypothetical protein CISIN_1g008295mg                   220   3e-65    Citrus sinensis [apfelsine]
ref|XP_001759236.1|  predicted protein                                  218   1e-64    
ref|XP_009419053.1|  PREDICTED: uncharacterized protein LOC103999117    211   1e-61    
ref|XP_009420231.1|  PREDICTED: pleckstrin homology domain-contai...    202   1e-61    
gb|KCW58246.1|  hypothetical protein EUGRSUZ_H009502                    194   2e-59    Eucalyptus grandis [rose gum]
ref|XP_009420265.1|  PREDICTED: uncharacterized protein ZK632.12-...    191   3e-58    
gb|KCW58247.1|  hypothetical protein EUGRSUZ_H009502                    190   1e-57    Eucalyptus grandis [rose gum]
gb|KCW58245.1|  hypothetical protein EUGRSUZ_H009502                    188   7e-57    Eucalyptus grandis [rose gum]
dbj|BAD95267.1|  hypothetical protein                                   182   9e-55    Arabidopsis thaliana [mouse-ear cress]
gb|KCW58248.1|  hypothetical protein EUGRSUZ_H009502                    157   3e-45    Eucalyptus grandis [rose gum]
emb|CDY43412.1|  BnaC07g14790D                                          152   2e-39    Brassica napus [oilseed rape]
emb|CDY29372.1|  BnaA06g14240D                                          144   5e-39    Brassica napus [oilseed rape]
ref|XP_008665773.1|  PREDICTED: uncharacterized protein LOC103644338    135   1e-35    
gb|KCW58249.1|  hypothetical protein EUGRSUZ_H009501                    123   1e-30    Eucalyptus grandis [rose gum]
tpg|DAA63256.1|  TPA: putative RING/FYVE/PHD zinc finger family p...    123   5e-30    
gb|ABR25941.1|  zinc ion binding protein                              89.4    3e-19    Oryza sativa Indica Group [Indian rice]
emb|CDY37424.1|  BnaC08g45620D                                        85.5    2e-16    Brassica napus [oilseed rape]
ref|XP_009388209.1|  PREDICTED: uncharacterized protein LOC103975025  79.7    1e-15    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002425816.1|  WD repeat and FYVE domain-containing protein...  84.3    6e-15    Pediculus humanus corporis [human body lice]
gb|EUD71470.1|  hypothetical protein YYG_03527                        79.3    2e-14    Plasmodium vinckei petteri
ref|XP_008814022.1|  hypothetical protein C922_00183                  79.3    2e-14    Plasmodium inui San Antonio 1
ref|XP_001615786.1|  hypothetical protein                             79.3    2e-14    Plasmodium vivax
ref|XP_678912.1|  hypothetical protein                                79.0    3e-14    Plasmodium berghei ANKA
ref|XP_008622149.1|  hypothetical protein YYE_00239                   78.6    4e-14    Plasmodium vinckei vinckei
ref|XP_002260270.1|  zinc finger                                      78.6    4e-14    Plasmodium knowlesi strain H
ref|XP_729753.1|  hypothetical protein                                77.8    8e-14    Plasmodium yoelii
emb|CDO67065.1|  FYVE and coiled-coil domain-containing protein, ...  77.8    1e-13    Plasmodium reichenowi
emb|CDR15529.1|  FYVE and coiled-coil domain-containing protein, ...  77.4    1e-13    
ref|XP_001348748.1|  conserved Plasmodium protein, unknown function   77.4    1e-13    Plasmodium falciparum 3D7
gb|ETW15786.1|  hypothetical protein PFFVO_05238                      77.4    1e-13    Plasmodium falciparum Vietnam Oak-Knoll (FVO)
gb|ERL88970.1|  hypothetical protein D910_06348                       75.5    2e-13    Dendroctonus ponderosae
gb|ENN80419.1|  hypothetical protein YQE_03167                        75.1    3e-13    Dendroctonus ponderosae
ref|XP_008488069.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  79.0    3e-13    
emb|CAG07794.1|  unnamed protein product                              78.2    5e-13    Tetraodon nigroviridis
ref|XP_011499895.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  77.8    7e-13    Ceratosolen solmsi marchali
ref|XP_003975214.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.4    9e-13    
ref|XP_002432980.1|  zinc finger protein FYVE domain containing p...  73.6    1e-12    Pediculus humanus corporis [human body lice]
gb|KFQ37953.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Mesitornis unicolor
ref|XP_009941202.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Opisthocomus hoazin [hoatzin]
ref|XP_010185514.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Mesitornis unicolor
ref|XP_004536074.1|  PREDICTED: RUN and FYVE domain-containing pr...  76.3    1e-12    Ceratitis capitata [medfly]
gb|EYC15306.1|  hypothetical protein Y032_0037g3445                   76.3    1e-12    Ancylostoma ceylanicum
gb|KFR17260.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Opisthocomus hoazin [hoatzin]
ref|XP_009875227.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Apaloderma vittatum
gb|KFP92514.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Apaloderma vittatum
gb|EMP30392.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Chelonia mydas [green seaturtle]
ref|XP_010574578.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Haliaeetus leucocephalus
gb|KFO06665.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Balearica regulorum gibbericeps
ref|XP_006258718.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    
gb|EOA93142.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Anas platyrhynchos [duck]
gb|KFV15204.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Tauraco erythrolophus
ref|XP_009981616.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  77.0    1e-12    Tauraco erythrolophus
ref|XP_005509144.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    
ref|XP_009967098.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Tyto alba [Schleiereule]
ref|XP_009952675.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Leptosomus discolor
ref|XP_009696848.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Cariama cristata
gb|KFQ13526.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Leptosomus discolor
gb|KFP64261.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Cariama cristata
ref|XP_005031203.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    
ref|XP_009325766.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Pygoscelis adeliae
ref|XP_010296340.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  77.0    1e-12    Balearica regulorum gibbericeps
ref|XP_008991296.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    
ref|XP_009674860.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Struthio camelus australis
ref|XP_009674858.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Struthio camelus australis
ref|XP_010574561.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Haliaeetus leucocephalus
ref|XP_009473403.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Nipponia nippon
ref|XP_009674857.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Struthio camelus australis
gb|KFQ91940.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Nipponia nippon
ref|XP_010574543.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Haliaeetus leucocephalus
ref|XP_010574514.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Haliaeetus leucocephalus
ref|XP_009674859.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Struthio camelus australis
ref|XP_005509143.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    
ref|XP_010574551.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Haliaeetus leucocephalus
ref|XP_010293434.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Phaethon lepturus
ref|XP_009889042.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Charadrius vociferus
ref|XP_009638294.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Egretta garzetta
gb|KGL97870.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Charadrius vociferus
gb|KFQ82983.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Phaethon lepturus
gb|KFP16954.1|  WD repeat and FYVE domain-containing protein 3        77.0    1e-12    Egretta garzetta
ref|XP_009278515.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Aptenodytes forsteri
ref|XP_010007250.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.0    1e-12    Chaetura pelagica
ref|XP_010574587.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Haliaeetus leucocephalus
gb|KFP39091.1|  WD repeat and FYVE domain-containing protein 3        76.6    2e-12    Chlamydotis macqueenii
ref|XP_010128334.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Chlamydotis macqueenii
ref|XP_010574569.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Haliaeetus leucocephalus
ref|XP_009557828.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  76.6    2e-12    Cuculus canorus
ref|XP_006033327.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Alligator sinensis
gb|KFV48755.1|  WD repeat and FYVE domain-containing protein 3        76.6    2e-12    Gavia stellata
ref|XP_006084635.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
gb|ELK16397.1|  WD repeat and FYVE domain-containing protein 3        76.6    2e-12    Pteropus alecto
ref|XP_005440950.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_005233645.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
gb|KIH53069.1|  FYVE zinc finger                                      75.5    2e-12    Ancylostoma duodenale
ref|XP_007496021.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_006867793.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Chrysochloris asiatica
ref|XP_005874170.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_007065709.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Chelonia mydas [green seaturtle]
ref|XP_006110939.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_005874172.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_006084634.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_006084633.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_006110940.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_007496019.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_005146631.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Melopsittacus undulatus
gb|ELK26525.1|  WD repeat and FYVE domain-containing protein 3        76.6    2e-12    Myotis davidii
ref|XP_010964486.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Camelus bactrianus [camel]
ref|XP_006110942.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006110941.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_006867792.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Chrysochloris asiatica
ref|XP_006084632.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_009819889.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Gavia stellata
ref|XP_006768730.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Myotis davidii
ref|XP_010964484.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Camelus bactrianus [camel]
ref|XP_006110938.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005292113.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Chrysemys picta bellii
ref|XP_001962707.1|  GF15587                                          76.6    2e-12    Drosophila ananassae
ref|XP_005292112.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    
ref|XP_005292111.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.6    2e-12    Chrysemys picta bellii
ref|XP_005292109.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    Chrysemys picta bellii
gb|ETN87008.1|  FYVE zinc finger                                      73.2    2e-12    Necator americanus
ref|XP_007250553.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    
ref|XP_010143550.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-12    Buceros rhinoceros silvestris
ref|XP_010707997.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-12    Meleagris gallopavo [common turkey]
ref|XP_010875289.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    
ref|XP_002186555.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    
ref|XP_010410314.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    Corvus cornix cornix
gb|EYU25796.1|  hypothetical protein MIMGU_mgv1a000111mg              75.9    2e-12    Erythranthe guttata [common monkey flower]
gb|KEH31176.1|  FYVE zinc finger protein                              75.9    2e-12    Medicago truncatula
ref|XP_009099830.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    
ref|XP_005485365.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    
ref|XP_005044780.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    Ficedula albicollis
ref|XP_005525642.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    
ref|XP_010875288.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    
ref|XP_010875285.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    2e-12    
ref|XP_008639490.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    3e-12    
ref|XP_010875287.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    3e-12    
ref|XP_010875286.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    3e-12    
ref|XP_010875284.1|  PREDICTED: WD repeat and FYVE domain-contain...  76.3    3e-12    
ref|XP_006975468.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    Peromyscus maniculatus bairdii
ref|XP_008555387.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    Microplitis demolitor
ref|XP_006797825.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    Neolamprologus brichardi [lyretail cichlid]
emb|CDR47537.1|  CYFA0S33e00166g1_1                                   74.3    3e-12    Cyberlindnera fabianii
ref|XP_008555388.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    Microplitis demolitor
ref|XP_010741159.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_005451574.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_010875291.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_005922026.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    Haplochromis burtoni
ref|XP_009600961.1|  PREDICTED: uncharacterized protein LOC104096...  75.5    3e-12    Nicotiana tomentosiformis
ref|XP_004555726.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_004555725.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_004555724.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_004555723.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_004555722.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_005730710.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_005922024.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
ref|XP_005922022.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    3e-12    
gb|EPS70417.1|  hypothetical protein M569_04338                       75.5    4e-12    
ref|XP_005451573.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    4e-12    
ref|XP_005451572.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.9    4e-12    
ref|XP_005922023.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_005681911.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  75.5    4e-12    
ref|XP_005922021.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_006008301.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_008289546.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
gb|AAH13377.1|  WD repeat and FYVE domain containing 3                72.8    4e-12    
ref|XP_009299979.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_006626807.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  75.5    4e-12    
ref|XP_009299978.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_009299977.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_009299980.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_009299981.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_008797353.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...  75.1    4e-12    
ref|XP_005165446.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    4e-12    
ref|XP_008797351.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...  75.1    4e-12    
ref|XP_001921741.4|  PREDICTED: WD repeat and FYVE domain-contain...  75.5    5e-12    
ref|XP_009779943.1|  PREDICTED: uncharacterized protein LOC104229065  75.1    5e-12    
ref|XP_006365872.1|  PREDICTED: myosin heavy chain, non-muscle-like   75.1    5e-12    
ref|XP_011170511.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.1    5e-12    
ref|XP_010897226.1|  PREDICTED: lateral signaling target protein ...  74.7    5e-12    
ref|XP_009620335.1|  PREDICTED: uncharacterized protein LOC104112...  70.5    5e-12    
ref|XP_009620333.1|  PREDICTED: uncharacterized protein LOC104112...  70.5    6e-12    
ref|XP_002937925.2|  PREDICTED: WD repeat and FYVE domain-contain...  75.1    6e-12    
ref|XP_002038006.1|  GM18578                                          75.1    6e-12    
ref|NP_608968.2|  blue cheese                                         75.1    6e-12    
ref|XP_002089165.1|  GE25712                                          75.1    6e-12    
ref|XP_004911122.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.1    6e-12    
gb|KHG03568.1|  Vacuolar sorting-associated protein 27                74.7    6e-12    
ref|XP_004911121.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.1    6e-12    
gb|KFM56661.1|  WD repeat and FYVE domain-containing protein 3        74.7    6e-12    
ref|XP_011303476.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.1    6e-12    
ref|XP_007895149.1|  PREDICTED: WD repeat and FYVE domain-contain...  75.1    6e-12    
ref|XP_004337163.1|  regulator of chromosome condensation (RCC1) ...  73.9    6e-12    
ref|XP_002596038.1|  hypothetical protein BRAFLDRAFT_202950           74.7    6e-12    
ref|XP_002002700.1|  GI17530                                          74.7    7e-12    
gb|KFM78396.1|  Early endosome antigen 1                              73.2    7e-12    
ref|XP_002065369.1|  GK14704                                          74.7    7e-12    
ref|XP_008439938.1|  PREDICTED: myosin-11                             74.7    7e-12    
gb|EGI61213.1|  WD repeat and FYVE domain-containing protein 3        74.7    7e-12    
ref|XP_011061285.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    7e-12    
ref|XP_011091440.1|  PREDICTED: uncharacterized protein LOC105171883  74.3    7e-12    
ref|XP_008879163.1|  hypothetical protein H310_13437                  73.9    8e-12    
ref|XP_001968857.1|  GG25102                                          74.7    8e-12    
ref|XP_011442907.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
ref|XP_002051366.1|  GJ15404                                          74.7    8e-12    
ref|XP_008109220.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
ref|XP_011442908.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
gb|EKC43200.1|  WD repeat and FYVE domain-containing protein 3        74.7    8e-12    
ref|XP_007426843.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
ref|XP_008109219.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
ref|XP_011442906.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
ref|XP_011442909.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
ref|XP_002110459.1|  hypothetical protein TRIADDRAFT_54491            74.3    8e-12    
gb|EZA48323.1|  WD repeat and FYVE domain-containing protein          74.7    8e-12    
ref|XP_008109218.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
ref|XP_011442910.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
ref|XP_005808863.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.7    8e-12    
gb|KGN49160.1|  hypothetical protein Csa_6G516680                     74.3    9e-12    
ref|XP_006611300.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.3    9e-12    
ref|XP_008204604.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  74.3    9e-12    
ref|XP_006559479.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.3    9e-12    
ref|XP_008415967.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.3    9e-12    
ref|XP_003491008.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  74.3    9e-12    
ref|XP_008109216.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.3    9e-12    
ref|XP_007547437.1|  PREDICTED: WD repeat and FYVE domain-contain...  74.3    9e-12    
ref|XP_003399618.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  74.3    1e-11    
ref|XP_003691270.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  74.3    1e-11    
ref|XP_010150761.1|  PREDICTED: WD repeat and FYVE domain-contain...  72.8    1e-11    
emb|CCW61444.1|  unnamed protein product                              71.6    1e-11    
emb|CDO99691.1|  unnamed protein product                              73.9    1e-11    
ref|XP_009620330.1|  PREDICTED: uncharacterized protein LOC104112...  70.5    1e-11    
gb|KJB68596.1|  hypothetical protein B456_010G253600                  73.9    1e-11    
gb|KHG16272.1|  Vacuolar sorting-associated protein 27                73.9    1e-11    
ref|XP_011267868.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.9    1e-11    
ref|XP_007025900.1|  Phosphoinositide binding, putative               73.9    1e-11    
gb|KHJ85542.1|  FYVE zinc finger                                      73.2    1e-11    
ref|XP_011348272.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.9    1e-11    
ref|XP_011270193.1|  hypothetical protein CAOG_08593                  73.6    1e-11    
ref|XP_011348273.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.9    1e-11    
ref|XP_005608715.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.9    1e-11    
gb|KJB69365.1|  hypothetical protein B456_011G019500                  73.6    1e-11    
ref|XP_005092555.1|  PREDICTED: RUN and FYVE domain-containing pr...  73.2    1e-11    
gb|EFN60314.1|  WD repeat and FYVE domain-containing protein 3        73.9    1e-11    
ref|XP_005092554.1|  PREDICTED: RUN and FYVE domain-containing pr...  73.2    1e-11    
gb|KDO19961.1|  hypothetical protein SPRG_13066                       73.6    1e-11    
ref|XP_010105402.1|  Vacuolar protein sorting-associated protein 27   73.6    1e-11    
gb|KDP33967.1|  hypothetical protein JCGZ_07538                       73.6    1e-11    
ref|XP_009410319.1|  PREDICTED: uncharacterized protein LOC103992372  73.6    1e-11    
gb|KFV05105.1|  WD repeat and FYVE domain-containing protein 3        73.6    2e-11    
ref|XP_001988151.1|  GH11010                                          73.6    2e-11    
dbj|BAE01533.1|  unnamed protein product                              72.4    2e-11    
ref|XP_420572.2|  PREDICTED: WD repeat and FYVE domain-containing...  73.6    2e-11    
ref|XP_002745698.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
gb|EMC83593.1|  WD repeat and FYVE domain-containing protein 3        73.6    2e-11    
emb|CDO97796.1|  unnamed protein product                              73.6    2e-11    
gb|AIC59787.1|  WDFY3                                                 72.0    2e-11    
ref|XP_010333061.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_008991294.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_011454705.1|  PREDICTED: RUN and FYVE domain-containing pr...  72.8    2e-11    
ref|XP_004941196.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_010333060.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_004941192.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_008991295.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
gb|KDP42226.1|  hypothetical protein JCGZ_02956                       73.2    2e-11    
ref|XP_009404097.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...  73.6    2e-11    
ref|XP_004941195.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
gb|ELT99015.1|  hypothetical protein CAPTEDRAFT_226204                73.2    2e-11    
ref|XP_007159216.1|  hypothetical protein PHAVU_002G2190001g          73.2    2e-11    
ref|XP_008991293.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_004941194.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_004941193.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_008797354.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...  73.2    2e-11    
ref|XP_009060099.1|  hypothetical protein LOTGIDRAFT_154132           73.6    2e-11    
ref|XP_004614438.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
dbj|GAM21304.1|  hypothetical protein SAMD00019534_044790             72.8    2e-11    
ref|XP_008536647.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_010202800.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004472769.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_002132224.1|  GA25322                                          73.6    2e-11    
ref|XP_010162773.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_009572174.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_006198337.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_009925771.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_006190095.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  73.6    2e-11    
ref|XP_010964483.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_011230792.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_004010159.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  73.6    2e-11    
ref|XP_004779415.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_010592393.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_011230797.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_011191890.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_004880161.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_005554945.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_004880157.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_011454706.1|  PREDICTED: RUN and FYVE domain-containing pr...  72.8    2e-11    
ref|NP_001164022.2|  WD repeat and FYVE domain-containing protein 3   73.6    2e-11    
ref|XP_010592394.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_006535287.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|NP_055806.2|  WD repeat and FYVE domain-containing protein 3      73.6    2e-11    
gb|AAN15137.1|  ALFY                                                  73.6    2e-11    
ref|XP_006535283.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_004681205.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.6    2e-11    
ref|XP_004872413.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007106918.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007997318.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_010617757.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_003898717.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  73.2    2e-11    
ref|XP_005975507.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
gb|ELR58518.1|  WD repeat and FYVE domain-containing protein 3        73.2    2e-11    
ref|XP_010617751.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
emb|CEF71447.1|  Lateral signaling target protein 2 homolog           72.8    2e-11    
ref|XP_006583790.1|  PREDICTED: myosin-3-like isoform X2              73.2    2e-11    
ref|XP_010375113.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005554948.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_008955873.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_006885317.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_011354631.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007997317.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005554946.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_001151618.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
gb|EFB19881.1|  hypothetical protein PANDA_001469                     73.2    2e-11    
ref|XP_004779413.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_010796282.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_010617756.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004880159.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_003510500.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007997311.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005554942.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_008691542.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat an...  73.2    2e-11    
ref|XP_002078286.1|  GD23368                                          72.8    2e-11    
ref|XP_004880162.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004285476.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_008063665.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004880158.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_010592392.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007649285.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005359677.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_010964485.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007997319.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_010617759.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_011280053.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_010375112.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_011470981.1|  PREDICTED: uncharacterized protein LOC101301741  73.2    2e-11    
ref|XP_009238440.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004391611.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007947022.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005892820.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004312042.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005262915.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007192196.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_002977443.1|  hypothetical protein SELMODRAFT_443583           72.8    2e-11    
gb|AAH15214.2|  WDFY3 protein                                         72.0    2e-11    
ref|XP_003773028.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_008955874.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004779416.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_006535288.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007525091.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_008572206.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_011214838.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005198726.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005639196.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_006535290.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_011280054.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007649283.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004880160.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_002717098.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004661641.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_008955868.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_007192197.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_004779417.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
ref|XP_005554947.1|  PREDICTED: WD repeat and FYVE domain-contain...  73.2    2e-11    
gb|EHH25861.1|  Autophagy-linked FYVE protein                         73.2    2e-11    



>emb|CDP07369.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+SSSYTTNTLLDTVTAAT+QFKEMGGRSRPAES K++EQP EKKK  ADW+
Sbjct  366  DIEPRRIRLQSSSYTTNTLLDTVTAATVQFKEMGGRSRPAESSKISEQPTEKKKGLADWM  425

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKPVNEEKDHW+PDEA +KCT CG DF+AF RKHHCRNCGDIFCDKCT GR+ALTAD+
Sbjct  426  AFMKPVNEEKDHWIPDEAASKCTACGTDFNAFVRKHHCRNCGDIFCDKCTHGRIALTADQ  485

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS RL+NAKEA+SR   L SHEDLAKKLQEEMERN KASSGSRSDG
Sbjct  486  NAPAVRVCDRCMVEVSHRLTNAKEASSRSTALHSHEDLAKKLQEEMERNRKASSGSRSDG  545

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             G+RMKEVACPTCTVHLQVQVPSSG
Sbjct  546  SGKRMKEVACPTCTVHLQVQVPSSG  570



>emb|CBI19906.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNT+LDTVTAAT+Q KEMGGRSRP+ES K  EQP EKKK FADW+
Sbjct  158  DIEPRRIRLQSNSYTTNTILDTVTAATVQIKEMGGRSRPSESLKTTEQPTEKKKGFADWM  217

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  218  NIIKPGNEEKDHWVPDEAVTKCTACGTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  277

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC+RC  EV++RLSNAKEAA++P LQSHEDLA+KLQEEMERN KASSGS+SDG 
Sbjct  278  SAQPVRVCDRCMAEVTQRLSNAKEAANKPALQSHEDLARKLQEEMERNRKASSGSKSDGS  337

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            G+RMKEVACP CTVHLQVQVPSSG
Sbjct  338  GKRMKEVACPICTVHLQVQVPSSG  361



>ref|XP_002271105.1| PREDICTED: uncharacterized protein LOC100259195 [Vitis vinifera]
Length=585

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNT+LDTVTAAT+Q KEMGGRSRP+ES K  EQP EKKK FADW+
Sbjct  364  DIEPRRIRLQSNSYTTNTILDTVTAATVQIKEMGGRSRPSESLKTTEQPTEKKKGFADWM  423

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  424  NIIKPGNEEKDHWVPDEAVTKCTACGTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  483

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC+RC  EV++RLSNAKEAA++P LQSHEDLA+KLQEEMERN KASSGS+SDG 
Sbjct  484  SAQPVRVCDRCMAEVTQRLSNAKEAANKPALQSHEDLARKLQEEMERNRKASSGSKSDGS  543

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            G+RMKEVACP CTVHLQVQVPSSG
Sbjct  544  GKRMKEVACPICTVHLQVQVPSSG  567



>ref|XP_011083457.1| PREDICTED: uncharacterized protein LOC105165989 [Sesamum indicum]
Length=565

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 180/205 (88%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRLKS+SYTTNTLLDTVTAA +Q+KEM GRSRP E  K AEQP EKKK   D+L
Sbjct  343  DIEPRRIRLKSNSYTTNTLLDTVTAAIVQYKEMSGRSRPPEYPKTAEQPTEKKKGLGDFL  402

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAVTKCT CG DFSAF RKHHCRNCGDIFCDKCTQGR ALTADE
Sbjct  403  NLIKPVNEEKDHWVPDEAVTKCTACGTDFSAFVRKHHCRNCGDIFCDKCTQGRTALTADE  462

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAPVVRVC+RC  EVSRRLS AK+AASR  V+QSHEDLAKKLQEEMER+ K SSGSRSD 
Sbjct  463  NAPVVRVCDRCLAEVSRRLSAAKDAASRSTVIQSHEDLAKKLQEEMERSCKVSSGSRSDS  522

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  523  SGRRMKEVACPTCTVHLQVQVPSSG  547



>ref|XP_009772832.1| PREDICTED: uncharacterized protein LOC104223158 [Nicotiana sylvestris]
Length=520

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 174/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTT+TLLDTVTAATIQFKE+GGR RP+ES K++EQP EKKK   DW+
Sbjct  299  DIEPRRIRLQSNSYTTSTLLDTVTAATIQFKEIGGRIRPSESPKLSEQPTEKKKGLVDWI  358

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+ F+AF RKHHCRNCGDIFCDKCTQGR ALTADE
Sbjct  359  NIVKPVNEEKDHWVPDEAVSKCTACGSAFNAFVRKHHCRNCGDIFCDKCTQGRTALTADE  418

