BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN005A11

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           246   1e-73   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       237   3e-70   Ipomoea batatas [batate]
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            203   1e-61   Glehnia littoralis
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             213   2e-61   Nicotiana tomentosiformis
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            200   2e-60   Glehnia littoralis
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           210   3e-60   Nicotiana attenuata
gb|AIB08913.1|  phenylalanine ammonia-lyase                             199   3e-60   Angelica sinensis [Chinese angelica]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       207   4e-59   Ipomoea batatas [batate]
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            197   4e-59   Glehnia littoralis
gb|ADP09383.1|  phenylalanine ammonia lyase                             192   5e-59   Pyrus pyrifolia [sha li]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   206   6e-59   Ipomoea nil [qian niu]
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            197   9e-59   Lotus japonicus
emb|CAJ43711.1|  phenylalanine ammonia lyase                            191   1e-58   Plantago major [cart-track plant]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             206   1e-58   Nicotiana sylvestris
gb|AFR41237.1|  phenylalanine ammonia-lyase                             191   1e-58   Populus nigra [black poplar]
gb|AAC33966.1|  phenylalanine ammonia-lyase                             203   1e-58   Capsicum chinense [bonnet pepper]
gb|AFR41234.1|  phenylalanine ammonia-lyase                             191   1e-58   Populus nigra [black poplar]
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       194   2e-58   Malus domestica [apple tree]
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        205   2e-58   
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      200   2e-58   
gb|AGT63063.1|  phenylalanine ammonia-lyase                             204   4e-58   Solanum tuberosum [potatoes]
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    204   4e-58   
gb|AFR41211.1|  phenylalanine ammonia-lyase                             189   4e-58   Populus trichocarpa [western balsam poplar]
gb|AFR41221.1|  phenylalanine ammonia-lyase                             189   4e-58   Populus fremontii
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    204   4e-58   Solanum tuberosum [potatoes]
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    204   5e-58   Solanum lycopersicum
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 196   5e-58   Manihot esculenta [manioc]
gb|AIA66448.1|  PAL1                                                    204   5e-58   Capsicum annuum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    204   5e-58   Capsicum annuum
emb|CDP06747.1|  unnamed protein product                                201   6e-58   Coffea canephora [robusta coffee]
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             195   7e-58   Vitis vinifera
gb|AET41698.1|  phenylalanine ammonia-lyase                             195   8e-58   Prunus salicina [Japanese plum]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            203   1e-57   Daucus carota [carrots]
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            203   1e-57   Daucus carota [carrots]
gb|AFC37247.1|  phenylalanine ammonia-lyase                             195   1e-57   Camellia chekiangoleosa
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       203   1e-57   Nicotiana tabacum [American tobacco]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             203   1e-57   Nicotiana tomentosiformis
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        202   2e-57   Solanum tuberosum [potatoes]
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             202   2e-57   
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     202   2e-57   Petroselinum crispum
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           202   3e-57   Nicotiana attenuata
dbj|BAA95629.1|  phenylalanine ammonia lyase                            202   3e-57   Catharanthus roseus [chatas]
ref|XP_002862326.1|  predicted protein                                  190   4e-57   
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           201   4e-57   Coffea canephora [robusta coffee]
gb|AFR41220.1|  phenylalanine ammonia-lyase                             187   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             201   5e-57   Solanum lycopersicum
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    201   5e-57   Solanum lycopersicum
gb|ACF94717.1|  phenylalanine ammonia lyase                             193   6e-57   Robinia pseudoacacia [black locust]
gb|AFR41232.1|  phenylalanine ammonia-lyase                             186   8e-57   Populus nigra [black poplar]
dbj|BAD95069.1|  phenylalanine ammonia lyase                            186   8e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        201   8e-57   Solanum tuberosum [potatoes]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           200   1e-56   Coffea arabica [arabica coffee]
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       195   1e-56   Vitis vinifera
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            200   1e-56   Lotus japonicus
emb|CDP20698.1|  unnamed protein product                                200   1e-56   Coffea canephora [robusta coffee]
gb|AGF50184.1|  phenylalanine ammonia lyase                             191   2e-56   Salvia virgata
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            197   2e-56   Lotus japonicus
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            199   2e-56   Lotus japonicus
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        199   2e-56   Solanum tuberosum [potatoes]
gb|AEA72280.1|  phenylalanine ammonia-lyase                             199   3e-56   Angelica gigas
gb|ACR56688.1|  phenylalanine ammonia-lyase                             199   3e-56   Scutellaria viscidula [zhan mao huang qin]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          199   4e-56   Populus euphratica
gb|AFR41218.1|  phenylalanine ammonia-lyase                             184   4e-56   Populus trichocarpa [western balsam poplar]
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            194   5e-56   Lotus japonicus
emb|CAA34715.1|  unnamed protein product                                197   5e-56   Petroselinum crispum
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   198   5e-56   Populus tremuloides
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             198   5e-56   Nicotiana sylvestris
gb|AEX32784.1|  phenylalanine ammonia-lyase                             198   6e-56   Vitis vinifera
gb|AFN85669.