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            N P VRVC+RC  EVSRRLS+AKEAA+R   LQSHEDLAKKLQEEMERN +  S      
Sbjct  419  NTPAVRVCDRCMAEVSRRLSSAKEAANRSTGLQSHEDLAKKLQEEMERNRR-ESSGSRSD  477

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
               RMKEVACPTCTVHLQVQVPSSG
Sbjct  478  HSGRMKEVACPTCTVHLQVQVPSSG  502



>ref|XP_009617737.1| PREDICTED: uncharacterized protein LOC104110025 [Nicotiana tomentosiformis]
Length=529

 Score =   324 bits (831),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 175/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTT+TLLDTVTAAT+QFKE+GGR RP+ES K+AEQP+EKKK   DW+
Sbjct  308  DIEPRRIRLQSNSYTTSTLLDTVTAATVQFKEIGGRIRPSESPKVAEQPSEKKKGLVDWI  367

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+ F+AF RKHHCRNCGDIFCDKCTQGR ALTADE
Sbjct  368  NIVKPVNEEKDHWVPDEAVSKCTACGSAFNAFVRKHHCRNCGDIFCDKCTQGRTALTADE  427

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            N P VRVC+RC  EVSRRLS+AKEAA+R   LQSHEDLAKKLQEEMERN +  S      
Sbjct  428  NTPAVRVCDRCMAEVSRRLSSAKEAANRSTGLQSHEDLAKKLQEEMERNRRE-SSGSRSD  486

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
               RMKEVACPTCTVHLQVQVPSSG
Sbjct  487  RSGRMKEVACPTCTVHLQVQVPSSG  511



>ref|XP_002510572.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF52759.1| zinc finger protein, putative [Ricinus communis]
Length=603

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAAT+QFKEMGG  RP ES K  EQ AEKKK F DW+
Sbjct  381  DIEPRRIRLQSNSYTTNTLLDTVTAATVQFKEMGGSRRPTESSKTVEQAAEKKKGFVDWM  440

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP NEEKDHWVPDEAV+KC+ CG DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  441  NLMKPGNEEKDHWVPDEAVSKCSACGTDFGAFVRKHHCRNCGDIFCDKCTHGRIALTADE  500

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSN+KE +S+P  LQSHEDLA+KLQEEME+N KASSGS+SDG
Sbjct  501  NAQPVRVCDRCMAEVTQRLSNSKETSSKPAGLQSHEDLARKLQEEMEKNRKASSGSKSDG  560

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  561  SGRRMKEVACPTCTVHLQVQVPSSG  585



>ref|XP_008221229.1| PREDICTED: uncharacterized protein LOC103321220 [Prunus mume]
Length=573

 Score =   322 bits (826),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+SSSYTTNTLLDTVTAAT+Q KEMGGR +P ES K  EQ AE+KK   DW+
Sbjct  351  DIEPRRIRLQSSSYTTNTLLDTVTAATVQLKEMGGRIKPTESLKPNEQSAERKKGLTDWM  410

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  411  NIIKPGNEEKDHWVPDEAVTKCTACGTDFGAFIRKHHCRNCGDIFCDKCTHGRIALTADE  470

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RLSNAKE +S+P  LQSHEDLAKKLQEEME+N K SSGS+SDG
Sbjct  471  NAPQVRVCDRCLAEVTQRLSNAKEVSSKPAGLQSHEDLAKKLQEEMEKNRKESSGSKSDG  530

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  531  SGRRMREVACPTCTVHLQVQVPSSG  555



>ref|XP_007222458.1| hypothetical protein PRUPE_ppa003456mg [Prunus persica]
 gb|EMJ23657.1| hypothetical protein PRUPE_ppa003456mg [Prunus persica]
Length=573

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGGR +P ES K +EQ AE+KK   DW+
Sbjct  351  DIEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGRIKPTESLKPSEQSAERKKGLTDWM  410

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  411  NIIKPGNEEKDHWVPDEAVTKCTACGTDFGAFIRKHHCRNCGDIFCDKCTHGRIALTADE  470

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RLSNAKE +S+P  LQSHEDLAKKLQEEME+N K SSGS+SDG
Sbjct  471  NAPQVRVCDRCLAEVTQRLSNAKEVSSKPAGLQSHEDLAKKLQEEMEKNRKESSGSKSDG  530

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  531  SGRRMREVACPTCTVHLQVQVPSSG  555



>ref|XP_003603777.1| Lateral signaling target protein-like protein [Medicago truncatula]
 gb|AES74028.1| RING/FYVE/PHD-type zinc finger protein [Medicago truncatula]
Length=549

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 179/204 (88%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAATIQFKEMGG  RPAES K  EQPAE+KK   DW+
Sbjct  329  DIEPRRIRLQSNSYTTNTLLDTVTAATIQFKEMGGSRRPAESFKTNEQPAERKKGLGDWM  388

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  389  NIIKPANEEKDHWVPDEAVSKCTACGTDFGAFIRKHHCRNCGDIFCDKCTHGRIALTAEE  448

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EV++RLS+AKE++++P+LQSHED+A+KLQEE+ERN K  SGS+SDG 
Sbjct  449  NAQPVRVCDRCMAEVTQRLSSAKESSNKPLLQSHEDMARKLQEELERNRKT-SGSKSDGS  507

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            G+RMKEVACP CTVHLQVQVPSSG
Sbjct  508  GKRMKEVACPICTVHLQVQVPSSG  531



>ref|XP_010026072.1| PREDICTED: uncharacterized protein LOC104416368 [Eucalyptus grandis]
Length=481

 Score =   318 bits (814),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 181/205 (88%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+ YTTNTLLDTVTAAT+Q KEMGGR+RP++  K +EQPAE+KK  ADW+
Sbjct  259  DIEPRRIRLQSNRYTTNTLLDTVTAATVQLKEMGGRTRPSDPVKTSEQPAERKKGIADWM  318

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP NEEKDHWVPDEAV+KCT CG+DFSAF R+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  319  NLMKPGNEEKDHWVPDEAVSKCTACGSDFSAFIRRHHCRNCGDIFCDKCTHGRIALTAEE  378

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  E+++RLSNAKEA+S+PV  QSHEDLA+KLQE+MERN   S+GS+SDG
Sbjct  379  NAQPVRVCDRCLAEMTQRLSNAKEASSKPVGFQSHEDLARKLQEKMERNRTGSAGSQSDG  438

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACP CTVHLQVQVP+SG
Sbjct  439  SGRRMKEVACPICTVHLQVQVPTSG  463



>ref|XP_006342069.1| PREDICTED: uncharacterized protein LOC102605585 [Solanum tuberosum]
Length=563

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 172/205 (84%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTT++LLDTVTAA +QFKEMGGR R +ES K+AEQP EKKK  ADW+
Sbjct  342  DIEPRRIRLQSNSYTTSSLLDTVTAAVVQFKEMGGRIRSSESPKVAEQPTEKKKGLADWI  401

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +K VNEEKDHWVPDEAV+KCT CG+ F+AF R+HHCRNCGDIFCDKCTQGR ALTADE
Sbjct  402  NIVKTVNEEKDHWVPDEAVSKCTACGSAFNAFVRRHHCRNCGDIFCDKCTQGRTALTADE  461

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAPVVRVC+RC  EVSRRLS+AKE  +R   LQSHEDLAKKLQEEMERN K  S      
Sbjct  462  NAPVVRVCDRCTAEVSRRLSSAKETVNRSTGLQSHEDLAKKLQEEMERNRKG-SSGSRQD  520

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
               RMKEVACPTCTVHLQVQVPSSG
Sbjct  521  RSGRMKEVACPTCTVHLQVQVPSSG  545



>ref|XP_007017867.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY15092.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
Length=592

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D EPRRIRL+S+ YTTNTLLDTVTAAT+Q KEMGGRS+  ES K  EQPAEKK+ FADW+
Sbjct  370  DFEPRRIRLQSNGYTTNTLLDTVTAATVQIKEMGGRSQAPESLKTTEQPAEKKRGFADWM  429

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP  EEKDHWVPDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  430  NLMKPGMEEKDHWVPDEAVSKCTACGTDFGAFVRKHHCRNCGDIFCDKCTPGRIALTADE  489

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSNAKEAAS+P  +QSHEDLA+KLQEEME+N +++SGS+SDG
Sbjct  490  NAQPVRVCDRCMAEVTQRLSNAKEAASKPAGIQSHEDLARKLQEEMEKNRRSASGSKSDG  549

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  550  SGRRMKEVACPTCTVHLQVQVPSSG  574



>gb|KJB58065.1| hypothetical protein B456_009G192800 [Gossypium raimondii]
Length=600

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLD VTAAT+Q KEMG +SRP ES K AEQPAEKK+ FADW+
Sbjct  378  DIEPRRIRLQSNSYTTNTLLDIVTAATVQIKEMGWKSRPPESAKTAEQPAEKKRGFADWM  437

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP  EEKDHWVPDEAV+KCT C  DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  438  NIIKPGAEEKDHWVPDEAVSKCTACATDFGAFVRKHHCRNCGDIFCDKCTHGRIALTADE  497

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RL+NAKE +S+P VLQSHEDLAKKLQEEM R+ +ASSGS SDG
Sbjct  498  NAPQVRVCDRCMAEVTQRLNNAKEISSKPTVLQSHEDLAKKLQEEMGRSRRASSGSMSDG  557

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  558  SGRRMKEVACPTCTVHLQVQVPSSG  582



>gb|AFK41947.1| unknown [Medicago truncatula]
Length=549

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAATIQFKEMGG  RPAES K  EQPAE+KK   DW+
Sbjct  329  DIEPRRIRLQSNSYTTNTLLDTVTAATIQFKEMGGSRRPAESFKTNEQPAERKKGLGDWM  388

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  389  NIIKPANEEKDHWVPDEAVSKCTACGTDFGAFIRKHHCRNCGDIFCDKCTHGRIALTAEE  448

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EV++RLS+AKE++++P+L+SHED+A+KLQEE+ERN K  SGS+SDG 
Sbjct  449  NAQPVRVCDRCMAEVTQRLSSAKESSNKPLLRSHEDMARKLQEELERNRKT-SGSKSDGS  507

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            G+RMKEVACP CTVHLQVQVPSSG
Sbjct  508  GKRMKEVACPICTVHLQVQVPSSG  531



>ref|XP_002301956.2| hypothetical protein POPTR_0002s02040g [Populus trichocarpa]
 gb|EEE81229.2| hypothetical protein POPTR_0002s02040g [Populus trichocarpa]
Length=596

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DI+PRRIRL+S+SYTTNTLLDTVTAAT+QFKEMGGR RP+++ K  EQP EKKK   DW+
Sbjct  375  DIDPRRIRLQSNSYTTNTLLDTVTAATVQFKEMGGRIRPSDTSKTTEQPTEKKKGLGDWM  434

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP +EEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  435  NLIKPGSEEKDHWVPDEAVSKCTSCGTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  494

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EV++RLSNAKEAAS+P   SHEDLA+KLQEEME+N K+SSGS+SDG 
Sbjct  495  NAQPVRVCDRCMAEVTQRLSNAKEAASKPAFHSHEDLARKLQEEMEKNRKSSSGSKSDGS  554

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  555  GRRMREVACPTCTVHLQVQVPSSG  578



>ref|XP_008387917.1| PREDICTED: uncharacterized protein LOC103450359 isoform X1 [Malus 
domestica]
Length=575

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGGR +P ES + +EQ  E+KK   DW+
Sbjct  353  DVEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGRIKPTESTRPSEQSIERKKGLTDWM  412

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AFNR+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  413  NIIKPGNEEKDHWVPDEAVTKCTACGTDFGAFNRRHHCRNCGDIFCDKCTHGRIALTAEE  472

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RLSNAKEA+S+P  L SHEDLAKKLQEE+ERN K SSGS+SDG
Sbjct  473  NAPQVRVCDRCMAEVTQRLSNAKEASSKPAGLHSHEDLAKKLQEELERNRKESSGSKSDG  532

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  533  SGRRMREVACPTCTVHLQVQVPSSG  557



>dbj|BAJ53102.1| JHL20J20.9 [Jatropha curcas]
 gb|KDP36892.1| hypothetical protein JCGZ_08183 [Jatropha curcas]
Length=601

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLD VTAAT+Q KEMGG  RP ES +  EQ AEKKK  ADW+
Sbjct  379  DIEPRRIRLQSNSYTTNTLLDIVTAATVQLKEMGGSRRPPESSRTLEQAAEKKKGLADWM  438

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  439  NLIKPGNEEKDHWVPDEAVSKCTACGTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  498

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RL+NAKEAAS+PV L SHEDLA+KLQEEME+N KASSGS+SDG
Sbjct  499  NAQPVRVCDRCMAEVTQRLTNAKEAASKPVGLHSHEDLARKLQEEMEKNRKASSGSKSDG  558

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  559  SGRRMKEVACPTCTVHLQVQVPSSG  583



>ref|XP_003527583.1| PREDICTED: uncharacterized protein LOC100794840 [Glycine max]
Length=548

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLD VTAATIQFKEMGG  RPAE+ K  EQ +E+KK F DW+
Sbjct  328  DIEPRRIRLQSNSYTTNTLLDIVTAATIQFKEMGGGRRPAEAVKTNEQSSERKKGFGDWM  387

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  388  NLIKPANEEKDHWVPDEAVSKCTACGTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  447

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EV++RL++AKE++S+P LQSHEDLAKKLQEE+ERN KA SGS+SDG 
Sbjct  448  NAQPVRVCDRCMAEVTQRLTSAKESSSKPALQSHEDLAKKLQEELERNQKA-SGSKSDGS  506

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
             RRMKEVACP CTVHLQVQVPSSG
Sbjct  507  ARRMKEVACPICTVHLQVQVPSSG  530



>gb|KHG09859.1| WD repeat and FYVE domain-containing 3 [Gossypium arboreum]
Length=599

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLD VTAAT+Q KEMG +SRP ES K AEQPAEKK+ F DW+
Sbjct  377  DIEPRRIRLQSNSYTTNTLLDIVTAATVQIKEMGWKSRPPESAKAAEQPAEKKRGFVDWM  436

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP  EEKDHWVPDEAV+KCT C  DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  437  NIIKPGAEEKDHWVPDEAVSKCTACATDFGAFVRKHHCRNCGDIFCDKCTHGRIALTADE  496

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RL+NAKE AS+P VLQSHEDLA+KLQEEM R+ +ASSGS SDG
Sbjct  497  NAPQVRVCDRCMAEVTQRLNNAKEIASKPTVLQSHEDLARKLQEEMGRSRRASSGSMSDG  556

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  557  SGRRMKEVACPTCTVHLQVQVPSSG  581



>gb|EPS64552.1| hypothetical protein M569_10227 [Genlisea aurea]
Length=552

 Score =   317 bits (812),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 172/205 (84%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIE RRIRL+S+SYTT+T+LDTVTAA +QFKE+G  SR AE  K AEQP EKKK F D++
Sbjct  332  DIEERRIRLQSNSYTTSTMLDTVTAAVVQFKEIGVNSRTAERPKAAEQPQEKKKGFGDFI  391

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP+NEEKDHWVPDEAV+KCT CG DF+AFNRKHHCRNCGDIFCDKCT GR ALTA+E
Sbjct  392  NLMKPINEEKDHWVPDEAVSKCTACGTDFNAFNRKHHCRNCGDIFCDKCTHGRTALTAEE  451

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAPVVRVC+RC  EVSRRLSNAKE+ASR   +QSHEDLAKKLQEE+ERN K  S      
Sbjct  452  NAPVVRVCDRCLAEVSRRLSNAKESASRSAAIQSHEDLAKKLQEELERNCKV-SSGSRSE  510

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
              +RMKEVACPTCTVHLQVQVPSSG
Sbjct  511  TSKRMKEVACPTCTVHLQVQVPSSG  535



>ref|XP_011034988.1| PREDICTED: uncharacterized protein LOC105132934 [Populus euphratica]
Length=601

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D EPRRIRL+S+SYTTNTLLDTVTAAT+QFKEMGGR RP+++ K  EQP EKKK   DW+
Sbjct  380  DFEPRRIRLQSNSYTTNTLLDTVTAATVQFKEMGGRIRPSDTSKTTEQPTEKKKGLGDWM  439

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP +EEK+HWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  440  NLIKPGSEEKEHWVPDEAVSKCTSCGTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  499

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EV++RLSNAKEAAS+P   SHEDLA+KLQEEME+N K+SSGS+SDG 
Sbjct  500  NAQPVRVCDRCMAEVTQRLSNAKEAASKPAFHSHEDLARKLQEEMEKNRKSSSGSKSDGS  559

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  560  GRRMREVACPTCTVHLQVQVPSSG  583



>ref|XP_010692504.1| PREDICTED: uncharacterized protein LOC104905615 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 179/207 (86%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAAT+QFKEMGGR+RP+E  +  EQ AEKKK   DW+
Sbjct  319  DIEPRRIRLQSNSYTTNTLLDTVTAATVQFKEMGGRARPSEPPRALEQSAEKKKGLGDWI  378

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCTGCG DFSAFNR+HHCRNCGD+FCDKCTQGR  LT ++
Sbjct  379  NKLKPVNEEKDHWVPDEAVSKCTGCGGDFSAFNRRHHCRNCGDVFCDKCTQGRTPLTLED  438

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC   V++RLS AKEAA+RPV LQSHEDLAKKLQEEME+N + SSGS+SDG
Sbjct  439  NAQAVRVCDRCMAHVTQRLSMAKEAANRPVSLQSHEDLAKKLQEEMEKNLRISSGSKSDG  498

Query  539  fgrr--MKEVACPTCTVHLQVQVPSSG  613
             G    M+EVACPTCTVHLQVQVP+SG
Sbjct  499  SGSGRRMREVACPTCTVHLQVQVPTSG  525



>gb|KCW58236.1| hypothetical protein EUGRSUZ_H00938 [Eucalyptus grandis]
Length=386

 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+ YTTNTLLDTVTAAT+Q KE+GGRSRP++  K +EQPAE+KK  ADW+
Sbjct  164  DIEPRRIRLQSNRYTTNTLLDTVTAATVQLKEIGGRSRPSDPVKTSEQPAERKKGIADWM  223

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP NEEKDHW PDEA +K T CG DFSAF R+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  224  NLMKPGNEEKDHWFPDEAASKRTACGTDFSAFIRRHHCRNCGDIFCDKCTHGRIALTAEE  283

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSNAKEA+S+PV  +SHEDLA+KLQEEMERN K S+GS+SDG
Sbjct  284  NAQPVRVCDRCLAEVTQRLSNAKEASSKPVRFKSHEDLARKLQEEMERNHKGSAGSQSDG  343

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACP CTVHLQVQVP+SG
Sbjct  344  SGRRMKEVACPICTVHLQVQVPTSG  368



>gb|KHN09075.1| Early endosome antigen 1 [Glycine soja]
Length=548

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLD VTAATIQFKEMGG  RPAE+ K  E  +E+KK F DW+
Sbjct  328  DIEPRRIRLQSNSYTTNTLLDIVTAATIQFKEMGGGRRPAEAVKTNELSSERKKGFGDWM  387

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  388  NLIKPANEEKDHWVPDEAVSKCTACGTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  447

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EV++RL++AKE++S+P LQSHEDLAKKLQEE+ERN KA SGS+SDG 
Sbjct  448  NAQPVRVCDRCMAEVTQRLTSAKESSSKPALQSHEDLAKKLQEELERNQKA-SGSKSDGS  506

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
             RRMKEVACP CTVHLQVQVPSSG
Sbjct  507  ARRMKEVACPICTVHLQVQVPSSG  530



>ref|XP_006579027.1| PREDICTED: uncharacterized protein LOC100779033 [Glycine max]
Length=542

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLD VTAATIQFKEMGG   PAE+ K  EQP E+KK F DW+
Sbjct  322  DIEPRRIRLQSNSYTTNTLLDIVTAATIQFKEMGGSRWPAEAVKPNEQPTERKKGFGDWM  381

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  382  NLIKPANEEKDHWVPDEAVSKCTACGTDFGAFVRRHHCRNCGDIFCDKCTYGRIALTADE  441

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EVS+RL++AKE++S+P LQSHEDLA+KLQEE+ERN K  SGS+SDG 
Sbjct  442  NAQPVRVCDRCMAEVSQRLTSAKESSSKPALQSHEDLARKLQEELERNRKT-SGSKSDGS  500

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
             RRMKEVACP CTVHLQVQVPSSG
Sbjct  501  ARRMKEVACPICTVHLQVQVPSSG  524



>ref|XP_004238375.1| PREDICTED: uncharacterized protein LOC101268468 [Solanum lycopersicum]
Length=563

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 170/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTT++LLDTVTAA +QFKEMGGR   +ES K+AEQP EKKK   DW+
Sbjct  342  DIEPRRIRLQSNSYTTSSLLDTVTAAVVQFKEMGGRIMSSESPKVAEQPTEKKKGLTDWI  401

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +K VNEEKDHWVPDEAV+KCT CG+ F+AF R+HHCRNCGDIFCDKCTQGR ALTADE
Sbjct  402  NIVKTVNEEKDHWVPDEAVSKCTACGSAFNAFVRRHHCRNCGDIFCDKCTQGRTALTADE  461

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAPVVRVC+RC  EVSRRLS+AKE  +R   LQSHEDLAKKLQEEMERN K  S      
Sbjct  462  NAPVVRVCDRCTAEVSRRLSSAKETVNRSTGLQSHEDLAKKLQEEMERNRKG-SSGSRQD  520

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
               RMKEVACPTCTVHLQVQVPSSG
Sbjct  521  RSGRMKEVACPTCTVHLQVQVPSSG  545



>gb|KHN45936.1| Early endosome antigen 1 [Glycine soja]
Length=557

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLD VTAATIQFKEMGG   PAE+ K  EQP E+KK F DW+
Sbjct  337  DIEPRRIRLQSNSYTTNTLLDIVTAATIQFKEMGGSRWPAEAVKPNEQPTERKKGFGDWM  396

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  397  NLIKPANEEKDHWVPDEAVSKCTACGTDFGAFVRRHHCRNCGDIFCDKCTYGRIALTADE  456

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EVS+RL++AKE++S+P LQSHEDLA+KLQEE+ERN K  SGS+SDG 
Sbjct  457  NAQPVRVCDRCMAEVSQRLTSAKESSSKPALQSHEDLARKLQEELERNRKT-SGSKSDGS  515

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
             RRMKEVACP CTVHLQVQVPSSG
Sbjct  516  ARRMKEVACPICTVHLQVQVPSSG  539



>gb|EYU38780.1| hypothetical protein MIMGU_mgv1a003498mg [Erythranthe guttata]
Length=581

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 179/205 (87%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNT+LDTVTAA IQ+KEM G SRP+E  K+AEQP EK+K F D L
Sbjct  360  DIEPRRIRLQSNSYTTNTILDTVTAAMIQYKEMNGASRPSEYPKIAEQPTEKRKGF-DLL  418

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP+NEEKDHWVPDEA TKCT CG DF+AF RKHHCRNCGDIFCDKCT GR ALTAD+
Sbjct  419  NLIKPLNEEKDHWVPDEAATKCTACGTDFNAFVRKHHCRNCGDIFCDKCTHGRTALTADD  478

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAPVVRVC+RC  EV+RRLSNA+E  SR  V+QSHEDLAKKLQEEMER+ K SSGSRS+G
Sbjct  479  NAPVVRVCDRCLAEVTRRLSNAREVPSRSTVVQSHEDLAKKLQEEMERSCKVSSGSRSEG  538

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             G+RMKEVACPTCTVHLQVQVPSSG
Sbjct  539  SGKRMKEVACPTCTVHLQVQVPSSG  563



>ref|XP_010026065.1| PREDICTED: uncharacterized protein LOC104416361 [Eucalyptus grandis]
Length=442

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+ YTTNTLLDTVTAAT+Q KE+GGRSRP++  K +EQPAE+KK  ADW+
Sbjct  220  DIEPRRIRLQSNRYTTNTLLDTVTAATVQLKEIGGRSRPSDPVKTSEQPAERKKGIADWM  279

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP NEEKDHW PDEA +K T CG DFSAF R+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  280  NLMKPGNEEKDHWFPDEAASKRTACGTDFSAFIRRHHCRNCGDIFCDKCTHGRIALTAEE  339

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSNAKEA+S+PV  +SHEDLA+KLQEEMERN K S+GS+SDG
Sbjct  340  NAQPVRVCDRCLAEVTQRLSNAKEASSKPVRFKSHEDLARKLQEEMERNHKGSAGSQSDG  399

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACP CTVHLQVQVP+SG
Sbjct  400  SGRRMKEVACPICTVHLQVQVPTSG  424



>ref|XP_003603776.1| Lateral signaling target protein-like protein [Medicago truncatula]
Length=553

 Score =   315 bits (806),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 179/208 (86%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAATIQFKEMGG  RPAES K  EQPAE+KK   DW+
Sbjct  329  DIEPRRIRLQSNSYTTNTLLDTVTAATIQFKEMGGSRRPAESFKTNEQPAERKKGLGDWM  388

Query  182  TAMKPVNEEKDHWV----PDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVAL  349
              +KP NEEKDHWV    PDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCT GR+AL
Sbjct  389  NIIKPANEEKDHWVTIDVPDEAVSKCTACGTDFGAFIRKHHCRNCGDIFCDKCTHGRIAL  448

Query  350  TADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsr  529
            TA+ENA  VRVC+RC  EV++RLS+AKE++++P+LQSHED+A+KLQEE+ERN K  SGS+
Sbjct  449  TAEENAQPVRVCDRCMAEVTQRLSSAKESSNKPLLQSHEDMARKLQEELERNRKT-SGSK  507

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
            SDG G+RMKEVACP CTVHLQVQVPSSG
Sbjct  508  SDGSGKRMKEVACPICTVHLQVQVPSSG  535



>ref|XP_004136375.1| PREDICTED: uncharacterized protein LOC101213650 [Cucumis sativus]
 ref|XP_004164799.1| PREDICTED: uncharacterized LOC101213650 [Cucumis sativus]
 gb|KGN60049.1| Zinc finger protein [Cucumis sativus]
Length=591

 Score =   315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 179/205 (87%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DI+PRRIRL+S+ YTTNTLLDTVTAAT+QFKEMGGRSRPAES K +EQ  EKKK   DW+
Sbjct  370  DIDPRRIRLQSNKYTTNTLLDTVTAATVQFKEMGGRSRPAESFKASEQATEKKKGLVDWV  429

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AF R+HHCRNCGDIFCDKCTQGR ALTA+E
Sbjct  430  NLIKPGNEEKDHWVPDEAVTKCTACGTDFGAFVRRHHCRNCGDIFCDKCTQGRTALTAEE  489

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RL+NAK+ AS+P  L SHEDLAKKL++EMERN ++ SGS+SDG
Sbjct  490  NAPQVRVCDRCMAEVTQRLANAKDLASKPAGLHSHEDLAKKLKDEMERNRRS-SGSKSDG  548

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             G+RMKEVACPTCTVHLQVQVPSSG
Sbjct  549  SGKRMKEVACPTCTVHLQVQVPSSG  573



>ref|XP_009334835.1| PREDICTED: uncharacterized protein LOC103927616 [Pyrus x bretschneideri]
Length=575

 Score =   315 bits (807),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGGR +P ES + +EQ  E+KK   DW+
Sbjct  353  DIEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGRIKPTESIRSSEQSTERKKGLTDWM  412

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT C  DF AFNR+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  413  NIIKPGNEEKDHWVPDEAVTKCTACRTDFGAFNRRHHCRNCGDIFCDKCTHGRIALTAEE  472

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RLSNAKEA+S+P  L SHEDLAKKLQEE+ERN K SSGS+SDG
Sbjct  473  NAPQVRVCDRCMAEVTQRLSNAKEASSKPAGLHSHEDLAKKLQEELERNRKESSGSKSDG  532

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPS+G
Sbjct  533  SGRRMREVACPTCTVHLQVQVPSTG  557



>gb|KHN12631.1| WD repeat and FYVE domain-containing protein 3 [Glycine soja]
Length=327

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EP RIRL S+ YTTNTLLDTV AATIQFKEMGG  RP+ES +  EQP EKK+ F DW+
Sbjct  107  DVEPGRIRLLSNRYTTNTLLDTVNAATIQFKEMGGSRRPSESLRTNEQPTEKKRGFGDWM  166

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP +EEKDHWVPDEAV KCT CG DF AF R+HHCRNCGDIFCDKCT+GR+ALT+DE
Sbjct  167  NLIKPADEEKDHWVPDEAVLKCTACGVDFGAFLRRHHCRNCGDIFCDKCTRGRIALTSDE  226

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC+RC  EV+ RLSNAKE++S+PVLQSHEDLAKKLQ+E+ERN +  SGS+SDG 
Sbjct  227  DALQVRVCDRCMAEVTLRLSNAKESSSKPVLQSHEDLAKKLQDELERNRRI-SGSKSDGS  285

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            GRRMKEVACP CTVHLQVQVP+SG
Sbjct  286  GRRMKEVACPICTVHLQVQVPTSG  309



>ref|XP_004500928.1| PREDICTED: uncharacterized protein LOC101502880 isoform X2 [Cicer 
arietinum]
Length=572

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAA IQFKEMGG  RP ES K  EQP E+KK   DW+
Sbjct  352  DIEPRRIRLQSNSYTTNTLLDTVTAAIIQFKEMGGSRRPVESLKTNEQPTERKKGLGDWM  411

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALT DE
Sbjct  412  NMIKPANEEKDHWVPDEAVSKCTACGTDFGAFIRKHHCRNCGDIFCDKCTHGRIALTTDE  471

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EV++RLS+AKE++++P+LQSHEDLA+KLQEE+ERN + SSGS+S+G 
Sbjct  472  NAQPVRVCDRCMAEVTQRLSSAKESSNKPLLQSHEDLARKLQEELERN-RKSSGSKSEGS  530

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            GRRMKEVACP CTVHLQVQVPSSG
Sbjct  531  GRRMKEVACPICTVHLQVQVPSSG  554



>ref|XP_010266000.1| PREDICTED: uncharacterized protein LOC104603633 [Nelumbo nucifera]
Length=584

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 181/205 (88%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTT+T+LDTVTAAT+Q KEMGGRS+P+ES K++EQ  E+KK F+DW+
Sbjct  362  DIEPRRIRLQSNSYTTSTILDTVTAATVQLKEMGGRSKPSESIKLSEQSTERKKGFSDWV  421

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP NEEKDHWVPDEAVTKCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  422  NLMKPSNEEKDHWVPDEAVTKCTACGTDFGAFVRKHHCRNCGDIFCDKCTHGRIALTADE  481

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             A  VRVC+RC  EV++RLS+A+E AS+P VL SHEDLA+KLQEEM++N ++SSGSRSDG
Sbjct  482  QAQPVRVCDRCMAEVTQRLSSARETASKPAVLHSHEDLARKLQEEMDKNRRSSSGSRSDG  541

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACP CTVHLQVQVPSSG
Sbjct  542  SGRRMREVACPICTVHLQVQVPSSG  566



>ref|XP_007136103.1| hypothetical protein PHAVU_009G018000g [Phaseolus vulgaris]
 gb|ESW08097.1| hypothetical protein PHAVU_009G018000g [Phaseolus vulgaris]
Length=566

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEP RIRL+S+SYTTNTLLDTVTAATIQFKEMGG  RPAE  K  EQ  ++KK F DW+
Sbjct  346  DIEPIRIRLQSNSYTTNTLLDTVTAATIQFKEMGGSRRPAEPLKTNEQTQDRKKVFGDWM  405

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  406  NLIKPANEEKDHWVPDEAVTKCTACGTDFGAFIRKHHCRNCGDIFCDKCTHGRIALTADE  465

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EVS+RL++AKE+ S+P +QSHEDLA+KLQEE+ERN K  SGS+SDG 
Sbjct  466  NAQPVRVCDRCMAEVSQRLTSAKESLSKPAVQSHEDLARKLQEELERNRKT-SGSKSDGS  524

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
             RRMKEVACP CTVHLQVQVPSSG
Sbjct  525  ARRMKEVACPICTVHLQVQVPSSG  548



>emb|CDY62935.1| BnaA08g31140D [Brassica napus]
Length=553

 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 175/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D E +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  332  DFEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPVSAKLVEQSAEKKKGLGDWM  391

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AFNR+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  392  NKIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFNRRHHCRNCGDVFCDKCTQGRIALTAEE  451

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR + LQSHEDLA+KLQEEM+RN K+ S    +G
Sbjct  452  NAPQVRVCDRCMAEVSQRLSNAKESASRNMSLQSHEDLARKLQEEMQRNRKS-SSGSREG  510

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  511  SGRRMKEVACPTCTVHLQVQVPSSG  535



>ref|XP_009110240.1| PREDICTED: uncharacterized protein LOC103835809 [Brassica rapa]
Length=553

 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 175/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D E +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  332  DFEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPVSAKLVEQSAEKKKGLGDWM  391

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AFNR+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  392  NKIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFNRRHHCRNCGDVFCDKCTQGRIALTAEE  451

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR + LQSHEDLA+KLQEEM+RN K+ S    +G
Sbjct  452  NAPQVRVCDRCMAEVSQRLSNAKESASRNMSLQSHEDLARKLQEEMQRNRKS-SSGSREG  510

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  511  SGRRMKEVACPTCTVHLQVQVPSSG  535



>ref|XP_008387918.1| PREDICTED: uncharacterized protein LOC103450359 isoform X2 [Malus 
domestica]
Length=574

 Score =   312 bits (799),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 178/205 (87%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGGR +P ES + +EQ  E+KK   DW+
Sbjct  353  DVEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGRIKPTESTRPSEQSIERKKGLTDWM  412

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AFNR+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  413  NIIKPGNEEKDHWVPDEAVTKCTACGTDFGAFNRRHHCRNCGDIFCDKCTHGRIALTAEE  472

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RLSNAKEA+S+P  L SHEDLAKKLQ E+ERN K SSGS+SDG
Sbjct  473  NAPQVRVCDRCMAEVTQRLSNAKEASSKPAGLHSHEDLAKKLQ-ELERNRKESSGSKSDG  531

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  532  SGRRMREVACPTCTVHLQVQVPSSG  556



>ref|XP_006435220.1| hypothetical protein CICLE_v10000707mg [Citrus clementina]
 gb|ESR48460.1| hypothetical protein CICLE_v10000707mg [Citrus clementina]
Length=573

 Score =   312 bits (799),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG-RSRPAESHKMAEQPAEKKKAFADW  178
            DIEPRRIRL+S+SYT  TLLD VTAAT+Q KEMGG RSR ++S K AEQ  E+KK FADW
Sbjct  351  DIEPRRIRLQSNSYTATTLLDIVTAATVQLKEMGGGRSRSSDSLKTAEQTGEQKKGFADW  410

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  MKP NEEKDHWVPDEAV+KCT CG DFSAF RKHHCRNCGDIFCDKCT GR+ALTAD
Sbjct  411  MNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTAD  470

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             NA  VRVC+RC  EV++RLSNAKE A++P LQSHEDLA+KLQEEME+N K+SSGS+SDG
Sbjct  471  ANAQPVRVCDRCMAEVTQRLSNAKEMANKPALQSHEDLARKLQEEMEKNRKSSSGSKSDG  530

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  531  SGRRMREVACPTCTVHLQVQVPSSG  555



>gb|KDO84921.1| hypothetical protein CISIN_1g008295mg [Citrus sinensis]
Length=571

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG-RSRPAESHKMAEQPAEKKKAFADW  178
            DIEPRRIRL+S+SYT  TLLD VTAAT+Q KEMGG RSR ++S K AEQ  E+KK FADW
Sbjct  349  DIEPRRIRLQSNSYTATTLLDIVTAATVQLKEMGGGRSRSSDSLKTAEQTGEQKKGFADW  408

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  MKP NEEKDHWVPDEAV+KCT CG DFSAF RKHHCRNCGDIFCDKCT GR+ALTAD
Sbjct  409  MNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTAD  468

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             NA  VRVC+RC  EV++RLSNAKE A++P LQSHEDLA+KLQEEME+N K+SSGS+SDG
Sbjct  469  ANAQPVRVCDRCMAEVTQRLSNAKEMANKPALQSHEDLARKLQEEMEKNRKSSSGSKSDG  528

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  529  SGRRMREVACPTCTVHLQVQVPSSG  553



>ref|XP_006473695.1| PREDICTED: uncharacterized protein LOC102614530 isoform X1 [Citrus 
sinensis]
Length=571

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG-RSRPAESHKMAEQPAEKKKAFADW  178
            DIEPRRIRL+S+SYT  TLLD VTAAT+Q KEMGG RSR ++S K AEQ  E+KK FADW
Sbjct  349  DIEPRRIRLQSNSYTATTLLDIVTAATVQLKEMGGGRSRSSDSLKTAEQTGEQKKGFADW  408

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  MKP NEEKDHWVPDEAV+KCT CG DFSAF RKHHCRNCGDIFCDKCT GR+ALTAD
Sbjct  409  MNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTAD  468

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             NA  VRVC+RC  EV++RLSNAKE A++P LQSHEDLA+KLQEEME+N K+SSGS+SDG
Sbjct  469  ANAQPVRVCDRCMAEVTQRLSNAKEMANKPALQSHEDLARKLQEEMEKNRKSSSGSKSDG  528

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  529  SGRRMREVACPTCTVHLQVQVPSSG  553



>ref|XP_006601708.1| PREDICTED: uncharacterized protein LOC100788920, partial [Glycine 
max]
Length=360

 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EP RIRL S+ YTTNTLLDTV AATIQFKEMGG  RP+ES +  EQP EKK+ F DW+
Sbjct  140  DVEPGRIRLLSNRYTTNTLLDTVNAATIQFKEMGGSRRPSESLRTNEQPTEKKRGFGDWM  199

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP +EEKDHWVPDEAV KCT CG DF AF R+HHCRNCGDIFCDKCT+GR+ALT+DE
Sbjct  200  NLIKPADEEKDHWVPDEAVLKCTACGVDFGAFLRRHHCRNCGDIFCDKCTRGRIALTSDE  259

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC+RC  EV+ RLSNAKE++S+PVLQSHEDLAKKLQ+E+ERN +  SGS+SDG 
Sbjct  260  DALQVRVCDRCMAEVTLRLSNAKESSSKPVLQSHEDLAKKLQDELERNRRI-SGSKSDGS  318

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            GRRMKEVACP CTVHLQVQVP+SG
Sbjct  319  GRRMKEVACPICTVHLQVQVPTSG  342



>ref|XP_010480552.1| PREDICTED: phosphatidylinositol 3-phosphate-binding protein 2-like 
[Camelina sativa]
Length=242

 Score =   299 bits (766),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D + +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  21   DFDAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPASGKLVEQSAEKKKGLGDWM  80

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  81   NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAEE  140

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR    QSHEDLA+KLQEEMERN K+ S    +G
Sbjct  141  NAPQVRVCDRCMAEVSQRLSNAKESASRNANAQSHEDLARKLQEEMERNRKS-SSGSREG  199

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  200  SGRRMKEVACPTCTVHLQVQVPISG  224



>gb|KJB29663.1| hypothetical protein B456_005G112600 [Gossypium raimondii]
Length=545

 Score =   308 bits (790),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 174/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEP RI L+S+SYTTNTLLD VTAAT+Q KEMGGRSRP +S K  EQP+EKKK F DW+
Sbjct  324  DIEPSRIGLQSNSYTTNTLLDIVTAATVQVKEMGGRSRPPDSLKTTEQPSEKKKGFGDWM  383

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP  EEKDHWVPDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCTQGR+ALTADE
Sbjct  384  NLMKPGTEEKDHWVPDEAVSKCTACGTDFGAFVRKHHCRNCGDIFCDKCTQGRIALTADE  443

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLS AKE AS+P  LQSHEDLA+KL EEME+N +ASSGS+SDG
Sbjct  444  NAQPVRVCDRCMAEVTQRLSIAKETASKPAALQSHEDLARKL-EEMEKNCRASSGSKSDG  502

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
              RRMKEVACP CTVHLQVQVPSSG
Sbjct  503  SDRRMKEVACPICTVHLQVQVPSSG  527



>emb|CDY54337.1| BnaCnng26830D [Brassica napus]
Length=557

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 174/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D E +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  336  DFEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPVSAKLVEQSAEKKKGLGDWM  395

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKC+QGR+ALTA+E
Sbjct  396  NKIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFLRRHHCRNCGDVFCDKCSQGRIALTAEE  455

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR + LQSHEDLA+KLQEEM+RN K+ S    +G
Sbjct  456  NAPEVRVCDRCMAEVSQRLSNAKESASRNMSLQSHEDLARKLQEEMQRNRKS-SSGLREG  514

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  515  SGRRMKEVACPTCTVHLQVQVPSSG  539



>ref|NP_564103.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 gb|AAK32902.1|AF367315_1 At1g20110/T20H2_10 [Arabidopsis thaliana]
 gb|AAL16109.1|AF428277_1 At1g20110/T20H2_10 [Arabidopsis thaliana]
 gb|AAN28881.1| At1g20110/T20H2_10 [Arabidopsis thaliana]
 gb|AEE29937.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
Length=601

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIE +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  380  DIEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPTSGKLIEQTAEKKKGLGDWM  439

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA++
Sbjct  440  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAED  499

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE   R V LQSHEDLA+KLQEEMERN K+ S    +G
Sbjct  500  NAPQVRVCDRCMAEVSQRLSNAKETTGRNVSLQSHEDLARKLQEEMERNRKS-SSGLREG  558

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  559  SGRRMKEVACPTCTVHLQVQVPVSG  583



>ref|XP_006416434.1| hypothetical protein EUTSA_v10007122mg [Eutrema salsugineum]
 gb|ESQ34787.1| hypothetical protein EUTSA_v10007122mg [Eutrema salsugineum]
Length=606

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 175/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIE +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  385  DIEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPASAKLIEQSAEKKKGLGDWM  444

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  445  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFMRRHHCRNCGDVFCDKCTQGRIALTAEE  504

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR + +QSHEDLA+KLQEEME+N K+ S    +G
Sbjct  505  NAPQVRVCDRCMAEVSQRLSNAKESASRNMSVQSHEDLARKLQEEMEKNRKS-SSGSREG  563

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
            FGRRMKEVACPTCTVHLQVQVP SG
Sbjct  564  FGRRMKEVACPTCTVHLQVQVPVSG  588



>ref|XP_006416433.1| hypothetical protein EUTSA_v10007122mg [Eutrema salsugineum]
 gb|ESQ34786.1| hypothetical protein EUTSA_v10007122mg [Eutrema salsugineum]
Length=605

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 175/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIE +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  384  DIEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPASAKLIEQSAEKKKGLGDWM  443

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  444  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFMRRHHCRNCGDVFCDKCTQGRIALTAEE  503

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR + +QSHEDLA+KLQEEME+N K+ S    +G
Sbjct  504  NAPQVRVCDRCMAEVSQRLSNAKESASRNMSVQSHEDLARKLQEEMEKNRKS-SSGSREG  562

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
            FGRRMKEVACPTCTVHLQVQVP SG
Sbjct  563  FGRRMKEVACPTCTVHLQVQVPVSG  587



>ref|XP_007017866.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY15091.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
Length=612

 Score =   308 bits (789),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 179/225 (80%), Gaps = 21/225 (9%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D EPRRIRL+S+ YTTNTLLDTVTAAT+Q KEMGGRS+  ES K  EQPAEKK+ FADW+
Sbjct  370  DFEPRRIRLQSNGYTTNTLLDTVTAATVQIKEMGGRSQAPESLKTTEQPAEKKRGFADWM  429

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP  EEKDHWVPDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  430  NLMKPGMEEKDHWVPDEAVSKCTACGTDFGAFVRKHHCRNCGDIFCDKCTPGRIALTADE  489

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssg-----  523
            NA  VRVC+RC  EV++RLSNAKEAAS+P  +QSHEDLA+KLQEEME+N +++SG     
Sbjct  490  NAQPVRVCDRCMAEVTQRLSNAKEAASKPAGIQSHEDLARKLQEEMEKNRRSASGSFLFP  549

Query  524  ---------------srsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                           S+SDG GRRMKEVACPTCTVHLQVQVPSSG
Sbjct  550  ECIITMKEVTCIYICSKSDGSGRRMKEVACPTCTVHLQVQVPSSG  594



>ref|XP_010498443.1| PREDICTED: uncharacterized protein LOC104776128 [Camelina sativa]
Length=607

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 172/205 (84%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DI+ +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  386  DIDAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPASAKLVEQSAEKKKGLGDWM  445

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  446  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAEE  505

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR    QSHEDLA+KLQEEMERN K+ S    +G
Sbjct  506  NAPQVRVCDRCMAEVSQRLSNAKESASRNANAQSHEDLARKLQEEMERNRKS-SSGSREG  564

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  565  SGRRMKEVACPTCTVHLQVQVPISG  589



>ref|XP_004291340.2| PREDICTED: formin-like protein 16 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=632

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 177/205 (86%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGG +RPAES K  E  AE+KK   DW+
Sbjct  411  DIEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGSTRPAESLK-TELSAERKKGLTDWM  469

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  470  NIIKPGNEEKDHWVPDEAVSKCTACGTDFGAFIRRHHCRNCGDIFCDKCTHGRIALTAEE  529

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RLSNAK+A+S+P  L SHEDLAKKLQ EME+N + SSGS+SDG
Sbjct  530  NAPQVRVCDRCMAEVTQRLSNAKDASSKPAALHSHEDLAKKLQAEMEKNRRESSGSKSDG  589

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  590  SGRRMREVACPTCTVHLQVQVPSSG  614



>ref|XP_010459693.1| PREDICTED: uncharacterized protein LOC104740711 [Camelina sativa]
Length=611

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D + +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  390  DFDAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPASAKLVEQSAEKKKGLGDWM  449

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  450  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAEE  509

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR    QSHEDLA+KLQEEMERN K+ S    +G
Sbjct  510  NAPQVRVCDRCMAEVSQRLSNAKESASRNANAQSHEDLARKLQEEMERNRKS-SSGSREG  568

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  569  SGRRMKEVACPTCTVHLQVQVPISG  593



>ref|XP_008466469.1| PREDICTED: lipoma-preferred partner homolog [Cucumis melo]
Length=566

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 173/199 (87%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+ YTTNTLLDTVTAAT+QFKEMGGRSRPAES K +EQ  EKKK   DW+
Sbjct  369  DIEPRRIRLQSNKYTTNTLLDTVTAATVQFKEMGGRSRPAESFKASEQATEKKKGLVDWV  428

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AF R+HHCRNCGDIFCDKCTQGR ALTA+E
Sbjct  429  NLIKPGNEEKDHWVPDEAVTKCTACGTDFGAFVRRHHCRNCGDIFCDKCTQGRTALTAEE  488

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EV++RL+NAK+ AS+P  L SHEDLAKKL++EMERN ++ SGS+SDG
Sbjct  489  NAPQVRVCDRCMAEVTQRLANAKDLASKPAGLHSHEDLAKKLKDEMERNRRS-SGSKSDG  547

Query  539  fgrrMKEVACPTCTVHLQV  595
             G+RMKEVACPTCTVHLQV
Sbjct  548  SGKRMKEVACPTCTVHLQV  566



>ref|XP_006435219.1| hypothetical protein CICLE_v10000707mg [Citrus clementina]
 gb|ESR48459.1| hypothetical protein CICLE_v10000707mg [Citrus clementina]
Length=572

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 177/205 (86%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG-RSRPAESHKMAEQPAEKKKAFADW  178
            DIEPRRIRL+S+SYT  TLLD VTAAT+Q KEMGG RSR ++S K AEQ  E+KK FADW
Sbjct  351  DIEPRRIRLQSNSYTATTLLDIVTAATVQLKEMGGGRSRSSDSLKTAEQTGEQKKGFADW  410

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  MKP NEEKDHWVPDEAV+KCT CG DFSAF RKHHCRNCGDIFCDKCT GR+ALTAD
Sbjct  411  MNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTAD  470

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             NA  VRVC+RC  EV++RLSNAKE A++P LQSHEDLA+KLQ EME+N K+SSGS+SDG
Sbjct  471  ANAQPVRVCDRCMAEVTQRLSNAKEMANKPALQSHEDLARKLQ-EMEKNRKSSSGSKSDG  529

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  530  SGRRMREVACPTCTVHLQVQVPSSG  554



>gb|KDO84922.1| hypothetical protein CISIN_1g008295mg [Citrus sinensis]
Length=570

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 177/205 (86%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG-RSRPAESHKMAEQPAEKKKAFADW  178
            DIEPRRIRL+S+SYT  TLLD VTAAT+Q KEMGG RSR ++S K AEQ  E+KK FADW
Sbjct  349  DIEPRRIRLQSNSYTATTLLDIVTAATVQLKEMGGGRSRSSDSLKTAEQTGEQKKGFADW  408

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  MKP NEEKDHWVPDEAV+KCT CG DFSAF RKHHCRNCGDIFCDKCT GR+ALTAD
Sbjct  409  MNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTAD  468

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             NA  VRVC+RC  EV++RLSNAKE A++P LQSHEDLA+KLQ EME+N K+SSGS+SDG
Sbjct  469  ANAQPVRVCDRCMAEVTQRLSNAKEMANKPALQSHEDLARKLQ-EMEKNRKSSSGSKSDG  527

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  528  SGRRMREVACPTCTVHLQVQVPSSG  552



>ref|XP_006473696.1| PREDICTED: uncharacterized protein LOC102614530 isoform X2 [Citrus 
sinensis]
Length=570

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 177/205 (86%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG-RSRPAESHKMAEQPAEKKKAFADW  178
            DIEPRRIRL+S+SYT  TLLD VTAAT+Q KEMGG RSR ++S K AEQ  E+KK FADW
Sbjct  349  DIEPRRIRLQSNSYTATTLLDIVTAATVQLKEMGGGRSRSSDSLKTAEQTGEQKKGFADW  408

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  MKP NEEKDHWVPDEAV+KCT CG DFSAF RKHHCRNCGDIFCDKCT GR+ALTAD
Sbjct  409  MNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTAD  468

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             NA  VRVC+RC  EV++RLSNAKE A++P LQSHEDLA+KLQ EME+N K+SSGS+SDG
Sbjct  469  ANAQPVRVCDRCMAEVTQRLSNAKEMANKPALQSHEDLARKLQ-EMEKNRKSSSGSKSDG  527

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  528  SGRRMREVACPTCTVHLQVQVPSSG  552



>ref|XP_010477242.1| PREDICTED: fidgetin-like [Camelina sativa]
Length=602

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D + +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  381  DFDAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPASGKLVEQSAEKKKGLGDWM  440

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  441  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAEE  500

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+ASR    QSHEDLA+KLQEEMERN K+ S    +G
Sbjct  501  NAPQVRVCDRCMAEVSQRLSNAKESASRNANAQSHEDLARKLQEEMERNRKS-SSGSREG  559

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  560  SGRRMKEVACPTCTVHLQVQVPISG  584



>ref|XP_006307043.1| hypothetical protein CARUB_v10008630mg [Capsella rubella]
 gb|EOA39941.1| hypothetical protein CARUB_v10008630mg [Capsella rubella]
Length=602

 Score =   305 bits (782),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 170/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D E +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  381  DFEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPASTKLVEQSAEKKKGLGDWM  440

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA+E
Sbjct  441  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAEE  500

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE+A R    QSHEDLA+KLQEEMERN K+ S    +G
Sbjct  501  NAPQVRVCDRCMAEVSQRLSNAKESAGRNASAQSHEDLARKLQEEMERNRKS-SSGSREG  559

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  560  SGRRMKEVACPTCTVHLQVQVPVSG  584



>ref|XP_010266837.1| PREDICTED: uncharacterized protein LOC104604260 [Nelumbo nucifera]
Length=591

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNT+LD VTAAT+Q KEMGG+S+P+E  K AEQ  EKKK F+DW+
Sbjct  369  DIEPRRIRLQSNSYTTNTILDNVTAATVQLKEMGGQSKPSEPVKFAEQSTEKKKGFSDWM  428

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT C  DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  429  NLIKPGNEEKDHWVPDEAVSKCTACRTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  488

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             A  VRVC++C  EV++RLS A+EAAS+PV L SHEDLA+KLQEEM++N + SSGS+SDG
Sbjct  489  QAQPVRVCDQCMAEVTQRLSTAREAASKPVGLHSHEDLARKLQEEMDKNRRVSSGSKSDG  548

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             G+RM+EVACPTCTVHLQVQVPSSG
Sbjct  549  SGKRMREVACPTCTVHLQVQVPSSG  573



>ref|XP_006840644.1| hypothetical protein AMTR_s00084p00172980 [Amborella trichopoda]
 gb|ERN02319.1| hypothetical protein AMTR_s00084p00172980 [Amborella trichopoda]
Length=405

 Score =   299 bits (765),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 174/213 (82%), Gaps = 9/213 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPA----ESHKMAEQPAEKKKAF  169
            DIEPRRIRL+S+SYTTNT+LDTVTAAT+Q KEMGG+        +S K+++QPAEKKK F
Sbjct  175  DIEPRRIRLQSNSYTTNTILDTVTAATVQLKEMGGKDIVGGGGKDSSKLSDQPAEKKKNF  234

Query  170  ADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVAL  349
            ADW+  MKP NEEKDHWVPDEAV+KCT CGADF AF RKHHCRNCGDIFCDKCT GR+AL
Sbjct  235  ADWMNLMKPANEEKDHWVPDEAVSKCTACGADFGAFVRKHHCRNCGDIFCDKCTHGRIAL  294

Query  350  TADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQ-SHEDLAKKLQEEMERN----SKA  514
            TADE A  VRVC+RC  EVS+RLSN KEA S+PV Q SHEDLAKKLQEE++RN    S  
Sbjct  295  TADEQAQPVRVCDRCLAEVSQRLSNTKEATSKPVGQHSHEDLAKKLQEEIDRNRTAASSG  354

Query  515  ssgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
             +   SDG  RRM+EVACPTCTVHLQVQVPSSG
Sbjct  355  HAKLSSDGSTRRMREVACPTCTVHLQVQVPSSG  387



>ref|XP_010536417.1| PREDICTED: uncharacterized protein LOC104811427 [Tarenaya hassleriana]
Length=604

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 173/207 (84%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRS-RPAESHKMAEQPAEKKKAFADW  178
            DIEPRRIRL+S+SYTTNTLLDTVTAA  Q KE+GG S RP  S K  EQ AEKKK FADW
Sbjct  380  DIEPRRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSSRPPASVKPTEQAAEKKKGFADW  439

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  +KPVNEEK+HWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCTQGR+ALTA+
Sbjct  440  MNIIKPVNEEKEHWVPDEAVSKCTSCGTDFGAFVRRHHCRNCGDIFCDKCTQGRIALTAE  499

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgs-rs  532
            ENAP VRVC+RC  EVS RLSN KEAA+R V  QSHEDLA+KLQ EME+N K+SSGS   
Sbjct  500  ENAPQVRVCDRCMAEVSERLSNTKEAANRYVGPQSHEDLARKLQGEMEKNRKSSSGSRDD  559

Query  533  dgfgrrMKEVACPTCTVHLQVQVPSSG  613
             G GRRMKEVACPTCTVHLQVQVP SG
Sbjct  560  GGSGRRMKEVACPTCTVHLQVQVPISG  586



>emb|CAA61964.1| hypothetical protein [Phoenix dactylifera]
Length=366

 Score =   296 bits (757),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 175/212 (83%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGR---SR---PAESHKMAEQPAEKKK  163
            DIEPRRIRL+S+SYTTNT+LDTVTAAT+Q KEMGG+   SR    A+  K++EQP EKKK
Sbjct  137  DIEPRRIRLQSNSYTTNTILDTVTAATVQLKEMGGKDILSRGKGTADGAKLSEQPTEKKK  196

Query  164  AFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRV  343
             FA+W+   KP NEEKDHWVPDEAV+KCT CGADF AF R+HHCR+CGDIFCDKCTQGR+
Sbjct  197  GFAEWVNLAKPDNEEKDHWVPDEAVSKCTSCGADFGAFVRRHHCRSCGDIFCDKCTQGRI  256

Query  344  ALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERN-SKAs  517
            ALTADENA  VRVC+RC  EVS RLS AKEAAS+P  L SHEDLA++LQEEME+N    S
Sbjct  257  ALTADENAQPVRVCDRCMAEVSHRLSYAKEAASKPAGLHSHEDLARRLQEEMEKNRKSPS  316

Query  518  sgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                SDG GRRM+EVACPTCTVHLQVQVP+SG
Sbjct  317  GSKSSDGSGRRMREVACPTCTVHLQVQVPASG  348



>ref|XP_008806595.1| PREDICTED: anther-specific proline-rich protein APG-like [Phoenix 
dactylifera]
Length=600

 Score =   303 bits (775),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 175/212 (83%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGR---SRP---AESHKMAEQPAEKKK  163
            DIEPRRIRL+S+SYTTNT+LDTVTAAT+Q KEMGG+   SR    A+  K++EQP EKKK
Sbjct  371  DIEPRRIRLQSNSYTTNTILDTVTAATVQLKEMGGKDILSRGKGTADGAKLSEQPTEKKK  430

Query  164  AFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRV  343
             FADWL   KP NEEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCTQGR+
Sbjct  431  GFADWLNLAKPDNEEKDHWVPDEAVSKCTSCGTDFGAFVRRHHCRNCGDIFCDKCTQGRI  490

Query  344  ALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERN-SKAs  517
            ALTADENA  VRVC+RC  EVS+RLS AKEAAS+P  L SHEDLA++LQEEME+N    S
Sbjct  491  ALTADENAQPVRVCDRCMAEVSQRLSYAKEAASKPAGLHSHEDLARRLQEEMEKNRKSPS  550

Query  518  sgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                SDG GRRM+EVACPTCTVHLQVQVP+SG
Sbjct  551  GSKSSDGSGRRMREVACPTCTVHLQVQVPASG  582



>ref|XP_004500927.1| PREDICTED: uncharacterized protein LOC101502880 isoform X1 [Cicer 
arietinum]
Length=576

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 171/200 (86%), Gaps = 1/200 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAA IQFKEMGG  RP ES K  EQP E+KK   DW+
Sbjct  352  DIEPRRIRLQSNSYTTNTLLDTVTAAIIQFKEMGGSRRPVESLKTNEQPTERKKGLGDWM  411

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCT GR+ALT DE
Sbjct  412  NMIKPANEEKDHWVPDEAVSKCTACGTDFGAFIRKHHCRNCGDIFCDKCTHGRIALTTDE  471

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            NA  VRVC+RC  EV++RLS+AKE++++P+LQSHEDLA+KLQEE+ERN + SSGS+S+G 
Sbjct  472  NAQPVRVCDRCMAEVTQRLSSAKESSNKPLLQSHEDLARKLQEELERN-RKSSGSKSEGS  530

Query  542  grrMKEVACPTCTVHLQVQV  601
            GRRMKEVACP CTVHLQV +
Sbjct  531  GRRMKEVACPICTVHLQVSI  550



>ref|XP_002890371.1| hypothetical protein ARALYDRAFT_312939 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66630.1| hypothetical protein ARALYDRAFT_312939 [Arabidopsis lyrata subsp. 
lyrata]
Length=967

 Score =   310 bits (795),  Expect = 1e-95, Method: Composition-based stats.
 Identities = 154/205 (75%), Positives = 172/205 (84%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIE RRIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  384  DIEARRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPTSGKLVEQTAEKKKGLGDWM  443

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ LTA++
Sbjct  444  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRITLTAED  503

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKEA SR V LQSHEDLA+KLQEEMERN K+ S    +G
Sbjct  504  NAPQVRVCDRCMAEVSQRLSNAKEATSRNVSLQSHEDLARKLQEEMERNRKS-SSGSREG  562

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  563  SGRRMKEVACPTCTVHLQVQVPISG  587



>ref|XP_002306947.2| hypothetical protein POPTR_0005s26420g [Populus trichocarpa]
 gb|EEE93943.2| hypothetical protein POPTR_0005s26420g [Populus trichocarpa]
Length=591

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D EPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGG +RP+++ K  EQP EKKK F D +
Sbjct  369  DFEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGGTRPSDTSKTTEQPTEKKKGFGDLM  428

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP +EEK+HWVPDEAV+KCT C  DF AF R+HHCRNCGDIFCDKCTQGR+ALTADE
Sbjct  429  NLIKPGSEEKEHWVPDEAVSKCTSCRMDFGAFVRRHHCRNCGDIFCDKCTQGRIALTADE  488

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSNAKEAAS+P    SHEDLA+KLQEEME+N K+SSGS+SD 
Sbjct  489  NAQPVRVCDRCMAEVTQRLSNAKEAASKPAAFHSHEDLARKLQEEMEKNRKSSSGSKSDV  548

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRR +EVACPTCTVHLQVQVPSSG
Sbjct  549  SGRRTREVACPTCTVHLQVQVPSSG  573



>emb|CDY44204.1| BnaC05g15610D [Brassica napus]
Length=390

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DI+ +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  169  DIDAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPTSVKLVEQSAEKKKGLGDWI  228

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEA +KCT CG+DF AF R+HHCRNCGD+FCD CTQGR+ALTADE
Sbjct  229  NIIKPVNEEKDHWVPDEAASKCTSCGSDFGAFIRRHHCRNCGDVFCDNCTQGRIALTADE  288

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VR C+RC  EVS+RLSNAKE+ASR V +QSHEDLA+KLQEEM++N K+ S    +G
Sbjct  289  NAPQVRFCDRCMAEVSQRLSNAKESASRNVSVQSHEDLARKLQEEMQKNRKS-SSGSREG  347

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMK+VACPTCTV+L+VQVP SG
Sbjct  348  SGRRMKDVACPTCTVYLEVQVPISG  372



>ref|XP_011459098.1| PREDICTED: formin-like protein 16 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=639

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 178/212 (84%), Gaps = 9/212 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGG +RPAES K  E  AE+KK   DW+
Sbjct  411  DIEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGSTRPAESLK-TELSAERKKGLTDWM  469

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAV+KCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  470  NIIKPGNEEKDHWVPDEAVSKCTACGTDFGAFIRRHHCRNCGDIFCDKCTHGRIALTAEE  529

Query  362  NAPVVRVCERC-------KNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAs  517
            NAP VRVC+RC       + EV++RLSNAK+A+S+P  L SHEDLAKKLQ EME+N + S
Sbjct  530  NAPQVRVCDRCMGTRSVHQAEVTQRLSNAKDASSKPAALHSHEDLAKKLQAEMEKNRRES  589

Query  518  sgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
            SGS+SDG GRRM+EVACPTCTVHLQVQVPSSG
Sbjct  590  SGSKSDGSGRRMREVACPTCTVHLQVQVPSSG  621



>ref|XP_011003061.1| PREDICTED: uncharacterized protein LOC105109894 isoform X1 [Populus 
euphratica]
Length=589

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 174/205 (85%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D EPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGG  RP+++ K  EQP EKKK F D +
Sbjct  367  DFEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGGIRPSDTSKTTEQPTEKKKGFGDLM  426

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP +EEK+HWVPDEAV+KCT C  DF AF R+HHCRNCGDIFCDKCTQGR+ALTADE
Sbjct  427  NLIKPGSEEKEHWVPDEAVSKCTSCRMDFGAFVRRHHCRNCGDIFCDKCTQGRIALTADE  486

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSNAKEAAS+P    SHEDLA+KLQEEME+N K+SSGS+SD 
Sbjct  487  NAQPVRVCDRCMAEVTQRLSNAKEAASKPAAFHSHEDLARKLQEEMEKNRKSSSGSKSDV  546

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRR +EVACPTCTVHLQVQVPSSG
Sbjct  547  SGRRTREVACPTCTVHLQVQVPSSG  571



>ref|XP_009414441.1| PREDICTED: uncharacterized protein LOC103995562 [Musa acuminata 
subsp. malaccensis]
Length=595

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 172/211 (82%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR------PAESHKMAEQPAEKKK  163
            D +PRRIRL+S+SYTTNT+LDTVTAAT+QFKEMGG+          ++ K+++Q  E+KK
Sbjct  368  DFDPRRIRLQSNSYTTNTILDTVTAATVQFKEMGGKDSLISGRGTVDASKLSDQSTERKK  427

Query  164  AFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRV  343
               DW+T +KP NEEKDHWVPDEAV+KCT CG+DF AFNR+HHCRNCGDIFCDKCT+GR+
Sbjct  428  GLVDWMTLIKPANEEKDHWVPDEAVSKCTSCGSDFGAFNRRHHCRNCGDIFCDKCTKGRI  487

Query  344  ALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAss  520
            ALTADE A  VRVC+RC  EV+RRLSNAKEAAS+P  LQ+HEDLA+KLQEEM++N K+  
Sbjct  488  ALTADEIAQPVRVCDRCMAEVTRRLSNAKEAASKPAGLQTHEDLARKLQEEMDKNLKS-V  546

Query  521  gsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
               +   G+ M+EVACP CTVHLQVQVP+SG
Sbjct  547  SKSTKVSGKGMREVACPICTVHLQVQVPASG  577



>gb|AAF79901.1|AC022472_10 Contains similarity to an unknown mRNA from Triticum sativum 
gb|AF004816 and contains a Lipase/Acylhydrolase with GDSL-like 
motif PF|00657 and FYVE zinc finger PF|01363 domain. ESTs 
gb|AV541158, gb|AA394699, gb|AI993442, gb|T88167, gb|BE038227, 
gb|AI993489, gb|T88521 come from this gene [Arabidopsis 
thaliana]
Length=967

 Score =   307 bits (786),  Expect = 2e-94, Method: Composition-based stats.
 Identities = 152/205 (74%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIE +RIRL+S+SYTTNTLLDTVTAA  Q KE+GG SRP  S K+ EQ AEKKK   DW+
Sbjct  380  DIEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGSSRPPTSGKLIEQTAEKKKGLGDWM  439

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV+KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA++
Sbjct  440  NIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAED  499

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+RC  EVS+RLSNAKE   R V LQSHEDLA+KLQEEMERN K+ S    +G
Sbjct  500  NAPQVRVCDRCMAEVSQRLSNAKETTGRNVSLQSHEDLARKLQEEMERNRKS-SSGLREG  558

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  559  SGRRMKEVACPTCTVHLQVQVPVSG  583



>emb|CDP01863.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 173/205 (84%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRLKS+SYTTN +LDTV AA+IQ KEMGG ++P+++ K A+QPAEKKKAF DW+
Sbjct  286  DIEPRRIRLKSNSYTTNNILDTVAAASIQVKEMGGTTKPSDAVKDADQPAEKKKAFIDWM  345

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MK  +EEKDHWVPDEAV KCT C + F+AFNRKHHCRNCGDIFCDKCTQGR+ALTADE
Sbjct  346  NLMKLGHEEKDHWVPDEAVNKCTACSSIFNAFNRKHHCRNCGDIFCDKCTQGRIALTADE  405

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSN +EAA+R    QSHE+L +KL+EEM++N K SS   SDG
Sbjct  406  NAQPVRVCDRCLAEVTQRLSNTREAAARFAGAQSHEELVRKLKEEMDKNRKTSSDVASDG  465

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
            FG R +EVACPTCTVHLQVQVP+SG
Sbjct  466  FGTRTREVACPTCTVHLQVQVPASG  490



>ref|XP_010935134.1| PREDICTED: uncharacterized protein LOC105055113 isoform X2 [Elaeis 
guineensis]
Length=599

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 171/212 (81%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR------PAESHKMAEQPAEKKK  163
            DIEPRRIRL+S+SYTT+T+LDTVTAA +Q KEMGG+         A+  K++E P EKKK
Sbjct  371  DIEPRRIRLQSNSYTTSTILDTVTAAAVQLKEMGGKDSLSRGKGTADGAKLSELPTEKKK  430

Query  164  AFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRV  343
             FADWL  MKP NEEKDHWVPDEAV KCT CG DF AF R+HHCRNCGDIFCDKCTQGR+
Sbjct  431  GFADWLNLMKPGNEEKDHWVPDEAVNKCTSCGTDFGAFVRRHHCRNCGDIFCDKCTQGRI  490

Query  344  ALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERN-SKAs  517
            ALTADENA  VRVC+RC  EVS+RLS AKEA S+P  L SHEDLA+KLQEEM++N   +S
Sbjct  491  ALTADENAQPVRVCDRCMAEVSQRLSYAKEAPSKPAGLHSHEDLARKLQEEMDKNRKSSS  550

Query  518  sgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                SDG GRRM+EVACPTCTVHLQVQVP+SG
Sbjct  551  GSKSSDGSGRRMREVACPTCTVHLQVQVPASG  582



>ref|XP_010935133.1| PREDICTED: uncharacterized protein LOC105055113 isoform X1 [Elaeis 
guineensis]
Length=600

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 171/212 (81%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR------PAESHKMAEQPAEKKK  163
            DIEPRRIRL+S+SYTT+T+LDTVTAA +Q KEMGG+         A+  K++E P EKKK
Sbjct  371  DIEPRRIRLQSNSYTTSTILDTVTAAAVQLKEMGGKDSLSRGKGTADGAKLSELPTEKKK  430

Query  164  AFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRV  343
             FADWL  MKP NEEKDHWVPDEAV KCT CG DF AF R+HHCRNCGDIFCDKCTQGR+
Sbjct  431  GFADWLNLMKPGNEEKDHWVPDEAVNKCTSCGTDFGAFVRRHHCRNCGDIFCDKCTQGRI  490

Query  344  ALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERN-SKAs  517
            ALTADENA  VRVC+RC  EVS+RLS AKEA S+P  L SHEDLA+KLQEEM++N   +S
Sbjct  491  ALTADENAQPVRVCDRCMAEVSQRLSYAKEAPSKPAGLHSHEDLARKLQEEMDKNRKSSS  550

Query  518  sgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                SDG GRRM+EVACPTCTVHLQVQVP+SG
Sbjct  551  GSKSSDGSGRRMREVACPTCTVHLQVQVPASG  582



>ref|XP_008811519.1| PREDICTED: uncharacterized protein LOC103722657 [Phoenix dactylifera]
Length=600

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 172/212 (81%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR------PAESHKMAEQPAEKKK  163
            DIEPRRIRL+S+SYTTNT+LDTVTAAT+Q KEMGG++        A+  K++EQ  EKKK
Sbjct  371  DIEPRRIRLQSNSYTTNTILDTVTAATVQIKEMGGKASLARGKGTADDAKLSEQLTEKKK  430

Query  164  AFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRV  343
               DWL  +KP NEEKDHWVPDE+V KCT CGADF AF R+HHCRNCGDIFCDKCTQGR+
Sbjct  431  GLVDWLNLIKPGNEEKDHWVPDESVRKCTSCGADFGAFVRRHHCRNCGDIFCDKCTQGRI  490

Query  344  ALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERN-SKAs  517
            ALTADENAP VRVC+RC  EVS+RLS  KEAAS+P  L SHEDLA++LQEEM++N   +S
Sbjct  491  ALTADENAPPVRVCDRCMAEVSQRLSYTKEAASKPAGLHSHEDLARQLQEEMDKNRKSSS  550

Query  518  sgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                SDG  R+M+EVACPTCTVHLQVQVP+SG
Sbjct  551  GSKSSDGSARQMREVACPTCTVHLQVQVPASG  582



>ref|XP_010026073.1| PREDICTED: uncharacterized protein LOC104416370 [Eucalyptus grandis]
Length=441

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+ YTTNTLLDTVTAAT+Q KEMGGR+RP++  K +EQPAE+KK  ADW+
Sbjct  236  DIEPRRIRLQSNRYTTNTLLDTVTAATVQLKEMGGRTRPSDPVKTSEQPAERKKGIADWM  295

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP NEEKDHWVPDEAV+KCT CG+DFSAF R+HHCRNCGDIFCDKCT GR+ALTA+E
Sbjct  296  NLMKPGNEEKDHWVPDEAVSKCTACGSDFSAFIRRHHCRNCGDIFCDKCTHGRIALTAEE  355

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSNAKEA+S+PV  QSHEDLA+KLQEEMERN K S+GS+SDG
Sbjct  356  NAQPVRVCDRCLAEVTQRLSNAKEASSKPVGFQSHEDLARKLQEEMERNRKGSAGSQSDG  415

Query  539  fgrrMKEVACP  571
             GRRM E  CP
Sbjct  416  SGRRMTESPCP  426



>ref|XP_011003062.1| PREDICTED: uncharacterized protein LOC105109894 isoform X2 [Populus 
euphratica]
Length=588

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 173/205 (84%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D EPRRIRL+S+SYTTNTLLDTVTAAT+Q KEMGG  RP+++ K  EQP EKKK F D +
Sbjct  367  DFEPRRIRLQSNSYTTNTLLDTVTAATVQLKEMGGGIRPSDTSKTTEQPTEKKKGFGDLM  426

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP +EEK+HWVPDEAV+KCT C  DF AF R+HHCRNCGDIFCDKCTQGR+ALTADE
Sbjct  427  NLIKPGSEEKEHWVPDEAVSKCTSCRMDFGAFVRRHHCRNCGDIFCDKCTQGRIALTADE  486

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NA  VRVC+RC  EV++RLSNAKEAAS+P    SHEDLA+KLQ EME+N K+SSGS+SD 
Sbjct  487  NAQPVRVCDRCMAEVTQRLSNAKEAASKPAAFHSHEDLARKLQ-EMEKNRKSSSGSKSDV  545

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRR +EVACPTCTVHLQVQVPSSG
Sbjct  546  SGRRTREVACPTCTVHLQVQVPSSG  570



>ref|XP_006656502.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Oryza brachyantha]
Length=278

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 172/210 (82%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG----RSRPA-ESHKMAEQPAEKKKA  166
            D+E RRIRLKS+SYTTNT+LDTVTAA++QFKEMGG    RSR   ++ K  EQ  +++K 
Sbjct  51   DVEARRIRLKSNSYTTNTILDTVTAASVQFKEMGGSSISRSRALPDAAKPPEQQNDRRKN  110

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F DW   MKP+NEEKDHWVPDEAVTKCT C ADFSAFNR+HHCRNCGDIFCDKCTQGR  
Sbjct  111  FLDWRNLMKPMNEEKDHWVPDEAVTKCTACTADFSAFNRRHHCRNCGDIFCDKCTQGRTP  170

Query  347  LTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgs  526
            LT D +A  VRVC+RC  EVS+RL+NAKEAA+RP++ SHEDLAKKL+E M+ N K+SS S
Sbjct  171  LTTDADAQPVRVCDRCMAEVSQRLNNAKEAANRPIVHSHEDLAKKLKEAMDINKKSSSAS  230

Query  527  rsdgfg-rrMKEVACPTCTVHLQVQVPSSG  613
            R+     RRM+EVACPTCTVHLQVQVP+SG
Sbjct  231  RASDGSGRRMREVACPTCTVHLQVQVPTSG  260



>gb|AFW69535.1| putative RING/FYVE/PHD zinc finger family protein [Zea mays]
Length=274

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 172/210 (82%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMG----GRSRP-AESHKMAEQPAEKKKA  166
            D+E +RIRLKS+SYT++T+LDTVTAAT+QFKEMG     RSR  A++ K AEQ  E+KK 
Sbjct  47   DVEGKRIRLKSNSYTSSTILDTVTAATVQFKEMGESSISRSRAIADASKPAEQQNERKKN  106

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F DW   MKP+NEEKDHWVPDEAV+KCT C ADFSAFNR+HHCRNCGDIFCDKCTQGR  
Sbjct  107  FLDWRNLMKPINEEKDHWVPDEAVSKCTACAADFSAFNRRHHCRNCGDIFCDKCTQGRTP  166

Query  347  LTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAss-g  523
            LT D +A  VRVC+RC  EV++RL+NA+E A+RP++ SHEDLAKKLQE M+ N ++SS  
Sbjct  167  LTTDADAQPVRVCDRCMAEVTQRLNNAREVANRPIVHSHEDLAKKLQEAMDINKRSSSGT  226

Query  524  srsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
              SD  G+RM+EVACPTCTVHLQV+VP+SG
Sbjct  227  RSSDVSGKRMREVACPTCTVHLQVEVPASG  256



>ref|XP_010533922.1| PREDICTED: uncharacterized protein LOC104809587 [Tarenaya hassleriana]
Length=600

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEP+RIRL+ SSYT NTLLD VTAA  Q KE+G  SRP+ S K  EQ AEKKK  ADW+
Sbjct  379  DIEPKRIRLQLSSYTINTLLDIVTAAMFQAKEIGESSRPSASVKSTEQAAEKKKGLADWM  438

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAV  CT CG DF AF R+HHCRNCGDIFCDKCTQGRVALTA+E
Sbjct  439  NVIKPVNEEKDHWVPDEAVKGCTSCGTDFGAFVRRHHCRNCGDIFCDKCTQGRVALTAEE  498

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            NAP VRVC+ C  EVS+RLSNAKE +++ +  QSHEDLA+KLQEEME+N + SS    DG
Sbjct  499  NAPQVRVCDPCMAEVSQRLSNAKETSNKYIGPQSHEDLARKLQEEMEKN-RNSSSGSRDG  557

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             GRRMKEVACPTCTVHLQVQVP SG
Sbjct  558  PGRRMKEVACPTCTVHLQVQVPISG  582



>ref|XP_010229705.1| PREDICTED: protein transport protein SEC31-like [Brachypodium 
distachyon]
Length=459

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 166/210 (79%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG----RSRPAESHKMAEQPAEKKKAF  169
            D+E RRIRLKS+SYTTNT+LDTVTAAT+QFKEMGG    RS+      +  +  +K+K F
Sbjct  232  DLEARRIRLKSNSYTTNTILDTVTAATVQFKEMGGSSMSRSKAIADAAIPSEQQDKRKNF  291

Query  170  ADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVAL  349
             DW   MKP+NEEKDHWVPDEAV KCT C  DFSAFNR+HHCRNCGDIFCDKCTQGR  L
Sbjct  292  LDWRNLMKPINEEKDHWVPDEAVNKCTACAGDFSAFNRRHHCRNCGDIFCDKCTQGRTPL  351

Query  350  TADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgs-  526
            T+D ++  VRVC+RC  EVSRRL++AKEAA+RP++ SHEDLAKKLQE M+ N K+SS S 
Sbjct  352  TSDADSQPVRVCDRCMTEVSRRLNSAKEAANRPIVHSHEDLAKKLQEAMDINKKSSSASR  411

Query  527  -rsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                  G+RM+EVACP CTVHLQVQVPSSG
Sbjct  412  PSDGSSGKRMREVACPICTVHLQVQVPSSG  441



>dbj|BAD62529.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAG87563.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66375.1| hypothetical protein OsJ_22693 [Oryza sativa Japonica Group]
Length=488

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 169/211 (80%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG----RSRP-AESHKMAEQPAEKKKA  166
            D E RRIRLKS+SYTTNT+LDTVTAA++QFKEMGG    RSR  A++ K  EQ  +++K 
Sbjct  260  DFEARRIRLKSNSYTTNTILDTVTAASVQFKEMGGSSISRSRAIADAAKPPEQQNDRRKN  319

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F DW   MKP+NEEKDHWVPDEAVTKCT C ADFSAFNR+HHCRNCGDIFCDKCTQGR  
Sbjct  320  FLDWRNLMKPMNEEKDHWVPDEAVTKCTACTADFSAFNRRHHCRNCGDIFCDKCTQGRTP  379

Query  347  LTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgs  526
            LT D +A  VRVC+RC  EVS+RL+NA+EAA+RP++ SHEDLAKKL++ M+ N K+SS S
Sbjct  380  LTTDADAQPVRVCDRCMAEVSQRLNNAREAANRPIVHSHEDLAKKLKDAMDINKKSSSAS  439

Query  527  rsdgfgrr--MKEVACPTCTVHLQVQVPSSG  613
                 G    M+EVACPTCTVHLQVQVP+SG
Sbjct  440  SRSTDGSSRRMREVACPTCTVHLQVQVPTSG  470



>ref|XP_004233566.1| PREDICTED: uncharacterized protein LOC101254660 [Solanum lycopersicum]
Length=466

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EPRRIRLKS+SYT N +LDTVTAA+IQ KEMG  ++ ++S K +EQ AEKKK FAD +
Sbjct  244  DMEPRRIRLKSNSYTVNNMLDTVTAASIQVKEMGESNKSSDSIKGSEQAAEKKKGFADLM  303

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              M+P+NEEKD WVPDEAV KCT C  DFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE
Sbjct  304  KLMRPLNEEKDFWVPDEAVRKCTACATDFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  363

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            +A  VRVC+RC  EV++RLSNA EA ++   LQSHEDL +KL+E ME+  K S+G  S G
Sbjct  364  DAQPVRVCDRCMAEVTQRLSNATEATTKVAALQSHEDLTRKLKEVMEKTRKTSTGLSSQG  423

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
              + M+EV CPTCTVHLQV+VP+SG
Sbjct  424  SNKGMREVECPTCTVHLQVEVPASG  448



>ref|NP_001058609.2| Os06g0724100 [Oryza sativa Japonica Group]
 dbj|BAF20523.2| Os06g0724100, partial [Oryza sativa Japonica Group]
Length=525

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 169/211 (80%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG----RSRP-AESHKMAEQPAEKKKA  166
            D E RRIRLKS+SYTTNT+LDTVTAA++QFKEMGG    RSR  A++ K  EQ  +++K 
Sbjct  297  DFEARRIRLKSNSYTTNTILDTVTAASVQFKEMGGSSISRSRAIADAAKPPEQQNDRRKN  356

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F DW   MKP+NEEKDHWVPDEAVTKCT C ADFSAFNR+HHCRNCGDIFCDKCTQGR  
Sbjct  357  FLDWRNLMKPMNEEKDHWVPDEAVTKCTACTADFSAFNRRHHCRNCGDIFCDKCTQGRTP  416

Query  347  LTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgs  526
            LT D +A  VRVC+RC  EVS+RL+NA+EAA+RP++ SHEDLAKKL++ M+ N K+SS S
Sbjct  417  LTTDADAQPVRVCDRCMAEVSQRLNNAREAANRPIVHSHEDLAKKLKDAMDINKKSSSAS  476

Query  527  rsdgfgrr--MKEVACPTCTVHLQVQVPSSG  613
                 G    M+EVACPTCTVHLQVQVP+SG
Sbjct  477  SRSTDGSSRRMREVACPTCTVHLQVQVPTSG  507



>ref|XP_006361943.1| PREDICTED: uncharacterized protein LOC102586445 [Solanum tuberosum]
Length=467

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 164/205 (80%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EPRRIRLKS+SYT N +LDTVTAA+IQ KEMG  ++P++S K +EQ AEKKK FAD +
Sbjct  246  DMEPRRIRLKSNSYTVNNMLDTVTAASIQVKEMGESNKPSDSIKGSEQAAEKKKGFADLM  305

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              M+P+NEEKD WVPDEAV KCT C  DFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE
Sbjct  306  KLMRPLNEEKDFWVPDEAVRKCTACATDFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  365

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            +A  VRVC+RC  EV++RLSNA EA ++   LQSHEDL +KL+E M++N K  S   S  
Sbjct  366  DAQPVRVCDRCMAEVTQRLSNAMEATTKVAALQSHEDLTRKLKEVMDKNRKT-STGLSSQ  424

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
              + M+EV CPTCTVHLQV+VP SG
Sbjct  425  GSKGMREVECPTCTVHLQVEVPVSG  449



>ref|XP_002437607.1| hypothetical protein SORBIDRAFT_10g030410 [Sorghum bicolor]
 gb|EER88974.1| hypothetical protein SORBIDRAFT_10g030410 [Sorghum bicolor]
Length=503

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 173/210 (82%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG----RSRP-AESHKMAEQPAEKKKA  166
            D+E +RIRLKS+SYT+NT+LDTVTAAT+QFKEMGG    RSR  A++ K AEQ  E+KK 
Sbjct  276  DVEAKRIRLKSNSYTSNTILDTVTAATVQFKEMGGSSISRSRAIADAAKPAEQQNERKKN  335

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F DW   MKP+NEEKDHWVPDEAV+KCT C ADFSAFNR+HHCRNCGDIFCDKCTQGR  
Sbjct  336  FLDWRNLMKPMNEEKDHWVPDEAVSKCTACAADFSAFNRRHHCRNCGDIFCDKCTQGRTP  395

Query  347  LTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgs  526
            L  D +A  VRVC+RC  EV++RL+NA+E  +RP++QSHEDLAKKLQE M+ N ++SSG+
Sbjct  396  LNTDADAQPVRVCDRCMAEVTQRLNNAREVTNRPIVQSHEDLAKKLQEAMDINKRSSSGT  455

Query  527  -rsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
              SD  G+RM+EVACP CTVHLQV+VP+SG
Sbjct  456  RSSDASGKRMREVACPICTVHLQVEVPTSG  485



>ref|XP_010941331.1| PREDICTED: uncharacterized protein LOC105059649 [Elaeis guineensis]
Length=600

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 166/212 (78%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR------PAESHKMAEQPAEKKK  163
            DIEPRRIRL+S+SYTTNT+LDTVTAAT+Q KEMG R         A+   ++EQ  EKKK
Sbjct  371  DIEPRRIRLQSNSYTTNTILDTVTAATVQIKEMGARDSLVRGKGTADGANLSEQSNEKKK  430

Query  164  AFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRV  343
               DWL   KP NEEKDHWVPDEAV+KCT C  DF AF R+HHCRNCG+IFCDKCTQGR+
Sbjct  431  GLVDWLNLKKPGNEEKDHWVPDEAVSKCTSCRTDFGAFVRRHHCRNCGEIFCDKCTQGRI  490

Query  344  ALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAss  520
            ALTADENA  VRVC+RC  EVSRRLS AKE +S+P  L SHEDLA++LQEEM++N K+SS
Sbjct  491  ALTADENAQPVRVCDRCMAEVSRRLSYAKEPSSKPAGLHSHEDLARQLQEEMDKNRKSSS  550

Query  521  gsrsdgfgrr-MKEVACPTCTVHLQVQVPSSG  613
            G +S       M+EVACPTCTVHLQVQVP+SG
Sbjct  551  GLKSSDGSGSRMREVACPTCTVHLQVQVPASG  582



>ref|NP_001141076.1| uncharacterized protein LOC100273158 [Zea mays]
 ref|XP_008645090.1| PREDICTED: uncharacterized protein LOC103626461 [Zea mays]
 gb|ACF85353.1| unknown [Zea mays]
Length=500

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 174/210 (83%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMG----GRSRP-AESHKMAEQPAEKKKA  166
            D+E +RIRLKS+SYT++T+LDTVTAAT+QFKEMG     RSR  A++ K AEQ  E+KK 
Sbjct  273  DVEGKRIRLKSNSYTSSTILDTVTAATVQFKEMGESSISRSRAIADASKPAEQQNERKKN  332

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F DW   MKP+NEEKDHWVPDEAV+KCT C ADFSAFNR+HHCRNCGDIFCDKCTQGR  
Sbjct  333  FLDWRNLMKPINEEKDHWVPDEAVSKCTACAADFSAFNRRHHCRNCGDIFCDKCTQGRTP  392

Query  347  LTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgs  526
            LT D +A  VRVC+RC  EV++RL+NA+E A+RP++ SHEDLAKKLQE M+ N ++SSG+
Sbjct  393  LTTDADAQPVRVCDRCMAEVTQRLNNAREVANRPIVHSHEDLAKKLQEAMDINKRSSSGT  452

Query  527  -rsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
              SD  G+RM+EVACPTCTVHLQV+VP+SG
Sbjct  453  RSSDVSGKRMREVACPTCTVHLQVEVPASG  482



>ref|XP_009779608.1| PREDICTED: uncharacterized protein LOC104228772 [Nicotiana sylvestris]
Length=476

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EPRRIRLKS+SYT N +LDTVTAA+IQ KEMG   +P++S K +EQ AEKKK F D +
Sbjct  255  DVEPRRIRLKSNSYTVNNILDTVTAASIQIKEMGENDKPSDSIKGSEQAAEKKKGFVDLM  314

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              M+P+NEEKD WVPDEAV KCTGC  DFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE
Sbjct  315  KLMRPLNEEKDFWVPDEAVRKCTGCRTDFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  374

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            +A  VRVC+RC  EV++RLSN+KEA ++   L+SHEDL +KL+EEM +  K  S   S  
Sbjct  375  DALPVRVCDRCMAEVTQRLSNSKEAMTKVAPLRSHEDLTRKLKEEMYKKRKI-SAGLSSQ  433

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
              RRM+EV CPTCTVHLQV+VP+SG
Sbjct  434  GSRRMREVECPTCTVHLQVEVPASG  458



>ref|XP_009612727.1| PREDICTED: uncharacterized protein LOC104105988 [Nicotiana tomentosiformis]
Length=480

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EPRRIRLKS+SYT N +LDTVTAA+IQ KE+G  ++P++S K +EQ AEKKK+F D +
Sbjct  259  DVEPRRIRLKSNSYTVNNILDTVTAASIQIKEIGESNKPSDSIKGSEQAAEKKKSFVDLM  318

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              M+P+NEEKD WVPDEAV KCTGCG DFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE
Sbjct  319  KLMRPLNEEKDFWVPDEAVRKCTGCGTDFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  378

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdg  538
            +A  VRVC+RC  EV++RLSN+KEA ++   L+SHEDL +KL+EEM++  K  SG  S  
Sbjct  379  DALPVRVCDRCMAEVTQRLSNSKEAMAKVAPLRSHEDLTRKLKEEMDKKRKT-SGGLSSQ  437

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
              R M+EV CPTCTVHLQV+V +SG
Sbjct  438  GSRGMREVECPTCTVHLQVEVAASG  462



>ref|XP_009611040.1| PREDICTED: uncharacterized protein LOC104104610 [Nicotiana tomentosiformis]
Length=537

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EP+RIR+KS+SYTTN +LD VTAA+IQ KEMG  SRP++S K +E  AEKKK F DW+
Sbjct  318  DVEPKRIRVKSNSYTTNNILDAVTAASIQVKEMGESSRPSDSIKGSESAAEKKKGF-DWM  376

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              M+P+NEEKDHWVPDEAV KCT CG DF AF R+HHCRNCGDIFCDKCTQGR+ALT DE
Sbjct  377  KLMRPLNEEKDHWVPDEAVRKCTACGTDFGAFVRRHHCRNCGDIFCDKCTQGRIALTTDE  436

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC+RC  EV++RLSNAK A     L SH DLAKKLQEEM++  K  S   +   
Sbjct  437  DAQPVRVCDRCMAEVTQRLSNAKAAVRVAALPSHVDLAKKLQEEMDKKRKT-STGHTSQG  495

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
             RRM+EVACPTCTVHLQV+VP+SG
Sbjct  496  SRRMREVACPTCTVHLQVEVPASG  519



>ref|XP_009776341.1| PREDICTED: uncharacterized protein LOC104226144 [Nicotiana sylvestris]
Length=537

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D+EP+RIRLKS+SYTTN +LD VTAA+IQ KEMG  SRP++S K +E  AEKKK F DW+
Sbjct  318  DVEPKRIRLKSNSYTTNNILDAVTAASIQVKEMGESSRPSDSIKGSESAAEKKKGF-DWI  376

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              M+P+NEEKDHWVPDEAV KCT CG DF AF R+HHCRNCGDIFCDKCTQGR ALT+DE
Sbjct  377  KLMRPLNEEKDHWVPDEAVRKCTACGTDFGAFVRRHHCRNCGDIFCDKCTQGRTALTSDE  436

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC+RC  EV++RLSNAK A     L SH DLAK+LQEEM++  K  S   +   
Sbjct  437  DAQPVRVCDRCMAEVTQRLSNAKAAVRVAALPSHVDLAKRLQEEMDKKRKT-STGHTSQV  495

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
             RRM+EVACPTCTVHLQV+VP+SG
Sbjct  496  SRRMREVACPTCTVHLQVEVPASG  519



>ref|NP_001060066.1| Os07g0573300 [Oryza sativa Japonica Group]
 dbj|BAF21980.1| Os07g0573300 [Oryza sativa Japonica Group]
Length=261

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 166/208 (80%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR---PAESHKMAEQPAEKKKAFA  172
            D E +RIRLKS+SYT+NTLLDTVTAAT+QFKE+GG +R     +S K   Q  EKKK F 
Sbjct  38   DFEAKRIRLKSNSYTSNTLLDTVTAATVQFKEIGGDARGRGTVDSSKPMSQSNEKKKGF-  96

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR ALT
Sbjct  97   DWMFA-KPVDEVKDHWVPDEAAKKCYSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRTALT  155

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EVS+RLS A+EAA+R   +QSHEDLA+KL+EEMERN K+S  + 
Sbjct  156  AEDNAPLVRVCDRCMAEVSQRLSIAQEAANRSATVQSHEDLARKLKEEMERNRKSSGSAS  215

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQVQVP+SG
Sbjct  216  GGSSGTRMREVACPTCTVHLQVQVPTSG  243



>ref|XP_011099882.1| PREDICTED: uncharacterized protein LOC105178178 [Sesamum indicum]
Length=509

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 159/204 (78%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D EPRRIRLKS+SYTTN +LDTVTAA+IQ KE+G    P++  K AE   EKKK F DW 
Sbjct  290  DPEPRRIRLKSNSYTTNNILDTVTAASIQSKEIGSSINPSDLVKGAEPSVEKKKGFIDWK  349

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KPVNEEKDHWVPDEAVTKCT CG DFSAFNRKHHCRNCGDIFCDKCTQGR+ALTA+E
Sbjct  350  NLIKPVNEEKDHWVPDEAVTKCTACGTDFSAFNRKHHCRNCGDIFCDKCTQGRIALTAEE  409

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC+RC  EV++RLSN         LQSHE+LA+KLQEEM++  K   G+  +  
Sbjct  410  HAQPVRVCDRCMAEVTQRLSNKVAPGRVAGLQSHEELARKLQEEMDKKRKT--GANPEAS  467

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
            G R +EVACP CTVHLQV+VPSSG
Sbjct  468  GTRTREVACPICTVHLQVRVPSSG  491



>dbj|BAJ99198.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 167/210 (80%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG---RSRPA-ESHKMAEQPAEKKKAF  169
            D+E RRIRLKSSSYTTNT+LDTVTAA++QFKEM     RS+ A +    +EQ  EK++ F
Sbjct  285  DLEARRIRLKSSSYTTNTILDTVTAASVQFKEMASSVSRSKAAADPASPSEQQNEKRRNF  344

Query  170  ADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVAL  349
             DW   +KPV EEKDHWVPDEAV KCT C  DFSAFNR+HHCRNCGDIFCDKCTQGR  L
Sbjct  345  LDWRNLVKPVTEEKDHWVPDEAVNKCTACAGDFSAFNRRHHCRNCGDIFCDKCTQGRTPL  404

Query  350  TADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsr  529
            T+D ++  VRVC+RC  EVSRRLS+AKEAA+RPV+QSHEDLAKKLQE M+ N K+SSGSR
Sbjct  405  TSDADSQPVRVCDRCMAEVSRRLSSAKEAANRPVVQSHEDLAKKLQEAMDINKKSSSGSR  464

Query  530  sdgfgrr--MKEVACPTCTVHLQVQVPSSG  613
            S        M+EVACP CTVHLQVQVP+SG
Sbjct  465  SSDGSSGKRMREVACPICTVHLQVQVPASG  494



>ref|XP_006658722.1| PREDICTED: lateral signaling target protein 2 homolog [Oryza 
brachyantha]
Length=471

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 167/208 (80%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR---PAESHKMAEQPAEKKKAFA  172
            D EP+RIRLKS+SYT++ LLD VTAAT+QFKE+GG +R     +S K   QP EKKK F 
Sbjct  248  DFEPKRIRLKSNSYTSSNLLDIVTAATVQFKEIGGDARVRGTVDSSKPVAQPNEKKKGF-  306

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C ADF+ FNR+HHCRNCG+IFCDKC+QGR ALT
Sbjct  307  DWMFA-KPVDEVKDHWVPDEAANKCHSCAADFNPFNRRHHCRNCGEIFCDKCSQGRTALT  365

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EVS+RLS A+EAA+R   +QSHEDLA+KL++EMERN ++S  + 
Sbjct  366  AEDNAPLVRVCDRCMAEVSQRLSIAQEAANRSATVQSHEDLARKLKDEMERNRRSSGSAS  425

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQVQVPSSG
Sbjct  426  GGASGTRMREVACPTCTVHLQVQVPSSG  453



>gb|EAZ04421.1| hypothetical protein OsI_26566 [Oryza sativa Indica Group]
Length=517

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 167/208 (80%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR---PAESHKMAEQPAEKKKAFA  172
            D E +RIRLKS+SYT+NTLLDTVTAAT+QFKE+GG +R     +S K   Q  EKKK F 
Sbjct  294  DFEAKRIRLKSNSYTSNTLLDTVTAATVQFKEIGGDARGRGTVDSSKPMSQSNEKKKGF-  352

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR ALT
Sbjct  353  DWMFA-KPVDEVKDHWVPDEAAKKCYSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRTALT  411

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EVS+RLS A+EAA+R   +QSHEDLA+KL+EEMERN K+S  + 
Sbjct  412  AEDNAPLVRVCDRCMAEVSQRLSIAQEAANRSATVQSHEDLARKLKEEMERNRKSSGSAS  471

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
               +G RM+EVACPTCTVHLQVQVP+SG
Sbjct  472  GGSYGTRMREVACPTCTVHLQVQVPTSG  499



>dbj|BAC83151.1| unknown protein [Oryza sativa Japonica Group]
Length=517

 Score =   274 bits (701),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 166/208 (80%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR---PAESHKMAEQPAEKKKAFA  172
            D E +RIRLKS+SYT+NTLLDTVTAAT+QFKE+GG +R     +S K   Q  EKKK F 
Sbjct  294  DFEAKRIRLKSNSYTSNTLLDTVTAATVQFKEIGGDARGRGTVDSSKPMSQSNEKKKGF-  352

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR ALT
Sbjct  353  DWMFA-KPVDEVKDHWVPDEAAKKCYSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRTALT  411

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EVS+RLS A+EAA+R   +QSHEDLA+KL+EEMERN K+S  + 
Sbjct  412  AEDNAPLVRVCDRCMAEVSQRLSIAQEAANRSATVQSHEDLARKLKEEMERNRKSSGSAS  471

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQVQVP+SG
Sbjct  472  GGSSGTRMREVACPTCTVHLQVQVPTSG  499



>ref|XP_010679884.1| PREDICTED: uncharacterized protein LOC104895153 [Beta vulgaris 
subsp. vulgaris]
Length=541

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIE +RIRLKS+SYTTNT+LDTVTAA++Q KE+G R + + S K  EQ  EKKK   DW+
Sbjct  320  DIESKRIRLKSNSYTTNTILDTVTAASVQLKEIGER-KDSSSSKAPEQLGEKKKGLVDWM  378

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKD+WVPDEAV KCT CG +F+AF RKHHCRNCG+IFCDKCTQGR  LT DE
Sbjct  379  NLIKPPNEEKDYWVPDEAVNKCTSCGTNFNAFVRKHHCRNCGEIFCDKCTQGRTPLTTDE  438

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             AP VRVC+RC  EV++RL+NA+EA +R     SHEDLAKKL++EM RNSK+S+G +S+G
Sbjct  439  QAPPVRVCDRCVAEVTQRLANAREAVNRSGSFPSHEDLAKKLKDEMSRNSKSSAGLKSEG  498

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
               RM++VACPTCTVHLQV+VP+SG
Sbjct  499  SQERMRDVACPTCTVHLQVEVPNSG  523



>gb|EAZ40379.1| hypothetical protein OsJ_24826 [Oryza sativa Japonica Group]
Length=517

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 166/208 (80%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR---PAESHKMAEQPAEKKKAFA  172
            D E +RIRLKS+SYT+NTLLDTVTAAT+QFKE+GG +R     +S K   Q  EKKK F 
Sbjct  294  DFEAKRIRLKSNSYTSNTLLDTVTAATVQFKEIGGDARGRGTVDSSKPMSQSNEKKKGF-  352

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR ALT
Sbjct  353  DWMFA-KPVDEVKDHWVPDEAAKKCYSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRTALT  411

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EVS+RLS A+EAA+R   +QSHEDLA+KL+EEMERN K+S  + 
Sbjct  412  AEDNAPLVRVCDRCMAEVSQRLSIAQEAANRSATVQSHEDLARKLKEEMERNRKSSGSAS  471

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQVQVP+SG
Sbjct  472  GGSSGTRMREVACPTCTVHLQVQVPTSG  499



>gb|EEC81326.1| hypothetical protein OsI_24498 [Oryza sativa Indica Group]
Length=424

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 170/235 (72%), Gaps = 31/235 (13%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG----RSRP-AESHKMAEQPAEKKKA  166
            D E RRIRLKS+SYTTNT+LDTVTAA++QFKEMGG    RSR  A++ K  EQ  +++K 
Sbjct  172  DFEARRIRLKSNSYTTNTILDTVTAASVQFKEMGGSSISRSRAIADAAKPPEQQNDRRKN  231

Query  167  FADWLTAMKPVNEEKDHW------------------------VPDEAVTKCTGCGADFSA  274
            F DW   MKP+NEEKDHW                        VPDEAVTKCT C ADFSA
Sbjct  232  FLDWRNLMKPMNEEKDHWYFNKIERQKLISCDLNFVMAIMKKVPDEAVTKCTACTADFSA  291

Query  275  FNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVL  454
            FNR+HHCRNCGDIFCDKCTQGR  LT D +A  VRVC+RC  EVS+RL+NA+EAA+RP++
Sbjct  292  FNRRHHCRNCGDIFCDKCTQGRTPLTTDADAQPVRVCDRCMAEVSQRLNNAREAANRPIV  351

Query  455  QSHEDLAKKLQEEMERNSKAssgsrsdg--fgrrMKEVACPTCTVHLQVQVPSSG  613
             SHEDLAKKL++ M+ N K+SS S        RRM+EVACPTCTVHLQVQVP+SG
Sbjct  352  HSHEDLAKKLKDAMDINKKSSSASSRSTDGSSRRMREVACPTCTVHLQVQVPTSG  406



>ref|XP_002460900.1| hypothetical protein SORBIDRAFT_02g037120 [Sorghum bicolor]
 gb|EER97421.1| hypothetical protein SORBIDRAFT_02g037120 [Sorghum bicolor]
Length=534

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 167/209 (80%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRP---AESHKMAEQPAEKKKAFA  172
            D+EP+RIRLKSSSYT+NT+LDTVTAAT+QFKE+GG +R     E+ K + Q  EKKK F 
Sbjct  310  DVEPKRIRLKSSSYTSNTMLDTVTAATVQFKEIGGDARSKGAVETGKPSVQSNEKKKGF-  368

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+   KPV+E KDHWVPDE   KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  369  DWMF-TKPVDEVKDHWVPDEVAKKCHSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRIALT  427

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EV++RLS AKEAA+R   +QSHEDLA+KL+EEME+N K+S  + 
Sbjct  428  AEDNAPLVRVCDRCMAEVTQRLSIAKEAANRSATVQSHEDLARKLKEEMEKNRKSSGPAS  487

Query  530  sdgfgrr-MKEVACPTCTVHLQVQVPSSG  613
              G     M+EVACPTCTVHLQVQVP+SG
Sbjct  488  GGGSSGTRMREVACPTCTVHLQVQVPTSG  516



>gb|KJB58066.1| hypothetical protein B456_009G192800 [Gossypium raimondii]
Length=560

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNTLLD VTAAT+Q KEMG +SRP ES K AEQPAEKK+ FADW+
Sbjct  378  DIEPRRIRLQSNSYTTNTLLDIVTAATVQIKEMGWKSRPPESAKTAEQPAEKKRGFADWM  437

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP  EEKDHWVPDEAV+KCT C  DF AF RKHHCRNCGDIFCDKCT GR+ALTADE
Sbjct  438  NIIKPGAEEKDHWVPDEAVSKCTACATDFGAFVRKHHCRNCGDIFCDKCTHGRIALTADE  497

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEME  499
            NAP VRVC+RC  EV++RL+NAKE +S+P VLQSHEDLAKKLQ   E
Sbjct  498  NAPQVRVCDRCMAEVTQRLNNAKEISSKPTVLQSHEDLAKKLQRWGE  544



>gb|EYU30816.1| hypothetical protein MIMGU_mgv1a004755mg [Erythranthe guttata]
Length=511

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D EP RIRLKS+SYTTN +LDTVTAA+IQ KE+G  S  ++  K  +Q  EKKKAF DW 
Sbjct  292  DPEPARIRLKSTSYTTNNILDTVTAASIQSKEIGPSS--SDLIKGTDQSLEKKKAFIDWK  349

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP+NEEKDHWVPDEAVTKC  C +DF+AFNRKHHCRNCGDIFCDKCTQGR+ LTADE
Sbjct  350  NLIKPINEEKDHWVPDEAVTKCKACISDFNAFNRKHHCRNCGDIFCDKCTQGRITLTADE  409

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC++C  EV++RLSN         LQSHEDLAK+LQEEM++  K    + +   
Sbjct  410  DAQPVRVCDQCMAEVTQRLSNKVAPGRVAGLQSHEDLAKRLQEEMDKKRKTGVKAEASAS  469

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
              RM+EVACPTCTVHLQVQVP+SG
Sbjct  470  RTRMREVACPTCTVHLQVQVPASG  493



>ref|NP_001145816.1| uncharacterized LOC100279323 [Zea mays]
 gb|ACL52641.1| unknown [Zea mays]
 tpg|DAA63255.1| TPA: putative RING/FYVE/PHD zinc finger family protein [Zea mays]
 tpg|DAA63257.1| TPA: putative RING/FYVE/PHD zinc finger family protein [Zea mays]
Length=453

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 167/208 (80%), Gaps = 7/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG--RSRPA-ESHKMAEQPAEKKKAFA  172
            DIEP+RIRLKSSSYT+NT+LDTVTAAT+QFKE+G   RSR A E+ K   Q  EKKK F 
Sbjct  231  DIEPKRIRLKSSSYTSNTMLDTVTAATVQFKEIGADARSRGAIETGKPLVQSNEKKKGF-  289

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+   KPV+E KDHWVPDE   KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  290  DWMF-TKPVDEVKDHWVPDEVAKKCHSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRIALT  348

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EV++RLS AK+ A+R   +QSHEDLA+KL+EEME+N K+ S S 
Sbjct  349  AEDNAPLVRVCDRCMAEVTQRLSIAKDVANRSATVQSHEDLARKLKEEMEKNRKS-SASG  407

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQVQVP+SG
Sbjct  408  GGAPGTRMREVACPTCTVHLQVQVPTSG  435



>ref|XP_008651302.1| PREDICTED: uncharacterized LOC100279323 isoform X1 [Zea mays]
 gb|ACN34198.1| unknown [Zea mays]
 tpg|DAA63258.1| TPA: putative RING/FYVE/PHD zinc finger family protein [Zea mays]
Length=542

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 167/208 (80%), Gaps = 7/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG--RSRPA-ESHKMAEQPAEKKKAFA  172
            DIEP+RIRLKSSSYT+NT+LDTVTAAT+QFKE+G   RSR A E+ K   Q  EKKK F 
Sbjct  320  DIEPKRIRLKSSSYTSNTMLDTVTAATVQFKEIGADARSRGAIETGKPLVQSNEKKKGF-  378

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+   KPV+E KDHWVPDE   KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  379  DWMF-TKPVDEVKDHWVPDEVAKKCHSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRIALT  437

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EV++RLS AK+ A+R   +QSHEDLA+KL+EEME+N K+ S S 
Sbjct  438  AEDNAPLVRVCDRCMAEVTQRLSIAKDVANRSATVQSHEDLARKLKEEMEKNRKS-SASG  496

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQVQVP+SG
Sbjct  497  GGAPGTRMREVACPTCTVHLQVQVPTSG  524



>ref|XP_010648990.1| PREDICTED: uncharacterized protein LOC100241024 [Vitis vinifera]
Length=524

 Score =   270 bits (689),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPR IRL+S++YT N +LDT+TA+++Q  EM  R+  ++S K++EQ A++K+ F+DW+
Sbjct  303  DIEPRCIRLQSNNYTVNIILDTLTASSVQLNEMDARNNSSDSFKVSEQYADRKRGFSDWI  362

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MK  NEEKDHWVPDEAVT+CT C  DF  F RKHHCRNCGDIFCDKCTQGR+ALTA+E
Sbjct  363  NMMKSSNEEKDHWVPDEAVTECTACCIDFGPFVRKHHCRNCGDIFCDKCTQGRIALTAEE  422

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsrsdg  538
             A  VRVC++C  EV++RLS+  EAA R   LQSHEDLAKKLQEEM R  K SSG +SDG
Sbjct  423  GAQPVRVCDQCMAEVTQRLSSTSEAAHRISGLQSHEDLAKKLQEEMNRKCKTSSGLKSDG  482

Query  539  fgrrMKEVACPTCTVHLQVQVPSSG  613
             G +M+EVACPTCTVHLQVQVP+SG
Sbjct  483  SGMQMREVACPTCTVHLQVQVPTSG  507



>dbj|BAJ97354.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 166/208 (80%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRP---AESHKMAEQPAEKKKAFA  172
            D E +RIRLKS+SYT+NTLLDTVTAAT+QFKE+G  +R     ++ K + Q  EKKK F 
Sbjct  279  DFEAKRIRLKSNSYTSNTLLDTVTAATVQFKEIGEDARAKGTVDAGKSSLQSNEKKKGF-  337

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  338  DWMFA-KPVDEVKDHWVPDEAAKKCQSCAGDFSHFNRRHHCRNCGEIFCDKCSQGRIALT  396

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EVS+RLS A+EAA+R   +QSH DLA+KL+EE+ERN K+S  + 
Sbjct  397  AEDNAPLVRVCDRCMAEVSQRLSMAQEAANRSTTVQSHGDLARKLKEELERNRKSSGTAS  456

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQV+VP+SG
Sbjct  457  GGASGTRMREVACPTCTVHLQVEVPTSG  484



>ref|XP_010105285.1| Arrestin domain-containing protein A [Morus notabilis]
 gb|EXC04220.1| Arrestin domain-containing protein A [Morus notabilis]
Length=191

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = +2

Query  98   MGGRSRPAESHKMAEQPAEKKKAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAF  277
            MGG SRP+ES K  EQ AEKKK FADW+  +KP NEEKDHWVPDEAV+KCT CG DF AF
Sbjct  1    MGGSSRPSESFKTNEQSAEKKKGFADWMNLIKPANEEKDHWVPDEAVSKCTACGTDFGAF  60

Query  278  NRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-L  454
             RKHHCRNCGDIFCDKCT GR+ALTADENA  VRVC+RC  EV++RLSNAKEAA++P  L
Sbjct  61   LRKHHCRNCGDIFCDKCTSGRIALTADENAQPVRVCDRCMAEVTQRLSNAKEAANKPAGL  120

Query  455  QSHEDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
            QSHEDLA+KLQEEME+N K+SSGS+SDG GRRM+EVACP CTVHLQVQVPSSG
Sbjct  121  QSHEDLARKLQEEMEKNRKSSSGSKSDGSGRRMREVACPICTVHLQVQVPSSG  173



>ref|XP_003562854.1| PREDICTED: formin-like protein 16 [Brachypodium distachyon]
Length=503

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 163/208 (78%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRP---AESHKMAEQPAEKKKAFA  172
            D EP+RIRLKS+SYT+NTLLDTVTAAT+QFKE+G  +R     +  K + Q  EKKK F 
Sbjct  280  DFEPKRIRLKSNSYTSNTLLDTVTAATVQFKEIGEDARANGTLDVGKSSVQSNEKKKGF-  338

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  339  DWMFA-KPVDEVKDHWVPDEAAKKCQSCAGDFSHFNRRHHCRNCGEIFCDKCSQGRIALT  397

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsr  529
             D+NAP+VRVC+RC  EVS+RLS A+EAA R   +QSH DLA+KL+EEMERN K+S  + 
Sbjct  398  TDDNAPLVRVCDRCMAEVSQRLSMAQEAAQRSATVQSHGDLARKLKEEMERNRKSSGSAS  457

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM EVACPTCTVHLQV+VP+SG
Sbjct  458  GGASGTRMLEVACPTCTVHLQVEVPTSG  485



>gb|AAD10234.1| unknown [Triticum aestivum]
Length=502

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 165/208 (79%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRP---AESHKMAEQPAEKKKAFA  172
            D E +RIRLKS+SYT+NTLLDTVTAAT+QFKE+G  +R     ++ K + Q  EKKK F 
Sbjct  279  DFEAKRIRLKSNSYTSNTLLDTVTAATVQFKEIGEDARAKGTVDAGKSSIQSNEKKKGF-  337

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  338  DWMFA-KPVDEVKDHWVPDEAAKKCQSCAGDFSHFNRRHHCRNCGEIFCDKCSQGRIALT  396

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EVS+RLS A+EAA+R   +QSH DLA+KL+EE+ERN K+S  + 
Sbjct  397  AEDNAPLVRVCDRCMAEVSQRLSMAQEAANRSTTVQSHGDLARKLKEELERNRKSSGTAS  456

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQV+VP SG
Sbjct  457  GGASGTRMREVACPTCTVHLQVEVPISG  484



>ref|XP_004958101.1| PREDICTED: uncharacterized protein LOC101784792 [Setaria italica]
Length=517

 Score =   266 bits (681),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 163/209 (78%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRP---AESHKMAEQPAEKKKAFA  172
            DI+P+RIRLKS+SYT+NT+LDTVTAAT+QFKE+GG ++     ++     Q  EKKK F 
Sbjct  293  DIDPKRIRLKSNSYTSNTMLDTVTAATVQFKEIGGDAKSKGTVDAGNPTVQSNEKKKGF-  351

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDE   KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  352  DWMFA-KPVDEVKDHWVPDEVAKKCHSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRIALT  410

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EV++RLS AKEA SR   +QSH DLA+KL+EEMERN K+S    
Sbjct  411  AEDNAPLVRVCDRCMAEVTQRLSMAKEATSRSATVQSHGDLARKLKEEMERNRKSSGPVS  470

Query  530  sdgfgrr-MKEVACPTCTVHLQVQVPSSG  613
              G     M+EVACPTCTVHLQVQVP+SG
Sbjct  471  GGGASGTRMREVACPTCTVHLQVQVPTSG  499



>ref|XP_006340768.1| PREDICTED: uncharacterized protein LOC102600420 [Solanum tuberosum]
Length=527

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 159/204 (78%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D E +RIRL+S+SYTTN +LD VTAA+IQ KEMG  + P+++   +E  AEKKK F DW+
Sbjct  308  DNEAKRIRLRSNSYTTNNILDAVTAASIQVKEMGESNMPSDAITGSESAAEKKKGF-DWM  366

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              M+P+NEEKDHWVPDEA+ KCT CG +FSAF R+HHCRNCGDIFCDKCTQGR ALTADE
Sbjct  367  KLMRPLNEEKDHWVPDEAIRKCTACGTNFSAFVRRHHCRNCGDIFCDKCTQGRTALTADE  426

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdgf  541
            +A  VRVC+RC  EV++RLSNAK A     + SH DLAKKLQEE+++  K  S   +   
Sbjct  427  DAQPVRVCDRCMAEVTQRLSNAKAAVRVAAMPSHVDLAKKLQEELDKKRKT-STGHTSQG  485

Query  542  grrMKEVACPTCTVHLQVQVPSSG  613
             RRM+EVACPTCTVHLQV+VP+SG
Sbjct  486  SRRMREVACPTCTVHLQVEVPASG  509



>gb|ACJ86305.1| unknown [Medicago truncatula]
Length=189

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = +2

Query  98   MGGRSRPAESHKMAEQPAEKKKAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAF  277
            MGG  RPAES K  EQPAE+KK   DW+  +KP NEEKDHWVPDEAV+KCT CG DF AF
Sbjct  1    MGGSRRPAESFKTNEQPAERKKGLGDWMNIIKPANEEKDHWVPDEAVSKCTACGTDFGAF  60

Query  278  NRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQ  457
             RKHHCRNCGDIFCDKCT GR+ALTA+ENA  VRVC+RC  EV++RLS+AKE++++P+LQ
Sbjct  61   IRKHHCRNCGDIFCDKCTHGRIALTAEENAQPVRVCDRCMAEVTQRLSSAKESSNKPLLQ  120

Query  458  SHEDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
            SHED+A+KLQEE+ERN K  SGS+SDG G+RMKEVACP CTVHLQVQVPSSG
Sbjct  121  SHEDMARKLQEELERNRKT-SGSKSDGSGKRMKEVACPICTVHLQVQVPSSG  171



>gb|EMT02175.1| Lateral signaling target 2-like protein [Aegilops tauschii]
Length=597

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 162/206 (79%), Gaps = 6/206 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG---RSRPA-ESHKMAEQPAEKKKAF  169
            D+E RRIRLKSSSYTTNT+LDTVTAA++QFKEM     RS+ A +    +EQ  EK++ F
Sbjct  51   DLEARRIRLKSSSYTTNTILDTVTAASVQFKEMASSVSRSKAAADPASPSEQQNEKRRNF  110

Query  170  ADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVAL  349
             DW   +KPV EEKDHWVPDEAV KCT C  DFSAFNR+HHCRNCGDIFCDKCTQGR  L
Sbjct  111  LDWRNLVKPVTEEKDHWVPDEAVNKCTACAGDFSAFNRRHHCRNCGDIFCDKCTQGRTPL  170

Query  350  TADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsr  529
            T+D ++  VRVC+RC  EVSRRLS+AKEAA+RPV+QSHEDLAKKLQE M+ N K+SSGSR
Sbjct  171  TSDADSQPVRVCDRCMAEVSRRLSSAKEAANRPVVQSHEDLAKKLQEAMDINKKSSSGSR  230

Query  530  sdgfgrr--MKEVACPTCTVHLQVQV  601
            S        M+EVACP CTVHLQ+ +
Sbjct  231  SSDGSSGKRMREVACPICTVHLQIDI  256



>ref|XP_008651303.1| PREDICTED: uncharacterized LOC100279323 isoform X2 [Zea mays]
Length=541

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 166/208 (80%), Gaps = 8/208 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG--RSRPA-ESHKMAEQPAEKKKAFA  172
            DIEP+RIRLKSSSYT+NT+LDTVTAAT+QFKE+G   RSR A E+ K   Q  EKKK F 
Sbjct  320  DIEPKRIRLKSSSYTSNTMLDTVTAATVQFKEIGADARSRGAIETGKPLVQSNEKKKGF-  378

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+   KPV+E KDHWVPDE   KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  379  DWMF-TKPVDEVKDHWVPDEVAKKCHSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRIALT  437

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsr  529
            A++NAP+VRVC+RC  EV++RLS AK+ A+R   +QSHEDLA+KL+ EME+N K+ S S 
Sbjct  438  AEDNAPLVRVCDRCMAEVTQRLSIAKDVANRSATVQSHEDLARKLK-EMEKNRKS-SASG  495

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                G RM+EVACPTCTVHLQVQVP+SG
Sbjct  496  GGAPGTRMREVACPTCTVHLQVQVPTSG  523



>gb|EMS65439.1| Lateral signaling target protein 2-like protein [Triticum urartu]
Length=689

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 161/206 (78%), Gaps = 6/206 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG---RSRPA-ESHKMAEQPAEKKKAF  169
            D+E RRIRLKSSSYTTNT+LDTVTAA++QFKEM     RS+ A +    +EQ  EK++ F
Sbjct  182  DLEARRIRLKSSSYTTNTILDTVTAASVQFKEMASSVSRSKAAVDPASPSEQQNEKRRNF  241

Query  170  ADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVAL  349
             DW   +KPV EEKDHWVPDEAV KCT C  DFSAFNR+HHCRNCGDIFCDKCTQGR  L
Sbjct  242  LDWRNLVKPVTEEKDHWVPDEAVNKCTACAGDFSAFNRRHHCRNCGDIFCDKCTQGRTPL  301

Query  350  TADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsr  529
            T+D ++  VRVC+RC  EVSRRLS+AKEAA+RPV+ SHEDLAKKLQE M+ N K+SSGSR
Sbjct  302  TSDADSQPVRVCDRCMAEVSRRLSSAKEAANRPVVHSHEDLAKKLQEAMDINKKSSSGSR  361

Query  530  sdgfgrr--MKEVACPTCTVHLQVQV  601
            S        M+EVACP CTVHLQ+ +
Sbjct  362  SSEGSSGKRMREVACPICTVHLQIDI  387



>ref|XP_002974610.1| hypothetical protein SELMODRAFT_13721, partial [Selaginella moellendorffii]
 gb|EFJ24130.1| hypothetical protein SELMODRAFT_13721, partial [Selaginella moellendorffii]
Length=348

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 152/211 (72%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D E RR RL+SS+ TTN +LDT+TAA +Q  EM G+S  A++   +    EKK  F++WL
Sbjct  121  DFEQRRTRLQSSASTTNAILDTLTAACVQLCEMVGKSDAAKASISSNVIPEKKFTFSEWL  180

Query  182  TAMK-PVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            T  K PV EEKDHWVPDEAVTKCT C +DF  F R+HHCRNCGDIFCDKCT+GR ALT+D
Sbjct  181  TRSKAPVQEEKDHWVPDEAVTKCTACSSDFGPFLRRHHCRNCGDIFCDKCTRGRTALTSD  240

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsrsd  535
            E+A +VRVC+RC  EV++RL+N KE +++    QSHEDLAKKLQEE+ERN+         
Sbjct  241  EDAQIVRVCDRCLAEVTQRLTNTKETSNKFASQQSHEDLAKKLQEELERNAPPRKTVDKT  300

Query  536  gfgr-----rMKEVACPTCTVHLQVQVPSSG  613
                     R ++VACPTCTVHL+V+VPS G
Sbjct  301  SRSTDGSRRRTRDVACPTCTVHLEVEVPSFG  331



>ref|XP_002963320.1| hypothetical protein SELMODRAFT_23867, partial [Selaginella moellendorffii]
 gb|EFJ35191.1| hypothetical protein SELMODRAFT_23867, partial [Selaginella moellendorffii]
Length=348

 Score =   238 bits (608),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 152/211 (72%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            D E RR RL+SS+ TTN +LDT+TAA +Q  EM G+S  A++   +    EKK  F++WL
Sbjct  121  DFEQRRTRLQSSASTTNAILDTLTAACVQLCEMVGKSDAAKASISSIVTPEKKFTFSEWL  180

Query  182  TAMK-PVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            T  K PV EEKDHWVPDEAVTKCT C +DF  F R+HHCRNCGDIFCDKCT+GR ALT+D
Sbjct  181  TRSKAPVQEEKDHWVPDEAVTKCTACSSDFGPFLRRHHCRNCGDIFCDKCTRGRTALTSD  240

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASR-PVLQSHEDLAKKLQEEMERNSKAssgsrsd  535
            E+A +VRVC+RC  EV++RL+N KE +++    QSHEDLAKKLQEE+ERN+         
Sbjct  241  EDAQIVRVCDRCLAEVTQRLTNTKETSNKFASQQSHEDLAKKLQEELERNAPPRKTVDKT  300

Query  536  gfgr-----rMKEVACPTCTVHLQVQVPSSG  613
                     R ++VACPTCTVHL+V+VPS G
Sbjct  301  SRSTDGSRRRTRDVACPTCTVHLEVEVPSFG  331



>gb|EMS56851.1| Cysteine-rich receptor-like protein kinase 10 [Triticum urartu]
Length=629

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 161/238 (68%), Gaps = 42/238 (18%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSR---PAESHKMAEQPAEKKKAFA  172
            D E +RIRLKS+SYT+NTLLDTVTAAT+QFKE+G  +R   P ++ K + Q  EKKK F 
Sbjct  51   DFEAKRIRLKSNSYTSNTLLDTVTAATVQFKEIGEDARAKGPVDASKSSIQSNEKKKGF-  109

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALT  352
            DW+ A KPV+E KDHWVPDEA  KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALT
Sbjct  110  DWMFA-KPVDEVKDHWVPDEAAKKCQSCAGDFSHFNRRHHCRNCGEIFCDKCSQGRIALT  168

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASRP-VLQSHEDLAKKL---------------  484
            A++NAP+VRVC+RC  EVS+RLS A+EAA+R   +QSH DLAKKL               
Sbjct  169  AEDNAPLVRVCDRCMAEVSQRLSMAQEAANRSTTVQSHGDLAKKLKLISDSKSLERSDGS  228

Query  485  ---------------------QEEMERNSKAssgsrsdgfgrrMKEVACPTCTVHLQV  595
                                 +EE+ERN K+S  +     G RM+EVACPTCTVHLQ+
Sbjct  229  SRGRHIRLSRRGLLRRALGRKEEELERNRKSSGTASGGASGTRMREVACPTCTVHLQL  286



>gb|KCW58254.1| hypothetical protein EUGRSUZ_H009522, partial [Eucalyptus grandis]
Length=177

 Score =   232 bits (592),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 142/175 (81%), Gaps = 3/175 (2%)
 Frame = +2

Query  89   FKEMGGRSRPAESHKMAEQPAEKKKAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADF  268
             KEMGGR+RP++  K +EQPAE+KK  ADW+  MKP NEEKDHWVPDEAV+KCT CG+DF
Sbjct  1    LKEMGGRTRPSDPVKTSEQPAERKKGIADWMNLMKPGNEEKDHWVPDEAVSKCTACGSDF  60

Query  269  SAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASRP  448
            SAF R+HHCRNCGDIFCDKCT GR+ALTA+ENA  VRVC+RC  EV++RLSNAKEA+S+P
Sbjct  61   SAFIRRHHCRNCGDIFCDKCTHGRIALTAEENAQPVRVCDRCLAEVTQRLSNAKEASSKP  120

Query  449  V-LQSHEDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTCTVHLQVQVPSS  610
            V  QSHEDLA+KLQEEMERN K S+GS+SDG GRRM E  CP   +H     P S
Sbjct  121  VGFQSHEDLARKLQEEMERNRKGSAGSQSDGSGRRMTESPCP--HMHCPFAGPGS  173



>gb|ABK24454.1| unknown [Picea sitchensis]
Length=539

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 163/221 (74%), Gaps = 18/221 (8%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEM---GGRSRPAESHKMAEQPAEKKKA-F  169
            D++PRRIRL+S+ YTTNT+LDTV AA +Q +EM         +++ K ++Q  EK+++  
Sbjct  302  DLDPRRIRLQSNRYTTNTILDTVAAACVQLREMVDDKSSGNNSDTSKASDQLTEKRRSSL  361

Query  170  ADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVAL  349
            ADW+T  KPV EEK HWVPDEAVT C GCG DF AF R+HHCRNCGDIFCDKCTQGR AL
Sbjct  362  ADWVTLKKPV-EEKQHWVPDEAVTSCKGCGTDFGAFVRRHHCRNCGDIFCDKCTQGRAAL  420

Query  350  TADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQ-SHEDLAKKLQEEMERNSKA----  514
            TAD++A  VRVC+RC  EV++RL++ KE +S+   Q SH+DLAK+L EEM RN K     
Sbjct  421  TADKDAQPVRVCDRCLAEVTQRLTSTKETSSKATAQRSHDDLAKRLMEEMGRNRKGNSDS  480

Query  515  --------ssgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                    SS S SDG G+RM++VACPTCTVHLQVQVPSSG
Sbjct  481  GSGSSPLWSSQSISDGTGKRMRDVACPTCTVHLQVQVPSSG  521



>gb|ACN40997.1| unknown [Picea sitchensis]
Length=539

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 162/221 (73%), Gaps = 18/221 (8%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEM---GGRSRPAESHKMAEQPAEKKKA-F  169
            D++PRRIRL+S+ YTTNT+LDTV AA +Q +EM         +++ K ++Q  EK+++  
Sbjct  302  DLDPRRIRLQSNRYTTNTILDTVAAACVQLREMVDDKSSGNNSDTSKASDQLTEKRRSSL  361

Query  170  ADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVAL  349
            ADW+T  KPV EEK HWVPDEAVT C GCG DF AF R+HHCRNCGDIFCDKCTQGR AL
Sbjct  362  ADWVTLKKPV-EEKQHWVPDEAVTSCKGCGTDFGAFVRRHHCRNCGDIFCDKCTQGRAAL  420

Query  350  TADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQ-SHEDLAKKLQEEMERNSKA----  514
            TAD++A  VRVC+RC  EV++RL++ KE +S+   Q SH+DLAK+L EEM RN K     
Sbjct  421  TADKDAQPVRVCDRCLAEVTQRLTSTKETSSKATTQRSHDDLAKRLMEEMGRNRKGNSDS  480

Query  515  --------ssgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
                    SS S SDG G+RM+EVACP CTVHLQVQVPSSG
Sbjct  481  GSGSSPLWSSQSISDGTGKRMREVACPICTVHLQVQVPSSG  521



>gb|KCW58255.1| hypothetical protein EUGRSUZ_H009522, partial [Eucalyptus grandis]
Length=178

 Score =   228 bits (580),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 142/176 (81%), Gaps = 4/176 (2%)
 Frame = +2

Query  89   FKEMGGRSRPAESHKMAEQPAEKKKAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADF  268
             KEMGGR+RP++  K +EQPAE+KK  ADW+  MKP NEEKDHWVPDEAV+KCT CG+DF
Sbjct  1    LKEMGGRTRPSDPVKTSEQPAERKKGIADWMNLMKPGNEEKDHWVPDEAVSKCTACGSDF  60

Query  269  SAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASRP  448
            SAF R+HHCRNCGDIFCDKCT GR+ALTA+ENA  VRVC+RC  EV++RLSNAKEA+S+P
Sbjct  61   SAFIRRHHCRNCGDIFCDKCTHGRIALTAEENAQPVRVCDRCLAEVTQRLSNAKEASSKP  120

Query  449  V-LQSHEDLAKKLQ-EEMERNSKAssgsrsdgfgrrMKEVACPTCTVHLQVQVPSS  610
            V  QSHEDLA+KLQ EEMERN K S+GS+SDG GRRM E  CP   +H     P S
Sbjct  121  VGFQSHEDLARKLQVEEMERNRKGSAGSQSDGSGRRMTESPCP--HMHCPFAGPGS  174



>emb|CAN63053.1| hypothetical protein VITISV_027811 [Vitis vinifera]
Length=528

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+SYTTNT+LDTVTAAT+Q KEMGGR RP+ES K  EQP EKKK FADW+
Sbjct  364  DIEPRRIRLQSNSYTTNTILDTVTAATVQIKEMGGRIRPSESLKTTEQPTEKKKGFADWM  423

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              +KP NEEKDHWVPDEAVTKCT CG DF AF R+HHCRNCGDIFCDKCT GR+ALTADE
Sbjct  424  NIIKPGNEEKDHWVPDEAVTKCTACGTDFGAFVRRHHCRNCGDIFCDKCTHGRIALTADE  483

Query  362  NAPVVRVCERC  394
            +A  VRVC+RC
Sbjct  484  SAQPVRVCDRC  494



>gb|KJB29664.1| hypothetical protein B456_005G112600 [Gossypium raimondii]
Length=463

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEP RI L+S+SYTTNTLLD VTAAT+Q KEMGGRSRP +S K  EQP+EKKK F DW+
Sbjct  324  DIEPSRIGLQSNSYTTNTLLDIVTAATVQVKEMGGRSRPPDSLKTTEQPSEKKKGFGDWM  383

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
              MKP  EEKDHWVPDEAV+KCT CG DF AF RKHHCRNCGDIFCDKCTQGR+ALTADE
Sbjct  384  NLMKPGTEEKDHWVPDEAVSKCTACGTDFGAFVRKHHCRNCGDIFCDKCTQGRIALTADE  443

Query  362  NAPVVRVCERC  394
            NA  VRVC+RC
Sbjct  444  NAQPVRVCDRC  454



>emb|CAN71844.1| hypothetical protein VITISV_036264 [Vitis vinifera]
Length=255

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 134/170 (79%), Gaps = 1/170 (1%)
 Frame = +2

Query  98   MGGRSRPAESHKMAEQPAEKKKAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAF  277
            M  R+  ++S K++EQ A++K+ F+DW+  MK  NEEKDHWVPDEAVT+C  C  DF  F
Sbjct  1    MDARNNSSDSFKVSEQYADRKRGFSDWINMMKSSNEEKDHWVPDEAVTECKACCIDFGPF  60

Query  278  NRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASR-PVL  454
             RKHHCRNCGDIFCDKCTQGR+ALTA+E A  VRVC++C  EV++RLS+  EAA R   L
Sbjct  61   XRKHHCRNCGDIFCDKCTQGRIALTAEEGAQPVRVCDQCMAEVTQRLSSTSEAAHRISGL  120

Query  455  QSHEDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTCTVHLQVQVP  604
            QSHEDLAKKLQEEM+R  K SSG +SDG G +M+EVACPTCTVHLQV +P
Sbjct  121  QSHEDLAKKLQEEMDRKCKTSSGLKSDGSGMQMREVACPTCTVHLQVSIP  170



>gb|KDO84923.1| hypothetical protein CISIN_1g008295mg [Citrus sinensis]
Length=492

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGG-RSRPAESHKMAEQPAEKKKAFADW  178
            DIEPRRIRL+S+SYT  TLLD VTAAT+Q KEMGG RSR ++S K AEQ  E+KK FADW
Sbjct  349  DIEPRRIRLQSNSYTATTLLDIVTAATVQLKEMGGGRSRSSDSLKTAEQTGEQKKGFADW  408

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  MKP NEEKDHWVPDEAV+KCT CG DFSAF RKHHCRNCGDIFCDKCT GR+ALTAD
Sbjct  409  MNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTAD  468

Query  359  ENAPVVRVCERC  394
             NA  VRVC+RC
Sbjct  469  ANAQPVRVCDRC  480



>ref|XP_001759236.1| predicted protein [Physcomitrella patens]
 gb|EDQ75920.1| predicted protein [Physcomitrella patens]
Length=478

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 149/211 (71%), Gaps = 9/211 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAE----KKKAF  169
            DIE R IRL+SSSYTT+ +LDT+TAA +Q  EM  +   ++    +  P++    +K   
Sbjct  253  DIEQRCIRLQSSSYTTSAILDTITAACVQLCEMVDKDESSKPSAGSTAPSDTTLGRKSFI  312

Query  170  ADWLTAMKP---VNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGR  340
             DW+   +P     EEK HWVPDEA TKC+ C ADFSAF R+HHCRNCGD+FCD+CT+GR
Sbjct  313  GDWV-PFRPRTASEEEKQHWVPDEAATKCSNCDADFSAFVRRHHCRNCGDVFCDRCTRGR  371

Query  341  VALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAss  520
              LT++E A  VRVC+RC  EVS+RLSNAKEA+  PV ++HEDLAKKLQ  +     + +
Sbjct  372  TPLTSEEGAQPVRVCDRCLAEVSQRLSNAKEASKVPVQRTHEDLAKKLQ-VIGVAITSYN  430

Query  521  gsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
             S + G G RM+EVACPTCTVHLQVQVPS G
Sbjct  431  SSGAKGSGPRMREVACPTCTVHLQVQVPSFG  461



>ref|XP_009419053.1| PREDICTED: uncharacterized protein LOC103999117 [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 114/137 (83%), Gaps = 6/137 (4%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRS------RPAESHKMAEQPAEKKK  163
            DI+PRRIRL+S+SYTTNT+LDTVTAAT+Q KEMGG          A++ K+++Q AE+KK
Sbjct  367  DIDPRRIRLQSNSYTTNTILDTVTAATVQLKEMGGNGSLTRGEEAADASKVSDQSAERKK  426

Query  164  AFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRV  343
            +  +W+  +KP NEEKDHWVPDEAV+KCT CG+DF AFNR+HHCRNCGDIFCDKCT+GR+
Sbjct  427  SLVNWMNLIKPANEEKDHWVPDEAVSKCTSCGSDFGAFNRRHHCRNCGDIFCDKCTKGRI  486

Query  344  ALTADENAPVVRVCERC  394
            ALT +ENA  VRVC+RC
Sbjct  487  ALTTEENAQQVRVCDRC  503



>ref|XP_009420231.1| PREDICTED: pleckstrin homology domain-containing family F member 
2-like [Musa acuminata subsp. malaccensis]
Length=189

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 125/175 (71%), Gaps = 9/175 (5%)
 Frame = +2

Query  5    IEPRRIR--LKSSSYTTNTLLDTVTAATIQFKEMGGRS------RPAESHKMAEQPAEKK  160
            I  R I+  L ++S      +    AA+   KEMGG          A++ K+++Q AE+K
Sbjct  6    ISWRSIKQTLTATSAMEVEFVSYFEAASYGRKEMGGNGSQTRGEEAADASKVSDQSAERK  65

Query  161  KAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGR  340
            K+  DW+  +KP NEEKDHWVPDE V+KCT CG+DF AFN +HHCRNCGDIFCDKCT+GR
Sbjct  66   KSLVDWMNLIKPANEEKDHWVPDEVVSKCTSCGSDFGAFNHRHHCRNCGDIFCDKCTKGR  125

Query  341  VALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMER  502
            +ALTA+ENA  VRVC+RC  EVS+RLSNAKEA S+P  LQSHEDLA++LQ +  R
Sbjct  126  IALTAEENAQQVRVCDRCMAEVSQRLSNAKEAVSKPTGLQSHEDLARRLQVDAGR  180



>gb|KCW58246.1| hypothetical protein EUGRSUZ_H009502, partial [Eucalyptus grandis]
Length=150

 Score =   194 bits (494),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = +2

Query  221  VPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKN  400
            VPDEAV+KCT CG+DFSAF R+HHCRNCGDIFCDKCT GR+ALTA+ENA  VRVC+RC  
Sbjct  1    VPDEAVSKCTACGSDFSAFIRRHHCRNCGDIFCDKCTHGRIALTAEENAQPVRVCDRCLA  60

Query  401  EVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTC  577
            E+++RLSNAKEA+S+PV  QSHEDLA+KLQE+MERN   S+GS+SDG GRRMKEVACP C
Sbjct  61   EMTQRLSNAKEASSKPVGFQSHEDLARKLQEKMERNRTGSAGSQSDGSGRRMKEVACPIC  120

Query  578  TVHLQVQVPSSG  613
            TVHLQVQVP+SG
Sbjct  121  TVHLQVQVPTSG  132



>ref|XP_009420265.1| PREDICTED: uncharacterized protein ZK632.12-like [Musa acuminata 
subsp. malaccensis]
Length=135

 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 111/139 (80%), Gaps = 6/139 (4%)
 Frame = +2

Query  179  LTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTAD  358
            +  +KP N EKDHWVPDEAV+KCT CG+DF AFNR+HHCRNCGDIFCDKCT+GR+ALTA 
Sbjct  1    MNLIKPANGEKDHWVPDEAVSKCTSCGSDFGAFNRRHHCRNCGDIFCDKCTKGRIALTAK  60

Query  359  ENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsd  535
            ENA  VRVC+RC  EVS+RLSNAKEA S+P  LQSHEDLA++LQEE+ +N      S SD
Sbjct  61   ENAQQVRVCDRCMAEVSQRLSNAKEAVSKPAGLQSHEDLARRLQEELNKN-----RSNSD  115

Query  536  gfgrrMKEVACPTCTVHLQ  592
               +  +EVACP CTVHLQ
Sbjct  116  ESWKPTREVACPICTVHLQ  134



>gb|KCW58247.1| hypothetical protein EUGRSUZ_H009502, partial [Eucalyptus grandis]
Length=151

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = +2

Query  221  VPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKN  400
            VPDEAV+KCT CG+DFSAF R+HHCRNCGDIFCDKCT GR+ALTA+ENA  VRVC+RC  
Sbjct  1    VPDEAVSKCTACGSDFSAFIRRHHCRNCGDIFCDKCTHGRIALTAEENAQPVRVCDRCLA  60

Query  401  EVSRRLSNAKEAASRPV-LQSHEDLAKKLQ-EEMERNSKAssgsrsdgfgrrMKEVACPT  574
            E+++RLSNAKEA+S+PV  QSHEDLA+KLQ E+MERN   S+GS+SDG GRRMKEVACP 
Sbjct  61   EMTQRLSNAKEASSKPVGFQSHEDLARKLQVEKMERNRTGSAGSQSDGSGRRMKEVACPI  120

Query  575  CTVHLQVQVPSSG  613
            CTVHLQVQVP+SG
Sbjct  121  CTVHLQVQVPTSG  133



>gb|KCW58245.1| hypothetical protein EUGRSUZ_H009502, partial [Eucalyptus grandis]
Length=149

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  VPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKN  400
            VPDEAV+KCT CG+DFSAF R+HHCRNCGDIFCDKCT GR+ALTA+ENA  VRVC+RC  
Sbjct  1    VPDEAVSKCTACGSDFSAFIRRHHCRNCGDIFCDKCTHGRIALTAEENAQPVRVCDRCLA  60

Query  401  EVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTC  577
            E+++RLSNAKEA+S+PV  QSHEDLA+KLQ +MERN   S+GS+SDG GRRMKEVACP C
Sbjct  61   EMTQRLSNAKEASSKPVGFQSHEDLARKLQ-KMERNRTGSAGSQSDGSGRRMKEVACPIC  119

Query  578  TVHLQVQVPSSG  613
            TVHLQVQVP+SG
Sbjct  120  TVHLQVQVPTSG  131



>dbj|BAD95267.1| hypothetical protein [Arabidopsis thaliana]
Length=142

 Score =   182 bits (463),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 2/125 (2%)
 Frame = +2

Query  242  KCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLS  421
            KCT CG+DF AF R+HHCRNCGD+FCDKCTQGR+ALTA++NAP VRVC+RC  EVS+RLS
Sbjct  1    KCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAEDNAPQVRVCDRCMAEVSQRLS  60

Query  422  NAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTCTVHLQVQ  598
            NAKE   R V LQSHEDLA+KLQEEMERN K+ S    +G GRRMKEVACPTCTVHLQVQ
Sbjct  61   NAKETTGRNVSLQSHEDLARKLQEEMERNRKS-SSGLREGSGRRMKEVACPTCTVHLQVQ  119

Query  599  VPSSG  613
            VP SG
Sbjct  120  VPVSG  124



>gb|KCW58248.1| hypothetical protein EUGRSUZ_H009502, partial [Eucalyptus grandis]
Length=128

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = +2

Query  287  HHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSH  463
            HHCRNCGDIFCDKCT GR+ALTA+ENA  VRVC+RC  E+++RLSNAKEA+S+PV  QSH
Sbjct  1    HHCRNCGDIFCDKCTHGRIALTAEENAQPVRVCDRCLAEMTQRLSNAKEASSKPVGFQSH  60

Query  464  EDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTCTVHLQVQVPSSG  613
            EDLA+KLQE+MERN   S+GS+SDG GRRMKEVACP CTVHLQVQVP+SG
Sbjct  61   EDLARKLQEKMERNRTGSAGSQSDGSGRRMKEVACPICTVHLQVQVPTSG  110



>emb|CDY43412.1| BnaC07g14790D [Brassica napus]
Length=548

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 105/162 (65%), Gaps = 36/162 (22%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            +IE +RIRL+S+SYTTNTLLDTVTAA  Q KE+ G SRP  S K+               
Sbjct  281  NIEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIWGSSRPPVSAKL---------------  325

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADE  361
                         VPDEAV+KCT CG+DF AFN +HHCRNCG    D C+Q    LTA+E
Sbjct  326  -------------VPDEAVSKCTLCGSDFGAFNLRHHCRNCG----DDCSQ---PLTAEE  365

Query  362  NAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKL  484
            NAP +RV +RC  EVS+RLS AKE+ASR V +QS+ DLA+KL
Sbjct  366  NAPQIRVFDRCMAEVSQRLSYAKESASRNVSVQSYGDLARKL  407



>emb|CDY29372.1| BnaA06g14240D [Brassica napus]
Length=202

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DI+ +RIRL+S+SYTTNTLLDTV AA  Q KE+GG SRP +S K+ EQ AEKKK   DW+
Sbjct  83   DIDAKRIRLQSNSYTTNTLLDTVIAAMFQAKEIGGSSRPPDSVKLVEQSAEKKKGLGDWM  142

Query  182  TAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRK  286
              + PVNEEKDHWVPDEAV+KCT CG+DF AF R+
Sbjct  143  NIINPVNEEKDHWVPDEAVSKCTSCGSDFGAFMRR  177



>ref|XP_008665773.1| PREDICTED: uncharacterized protein LOC103644338 [Zea mays]
Length=212

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 76/91 (84%), Gaps = 1/91 (1%)
 Frame = +2

Query  221  VPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKN  400
            VPDE   KC  C  DFS FNR+HHCRNCG+IFCDKC+QGR+ALTA++NAP+VRVC+RC  
Sbjct  18   VPDEVAKKCHSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRIALTAEDNAPLVRVCDRCMT  77

Query  401  EVSRRLSNAKEAASRP-VLQSHEDLAKKLQE  490
            EV++RLS AK+ A+R   +QSHEDLA+KL++
Sbjct  78   EVTQRLSIAKDVANRSATVQSHEDLARKLKD  108



>gb|KCW58249.1| hypothetical protein EUGRSUZ_H009501, partial [Eucalyptus grandis]
 gb|KCW58250.1| hypothetical protein EUGRSUZ_H009501, partial [Eucalyptus grandis]
 gb|KCW58251.1| hypothetical protein EUGRSUZ_H009501, partial [Eucalyptus grandis]
 gb|KCW58252.1| hypothetical protein EUGRSUZ_H009501, partial [Eucalyptus grandis]
Length=236

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMGGRSRPAESHKMAEQPAEKKKAFADWL  181
            DIEPRRIRL+S+ YTTNTLLDTVTAAT+Q KEMGGR+RP++  K +EQPAE+KK  ADW+
Sbjct  164  DIEPRRIRLQSNRYTTNTLLDTVTAATVQLKEMGGRTRPSDPVKTSEQPAERKKGIADWM  223

Query  182  TAMKPVNEEKDHW  220
              MKP NEEKDHW
Sbjct  224  NLMKPGNEEKDHW  236



>tpg|DAA63256.1| TPA: putative RING/FYVE/PHD zinc finger family protein [Zea mays]
Length=335

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 75/101 (74%), Gaps = 5/101 (5%)
 Frame = +2

Query  2    DIEPRRIRLKSSSYTTNTLLDTVTAATIQFKEMG--GRSRPA-ESHKMAEQPAEKKKAFA  172
            DIEP+RIRLKSSSYT+NT+LDTVTAAT+QFKE+G   RSR A E+ K   Q  EKKK F 
Sbjct  231  DIEPKRIRLKSSSYTSNTMLDTVTAATVQFKEIGADARSRGAIETGKPLVQSNEKKKGF-  289

Query  173  DWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHC  295
            DW+   KPV+E KDHWVPDE   KC  C  DFS FNR+ +C
Sbjct  290  DWMF-TKPVDEVKDHWVPDEVAKKCHSCAVDFSPFNRRRNC  329



>gb|ABR25941.1| zinc ion binding protein [Oryza sativa Indica Group]
Length=94

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +2

Query  392  CKNEVSRRLSNAKEAASRPVLQSHEDLAKKLQEEMERNSKAssgsrsdg--fgrrMKEVA  565
            C  EVS+RL+NA+EAA+RP++ SHEDLAKKL++ M+ N K+SS          RRM+EVA
Sbjct  1    CMAEVSQRLNNAREAANRPIVHSHEDLAKKLKDAMDINKKSSSALSRSTDGSSRRMREVA  60

Query  566  CPTCTVHLQVQVPSSG  613
            CPTCTVHLQVQVP+SG
Sbjct  61   CPTCTVHLQVQVPTSG  76



>emb|CDY37424.1| BnaC08g45620D [Brassica napus]
Length=284

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = +2

Query  353  ADENAPVVRVCERCKNEVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsr  529
            A+ NAP V V ++C  +VS+RLS AKE+A R V +QSH D A+KLQEEME+N + SS   
Sbjct  180  AEGNAPQVPVSDQCMEKVSQRLSYAKESACRNVSVQSHGDPARKLQEEMEKN-RMSSSGS  238

Query  530  sdgfgrrMKEVACPTCTVHLQVQVPSSG  613
             +G GRRMKEVACPTCTV LQVQVP SG
Sbjct  239  REGSGRRMKEVACPTCTVRLQVQVPISG  266



>ref|XP_009388209.1| PREDICTED: uncharacterized protein LOC103975025, partial [Musa 
acuminata subsp. malaccensis]
Length=89

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = +2

Query  401  EVSRRLSNAKEAASRPV-LQSHEDLAKKLQEEMERNSKAssgsrsdgfgrrMKEVACPTC  577
            +VS+RLSNAK+A S+P  LQSHEDL ++LQEE+ +N K+ S S        M+EVACP C
Sbjct  2    KVSQRLSNAKKAVSKPAGLQSHEDLVRRLQEELNKNRKSGSNSDESWKP--MREVACPIC  59

Query  578  TVHLQVQVPSSG  613
            TVHLQVQVP+SG
Sbjct  60   TVHLQVQVPASG  71



>ref|XP_002425816.1| WD repeat and FYVE domain-containing protein, putative [Pediculus 
humanus corporis]
 gb|EEB13078.1| WD repeat and FYVE domain-containing protein, putative [Pediculus 
humanus corporis]
Length=3546

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/92 (37%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  A +P     DHW+ DE    C GCG  F+ + RKHHCRNCG +FC KC++    ++ 
Sbjct  3453  WSVAEQPGRTMADHWLRDEGAESCVGCGVKFNIYERKHHCRNCGQVFCSKCSRFESEISK  3512

Query  356   DENAPVVRVCERCKNEVSRRLSNAKEAASRPV  451
              +    VRVC+ C   +S++  +  +  S  V
Sbjct  3513  LKILKPVRVCQNCHKSLSKQKQDNNKPPSHVV  3544



>gb|EUD71470.1| hypothetical protein YYG_03527 [Plasmodium vinckei petteri]
Length=319

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = +2

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F D   A   V +++ HWVPDE VT C  C   F+   RKHHCR CG++FC  C+  ++ 
Sbjct  18   FGD---AENIVTDKRGHWVPDEEVTNCYSCNVTFNVRVRKHHCRACGNVFCSNCSDNKIK  74

Query  347  LTADENAPVVRVCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            ++    +  VRVC++C  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  75   ISEYSYSEKVRVCDKCFVERSSTQTLLLQEDLGARK--QINQDLKKALSEKM  124



>ref|XP_008814022.1| hypothetical protein C922_00183 [Plasmodium inui San Antonio 
1]
 gb|EUD69320.1| hypothetical protein C922_00183 [Plasmodium inui San Antonio 
1]
Length=324

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +2

Query  200  NEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVR  379
            N++K  WVPDE VT C  C A F+   RKHHCR CG++FC  C+  ++ ++    A  VR
Sbjct  26   NDKKCLWVPDEEVTNCYSCNAFFNVRVRKHHCRACGNVFCSNCSDNKIKISEYSYAEKVR  85

Query  380  VCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            VC+RC  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  86   VCDRCFMERSSPQTLLLQEDLGARK--QINQDLKKALSEKM  124



>ref|XP_001615786.1| hypothetical protein [Plasmodium vivax Sal-1]
 gb|EDL46059.1| hypothetical protein, conserved [Plasmodium vivax]
Length=307

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +2

Query  200  NEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVR  379
            N++K  WVPDE VT C  C A F+   RKHHCR CG++FC  C+  ++ ++    A  VR
Sbjct  9    NDKKCLWVPDEEVTNCYSCNAFFNVRVRKHHCRACGNVFCSNCSDNKIKISEYSYAEKVR  68

Query  380  VCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            VC+RC  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  69   VCDRCFMERSSPQTLLLQEDLGARK--QINQDLKKALSEKM  107



>ref|XP_678912.1| hypothetical protein [Plasmodium berghei strain ANKA]
 emb|CAH96943.1| conserved hypothetical protein [Plasmodium berghei]
 emb|CDS50356.1| FYVE and coiled-coil domain-containing protein, putative [Plasmodium 
berghei ANKA]
Length=319

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = +2

Query  176  WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
            ++ A   V +++ HWVPDE VT C  C   F+   RKHHCR CG++FC  C+  ++ ++ 
Sbjct  18   FVDAENIVIDKRGHWVPDEEVTNCYSCNVFFNVRVRKHHCRACGNVFCSNCSDNKIKISE  77

Query  356  DENAPVVRVCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
               +  VRVC++C  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  78   YSYSEKVRVCDKCFVERSSTQTLLLQEDLGARK--QINQDLKKALSEKM  124



>ref|XP_008622149.1| hypothetical protein YYE_00239 [Plasmodium vinckei vinckei]
 gb|KEG04664.1| hypothetical protein YYE_00239 [Plasmodium vinckei vinckei]
Length=318

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = +2

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F D   A   + +++ HWVPDE VT C  C   F+   RKHHCR CG++FC  C+  ++ 
Sbjct  18   FGD---AENIITDKRGHWVPDEEVTNCYSCNVTFNVRVRKHHCRACGNVFCSNCSDNKIK  74

Query  347  LTADENAPVVRVCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            ++    +  VRVC++C  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  75   ISEYGYSEKVRVCDKCFVERSSTQTLLLQEDLGARK--QINQDLKKALSEKM  124



>ref|XP_002260270.1| zinc finger [Plasmodium knowlesi strain H]
 emb|CAQ41537.1| zinc finger, putative [Plasmodium knowlesi strain H]
Length=323

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +2

Query  200  NEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVR  379
            N++K  WVPDE VT C  C A F+   RKHHCR CG++FC  C+  ++ ++    A  VR
Sbjct  26   NDKKCLWVPDEEVTNCYSCNALFNVRVRKHHCRACGNVFCSNCSDNKIKISEYSYAEKVR  85

Query  380  VCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            VC+RC  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  86   VCDRCFVERSSPQTLLLQEDLGARK--QINQDLKKALSEKM  124



>ref|XP_729753.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21318.1| zinc finger, putative [Plasmodium yoelii yoelii]
 gb|ETB63126.1| hypothetical protein YYC_00710 [Plasmodium yoelii 17X]
 emb|CDU19895.1| FYVE and coiled-coil domain-containing protein, putative [Plasmodium 
yoelii]
 emb|CDZ17328.1| FYVE and coiled-coil domain-containing protein, putative [Plasmodium 
yoelii]
Length=319

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = +2

Query  167  FADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVA  346
            F D   A   V +++ HWVPDE VT C  C   F+   RKHHCR CG++FC  C+  ++ 
Sbjct  18   FGD---AENVVIDKRGHWVPDEEVTNCYSCNVFFNVRVRKHHCRACGNVFCSNCSDNKIK  74

Query  347  LTADENAPVVRVCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            ++    +  VRVC++C  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  75   ISEYSYSEKVRVCDKCFVERSSTQTLLLQEDLGARK--QINQDLKKALSEKM  124



>emb|CDO67065.1| FYVE and coiled-coil domain-containing protein, putative [Plasmodium 
reichenowi]
Length=325

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +2

Query  200  NEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVR  379
            NE K  WVPDE VT C  C   F+   RKHHCR CG++FC  C+  ++ ++    +  VR
Sbjct  27   NERKCLWVPDEEVTNCYSCNVVFNVRVRKHHCRACGNVFCSNCSDNKIKISEYSYSEKVR  86

Query  380  VCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            VC+RC  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  87   VCDRCFMERSSPQTLLLQEDLGARK--QINQDLKKALSEKM  125



>emb|CDR15529.1| FYVE and coiled-coil domain-containing protein, putative [Plasmodium 
chabaudi chabaudi]
Length=319

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +2

Query  185  AMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADEN  364
            A   + +++ HWVPDE VT C  C   F+   RKHHCR CG++FC  C+  ++ ++    
Sbjct  21   AENIITDKRGHWVPDEEVTNCYSCNVVFNVRVRKHHCRACGNVFCSNCSDNKIKISEYGY  80

Query  365  APVVRVCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            +  VRVC++C  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  81   SEKVRVCDKCFVERSSTQTLLLQEDLGARK--QINQDLKKALSEKM  124



>ref|XP_001348748.1| conserved Plasmodium protein, unknown function [Plasmodium falciparum 
3D7]
 gb|AAN37187.1| conserved Plasmodium protein, unknown function [Plasmodium falciparum 
3D7]
 gb|EWC86266.1| hypothetical protein PFNF54_04996 [Plasmodium falciparum NF54]
Length=325

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +2

Query  200  NEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVR  379
            NE K  WVPDE VT C  C   F+   RKHHCR CG++FC  C+  ++ ++    +  VR
Sbjct  27   NERKCLWVPDEEVTNCYSCNVVFNVRVRKHHCRACGNVFCSNCSDNKIKISEYSYSEKVR  86

Query  380  VCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            VC+RC  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  87   VCDRCFMERSSPQTLLLQEDLGARK--QINQDLKKALSEKM  125



>gb|ETW15786.1| hypothetical protein PFFVO_05238 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW27583.1| hypothetical protein PFFCH_05033 [Plasmodium falciparum FCH/4]
 gb|ETW33723.1| hypothetical protein PFTANZ_05586 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW39648.1| hypothetical protein PFNF135_05677 [Plasmodium falciparum NF135/5.C10]
 gb|ETW46533.1| hypothetical protein PFMALIP_05437 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW54265.1| hypothetical protein PFUGPA_04135 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW58579.1| hypothetical protein PFMC_05677 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR62457.1| hypothetical protein PFBG_05668 [Plasmodium falciparum 7G8]
 gb|EUT79126.1| hypothetical protein PFAG_05698 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC73597.1| hypothetical protein C923_05722 [Plasmodium falciparum UGT5.1]
Length=325

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +2

Query  200  NEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVR  379
            NE K  WVPDE VT C  C   F+   RKHHCR CG++FC  C+  ++ ++    +  VR
Sbjct  27   NERKCLWVPDEEVTNCYSCNVVFNVRVRKHHCRACGNVFCSNCSDNKIKISEYSYSEKVR  86

Query  380  VCERCKNEVS--RRLSNAKEAASRPVLQSHEDLAKKLQEEM  496
            VC+RC  E S  + L   ++  +R   Q ++DL K L E+M
Sbjct  87   VCDRCFMERSSPQTLLLQEDLGARK--QINQDLKKALSEKM  125



>gb|ERL88970.1| hypothetical protein D910_06348 [Dendroctonus ponderosae]
Length=205

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +2

Query  119  AESHKMAEQPAEKKKAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCR  298
             ESH  A    E  ++   W+   + V  +   WVPD AV++CTGCG  F    R+HHCR
Sbjct  71   GESHVSA---GESLRSDLSWVDVEESVECQGTLWVPDHAVSRCTGCGTAFWMGRRRHHCR  127

Query  299  NCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAK  478
             CG IFC  C++    L +++    VRVC  C +++ +          RP+L +   ++ 
Sbjct  128  KCGRIFCADCSEHATPLPSEQLYNPVRVCTGCYSDLKQ--------IDRPLLLN--SISD  177

Query  479  KLQEEMERNSKA  514
             L E+  R S  
Sbjct  178  SLAEQCSRGSSG  189



>gb|ENN80419.1| hypothetical protein YQE_03167, partial [Dendroctonus ponderosae]
Length=205

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = +2

Query  119  AESHKMAEQPAEKKKAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCR  298
             ESH  A    E  ++   W+   + V  +   WVPD AV++CTGCG  F    R+HHCR
Sbjct  71   GESHVSA---GESLRSDLSWVDVEESVECQGTLWVPDHAVSRCTGCGTAFWMGRRRHHCR  127

Query  299  NCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLSNAKEAASRPVLQSHEDLAK  478
             CG IFC  C++    L +++    VRVC  C +++ +          RP+L +   ++ 
Sbjct  128  KCGRIFCADCSEHATPLPSEQLYNPVRVCTGCYSDLKQ--------IDRPLLLN--SISD  177

Query  479  KLQEEMERNSKA  514
             L E+  R S  
Sbjct  178  SLAEQCSRGSSG  189



>ref|XP_008488069.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat and FYVE domain-containing 
protein 3-like [Diaphorina citri]
Length=3193

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W     P     DHW+ DE    C GCG  FS + RKHHCRNCG +FC KC++    ++ 
Sbjct  3104  WSLTEAPGRSIADHWLKDEGAESCPGCGVKFSIYERKHHCRNCGQVFCSKCSRYESEISR  3163

Query  356   DENAPVVRVCERCKNEVSRRL  418
                   VRVC+RC   +S RL
Sbjct  3164  LRILKPVRVCQRC--HMSLRL  3182



>emb|CAG07794.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=3477

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 54/111 (49%), Gaps = 7/111 (6%)
 Frame = +2

Query  110   SRPAESHKMAEQPAEKKKAFAD-------WLTAMKPVNEEKDHWVPDEAVTKCTGCGADF  268
             + PAE   +A      K    D       W  + +P     DHWV DE V  C+GC   F
Sbjct  3364  AHPAEITSLAISKDHSKILVGDGRGRVFSWSVSDQPGRSAADHWVKDEVVDNCSGCTVRF  3423

Query  269   SAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLS  421
             S   R+HHCRNCG +FC KC++ +  +   + +  VRVC+ C   +   LS
Sbjct  3424  SLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHELS  3474



>ref|XP_011499895.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat and FYVE domain-containing 
protein 3 [Ceratosolen solmsi marchali]
Length=3445

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W    +P     DHW+ DE V  C GCG  F+ + R+HHCRNCG +FC KC++    ++ 
Sbjct  3359  WSVCEQPGRTVADHWLKDEGVDSCVGCGVKFNIYERRHHCRNCGQVFCSKCSRFESKISR  3418

Query  356   DENAPVVRVCERC  394
                   VRVC+ C
Sbjct  3419  LGILKPVRVCQGC  3431



>ref|XP_003975214.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
[Takifugu rubripes]
Length=3543

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 53/111 (48%), Gaps = 7/111 (6%)
 Frame = +2

Query  110   SRPAESHKMAEQPAEKKKAFAD-------WLTAMKPVNEEKDHWVPDEAVTKCTGCGADF  268
             + PAE   +A      K    D       W  + +P     DHWV DE V  C+GC   F
Sbjct  3428  AHPAEITSLAISKDHSKILVGDGRGRVFSWSVSDQPGRSAADHWVKDEVVDSCSGCAVRF  3487

Query  269   SAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEVSRRLS  421
             S   R+HHCRNCG +FC KC++ +  +   + +  VRVC+ C   +   L 
Sbjct  3488  SLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHELG  3538



>ref|XP_002432980.1| zinc finger protein FYVE domain containing protein, putative 
[Pediculus humanus corporis]
 gb|EEB20242.1| zinc finger protein FYVE domain containing protein, putative 
[Pediculus humanus corporis]
Length=202

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  218  WVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERCK  397
            WVPD AV +C GC  +F    RKHHCRNCG +FC +C+    A+  ++    VRVC  C 
Sbjct  104  WVPDHAVARCQGCDVEFWLGRRKHHCRNCGKVFCSECSDNTAAVPGEQLYEPVRVCNTCH  163

Query  398  NEVSRRLSNAK  430
            N ++  +++A+
Sbjct  164  NFLATIITSAR  174



>gb|KFQ37953.1| WD repeat and FYVE domain-containing protein 3, partial [Mesitornis 
unicolor]
Length=3215

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3127  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3186

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3187  LKISSPVRVCQNC  3199



>ref|XP_009941202.1| PREDICTED: WD repeat and FYVE domain-containing protein 3, partial 
[Opisthocomus hoazin]
Length=3425

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3337  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3396

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3397  LKISSPVRVCQNC  3409



>ref|XP_010185514.1| PREDICTED: WD repeat and FYVE domain-containing protein 3, partial 
[Mesitornis unicolor]
Length=3208

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3120  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3179

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3180  LKISSPVRVCQNC  3192



>ref|XP_004536074.1| PREDICTED: RUN and FYVE domain-containing protein 2-like isoform 
X2 [Ceratitis capitata]
Length=701

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  218  WVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADEN--APVVRVCER  391
            W PD   T CTGC  +FS   RKHHCR+CGDIFC  C++  +AL  D+       RVC+R
Sbjct  636  WAPDSIATHCTGCSKEFSLTRRKHHCRSCGDIFCSSCSEHTLALLNDQGQLGKPARVCDR  695

Query  392  C  394
            C
Sbjct  696  C  696



>gb|EYC15306.1| hypothetical protein Y032_0037g3445 [Ancylostoma ceylanicum]
Length=573

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  215  HWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERC  394
            HW  D  VT+CT C   FS   RKHHCR CG IFC  C++GR+ L +  N+   RVC++C
Sbjct  503  HWAKDSDVTQCTACSDKFSISKRKHHCRMCGSIFCAACSEGRIKLPS--NSKPARVCDQC  560

Query  395  KNEVSRRLSNA  427
             N +  R S A
Sbjct  561  FNLLKNRQSAA  571



>gb|KFR17260.1| WD repeat and FYVE domain-containing protein 3, partial [Opisthocomus 
hoazin]
Length=3424

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3336  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3395

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3396  LKISSPVRVCQNC  3408



>ref|XP_009875227.1| PREDICTED: WD repeat and FYVE domain-containing protein 3, partial 
[Apaloderma vittatum]
Length=2587

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2499  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2558

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2559  LKISSPVRVCQNC  2571



>gb|KFP92514.1| WD repeat and FYVE domain-containing protein 3, partial [Apaloderma 
vittatum]
Length=2591

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2503  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2562

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2563  LKISSPVRVCQNC  2575



>gb|EMP30392.1| WD repeat and FYVE domain-containing protein 3 [Chelonia mydas]
Length=3542

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3454  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3513

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3514  LKISSPVRVCQNC  3526



>ref|XP_010574578.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X6 [Haliaeetus leucocephalus]
Length=3384

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3296  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3355

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3356  LKISSPVRVCQNC  3368



>gb|KFO06665.1| WD repeat and FYVE domain-containing protein 3 [Balearica regulorum 
gibbericeps]
Length=3508

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3420  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3479

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3480  LKISSPVRVCQNC  3492



>ref|XP_006258718.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Alligator 
mississippiensis]
Length=3513

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3425  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3484

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3485  LKISSPVRVCQNC  3497



>gb|EOA93142.1| WD repeat and FYVE domain-containing protein 3, partial [Anas 
platyrhynchos]
Length=2719

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2631  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2690

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2691  LKISSPVRVCQNC  2703



>gb|KFV15204.1| WD repeat and FYVE domain-containing protein 3, partial [Tauraco 
erythrolophus]
Length=3463

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3375  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3434

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3435  LKISSPVRVCQNC  3447



>ref|XP_009981616.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat and FYVE domain-containing 
protein 3, partial [Tauraco erythrolophus]
Length=3469

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3381  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3440

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3441  LKISSPVRVCQNC  3453



>ref|XP_005509144.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
isoform X2 [Columba livia]
Length=3484

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3396  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3455

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3456  LKISSPVRVCQNC  3468



>ref|XP_009967098.1| PREDICTED: WD repeat and FYVE domain-containing protein 3, partial 
[Tyto alba]
Length=2656

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2568  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2627

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2628  LKISSPVRVCQNC  2640



>ref|XP_009952675.1| PREDICTED: WD repeat and FYVE domain-containing protein 3, partial 
[Leptosomus discolor]
Length=2659

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2571  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2630

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2631  LKISSPVRVCQNC  2643



>ref|XP_009696848.1| PREDICTED: WD repeat and FYVE domain-containing protein 3, partial 
[Cariama cristata]
Length=2659

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2571  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2630

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2631  LKISSPVRVCQNC  2643



>gb|KFQ13526.1| WD repeat and FYVE domain-containing protein 3, partial [Leptosomus 
discolor]
Length=2660

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2572  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2631

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2632  LKISSPVRVCQNC  2644



>gb|KFP64261.1| WD repeat and FYVE domain-containing protein 3, partial [Cariama 
cristata]
Length=2660

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2572  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2631

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2632  LKISSPVRVCQNC  2644



>ref|XP_005031203.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like, 
partial [Anas platyrhynchos]
Length=2718

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2630  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2689

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2690  LKISSPVRVCQNC  2702



>ref|XP_009325766.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Pygoscelis 
adeliae]
 gb|KFW69539.1| WD repeat and FYVE domain-containing protein 3 [Pygoscelis adeliae]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_010296340.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat and FYVE domain-containing 
protein 3 [Balearica regulorum gibbericeps]
Length=3530

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3442  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3501

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3502  LKISSPVRVCQNC  3514



>ref|XP_008991296.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X5 [Callithrix jacchus]
Length=3402

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3313  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3372

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3373  LKISSPVRVCQNC  3385



>ref|XP_009674860.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X4 [Struthio camelus australis]
Length=3499

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3411  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3470

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3471  LKISSPVRVCQNC  3483



>ref|XP_009674858.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Struthio camelus australis]
Length=3512

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3424  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3483

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3484  LKISSPVRVCQNC  3496



>ref|XP_010574561.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X4 [Haliaeetus leucocephalus]
Length=3526

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3438  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3497

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3498  LKISSPVRVCQNC  3510



>ref|XP_009473403.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Nipponia 
nippon]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_009674857.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Struthio camelus australis]
 gb|KFV82140.1| WD repeat and FYVE domain-containing protein 3 [Struthio camelus 
australis]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>gb|KFQ91940.1| WD repeat and FYVE domain-containing protein 3 [Nipponia nippon]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_010574543.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Haliaeetus leucocephalus]
Length=3539

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3451  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3510

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3511  LKISSPVRVCQNC  3523



>ref|XP_010574514.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Haliaeetus leucocephalus]
 ref|XP_010574525.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Haliaeetus leucocephalus]
 ref|XP_010574534.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Haliaeetus leucocephalus]
Length=3554

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3466  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3525

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3526  LKISSPVRVCQNC  3538



>ref|XP_009674859.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X3 [Struthio camelus australis]
Length=3509

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3421  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3480

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3481  LKISSPVRVCQNC  3493



>ref|XP_005509143.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
isoform X1 [Columba livia]
Length=3512

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3424  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3483

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3484  LKISSPVRVCQNC  3496



>ref|XP_010574551.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X3 [Haliaeetus leucocephalus]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_010293434.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Phaethon 
lepturus]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_009889042.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Charadrius 
vociferus]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_009638294.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Egretta 
garzetta]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>gb|KGL97870.1| WD repeat and FYVE domain-containing protein 3 [Charadrius vociferus]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>gb|KFQ82983.1| WD repeat and FYVE domain-containing protein 3 [Phaethon lepturus]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>gb|KFP16954.1| WD repeat and FYVE domain-containing protein 3 [Egretta garzetta]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_009278515.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Aptenodytes 
forsteri]
 gb|KFM08196.1| WD repeat and FYVE domain-containing protein 3 [Aptenodytes forsteri]
Length=3527

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_010007250.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Chaetura 
pelagica]
 gb|KFU86185.1| WD repeat and FYVE domain-containing protein 3 [Chaetura pelagica]
Length=3529

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3441  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3500

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3501  LKISSPVRVCQNC  3513



>ref|XP_010574587.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X7 [Haliaeetus leucocephalus]
Length=2901

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2813  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2872

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2873  LKISSPVRVCQNC  2885



>gb|KFP39091.1| WD repeat and FYVE domain-containing protein 3, partial [Chlamydotis 
macqueenii]
Length=2719

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2631  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2690

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2691  LKISSPVRVCQNC  2703



>ref|XP_010128334.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Chlamydotis 
macqueenii]
Length=2722

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  2634  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  2693

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  2694  LKISSPVRVCQNC  2706



>ref|XP_010574569.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X5 [Haliaeetus leucocephalus]
Length=3493

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3405  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3464

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3465  LKISSPVRVCQNC  3477



>ref|XP_009557828.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat and FYVE domain-containing 
protein 3 [Cuculus canorus]
Length=3528

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3440  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3499

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3500  LKISSPVRVCQNC  3512



>ref|XP_006033327.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Alligator 
sinensis]
Length=3543

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3455  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3514

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3515  LKISSPVRVCQNC  3527



>gb|KFV48755.1| WD repeat and FYVE domain-containing protein 3, partial [Gavia 
stellata]
Length=2023

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  1935  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  1994

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  1995  LKISSPVRVCQNC  2007



>ref|XP_006084635.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X4 [Myotis lucifugus]
Length=3484

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3395  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3454

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3455  LKISSPVRVCQNC  3467



>gb|ELK16397.1| WD repeat and FYVE domain-containing protein 3 [Pteropus alecto]
Length=3492

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3403  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3462

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3463  LKISSPVRVCQNC  3475



>ref|XP_005440950.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
[Falco cherrug]
Length=3527

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>ref|XP_005233645.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
[Falco peregrinus]
Length=3527

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3439  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3498

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3499  LKISSPVRVCQNC  3511



>gb|KIH53069.1| FYVE zinc finger [Ancylostoma duodenale]
Length=433

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = +2

Query  215  HWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERC  394
            HW  D  VT+CT C   FS   RKHHCR CG IFC  C++GR+ L +  N+   RVC++C
Sbjct  363  HWAKDSDVTQCTACSDKFSISKRKHHCRMCGSIFCAACSEGRIKLPS--NSKPARVCDQC  420

Query  395  KNEVSRRLSNA  427
             N +  R S  
Sbjct  421  FNLLKNRQSGG  431



>ref|XP_007496021.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X3 [Monodelphis domestica]
Length=3508

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3419  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3478

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3479  LKISSPVRVCQNC  3491



>ref|XP_006867793.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Chrysochloris asiatica]
Length=3509

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3420  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3479

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3480  LKISSPVRVCQNC  3492



>ref|XP_005874170.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Myotis brandtii]
Length=3510

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3421  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3480

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3481  LKISSPVRVCQNC  3493



>ref|XP_007065709.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Chelonia 
mydas]
Length=3525

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3437  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3496

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3497  LKISSPVRVCQNC  3509



>ref|XP_006110939.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Pelodiscus sinensis]
Length=3536

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3448  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3507

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3508  LKISSPVRVCQNC  3520



>ref|XP_005874172.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X4 [Myotis brandtii]
Length=3497

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3408  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3467

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3468  LKISSPVRVCQNC  3480



>ref|XP_006084634.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X3 [Myotis lucifugus]
Length=3509

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3420  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3479

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3480  LKISSPVRVCQNC  3492



>ref|XP_006084633.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Myotis lucifugus]
Length=3512

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3423  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3482

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3483  LKISSPVRVCQNC  3495



>ref|XP_006110940.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X3 [Pelodiscus sinensis]
Length=3526

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3438  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3497

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3498  LKISSPVRVCQNC  3510



>ref|XP_007496019.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Monodelphis domestica]
 ref|XP_007496020.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Monodelphis domestica]
Length=3526

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3437  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3496

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3497  LKISSPVRVCQNC  3509



>ref|XP_005146631.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
[Melopsittacus undulatus]
Length=3529

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3441  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3500

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3501  LKISSPVRVCQNC  3513



>gb|ELK26525.1| WD repeat and FYVE domain-containing protein 3 [Myotis davidii]
Length=3485

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3396  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3455

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3456  LKISSPVRVCQNC  3468



>ref|XP_010964486.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X4 [Camelus bactrianus]
Length=3499

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3410  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3469

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3470  LKISSPVRVCQNC  3482



>ref|XP_006110942.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X5 [Pelodiscus sinensis]
Length=3523

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3435  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3494

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3495  LKISSPVRVCQNC  3507



>ref|XP_006110941.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X4 [Pelodiscus sinensis]
Length=3523

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3435  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3494

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3495  LKISSPVRVCQNC  3507



>ref|XP_006867792.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Chrysochloris asiatica]
Length=3527

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3438  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3497

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3498  LKISSPVRVCQNC  3510



>ref|XP_006084632.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Myotis lucifugus]
Length=3527

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3438  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3497

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3498  LKISSPVRVCQNC  3510



>ref|XP_009819889.1| PREDICTED: WD repeat and FYVE domain-containing protein 3, partial 
[Gavia stellata]
Length=2022

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  1934  WSVSDQPGRSAADHWVKDEGGDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  1993

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  1994  LKISSPVRVCQNC  2006



>ref|XP_006768730.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Myotis davidii]
Length=3505

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3416  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3475

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3476  LKISSPVRVCQNC  3488



>ref|XP_010964484.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Camelus bactrianus]
Length=3512

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3423  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3482

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3483  LKISSPVRVCQNC  3495



>ref|XP_006110938.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Pelodiscus sinensis]
Length=3541

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3453  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3512

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3513  LKISSPVRVCQNC  3525



>ref|XP_005292113.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X4 [Chrysemys picta bellii]
Length=3500

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3412  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3471

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3472  LKISSPVRVCQTC  3484



>ref|XP_001962707.1| GF15587 [Drosophila ananassae]
 gb|EDV31928.1| GF15587 [Drosophila ananassae]
Length=3491

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = +2

Query  119   AESHKMAEQPAEKKKAFADWLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCR  298
             ++ HK+      + + F+ W  A +P     DHW+ DE   +C  C   F+ + RKHHCR
Sbjct  3390  SKDHKILYVGDARGRIFS-WSVAEQPGRGVADHWLKDEGADQCVKCHVKFTLYERKHHCR  3448

Query  299   NCGDIFCDKCTQGRVALTADENAPVVRVCERCKNEV  406
             NCG +FC+KC++    ++       VRVC+ C +++
Sbjct  3449  NCGQVFCNKCSRFESEISRLRILKPVRVCQACYSQL  3484



>ref|XP_005292112.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X3 [Chrysemys picta bellii]
Length=3510

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3422  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3481

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3482  LKISSPVRVCQTC  3494



>ref|XP_005292111.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X2 [Chrysemys picta bellii]
Length=3513

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3425  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3484

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3485  LKISSPVRVCQTC  3497



>ref|XP_005292109.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Chrysemys picta bellii]
 ref|XP_005292110.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 isoform 
X1 [Chrysemys picta bellii]
Length=3528

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  176   WLTAMKPVNEEKDHWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTA  355
             W  + +P     DHWV DE    C+GC   FS   R+HHCRNCG +FC KC++ +  +  
Sbjct  3440  WSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKR  3499

Query  356   DENAPVVRVCERC  394
              + +  VRVC+ C
Sbjct  3500  LKISSPVRVCQTC  3512



>gb|ETN87008.1| FYVE zinc finger [Necator americanus]
Length=269

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +2

Query  215  HWVPDEAVTKCTGCGADFSAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERC  394
            HW  D  V++CT C   FS   RKHHCR CG IFC  C++GR+ L +  N+   RVC++C
Sbjct  200  HWAKDSDVSQCTACSDKFSISKRKHHCRMCGSIFCAACSEGRIKLPS--NSKPARVCDQC  257

Query  395  KNEVSRR  415
             N +  R
Sbjct  258  FNLLKNR  264



>ref|XP_007250553.1| PREDICTED: WD repeat and FYVE domain-containing protein 3 [Astyanax 
mexicanus]
Length=3476

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 52/102 (51%), Gaps = 7/102 (7%)
 Frame = +2

Query  110   SRPAESHKMAEQPAEKKKAFAD-------WLTAMKPVNEEKDHWVPDEAVTKCTGCGADF  268
             ++PAE   +A      K    D       W  + +P     DHWV DE V  C+GC   F
Sbjct  3359  AQPAEITALAISKDHSKILVGDGRGRVFSWSVSEQPGRSAADHWVKDEQVDSCSGCAVRF  3418

Query  269   SAFNRKHHCRNCGDIFCDKCTQGRVALTADENAPVVRVCERC  394
             S   R+HHCRNCG +FC KC++ +  +   + +  VRVC+ C
Sbjct  3419  SLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNC  3460



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090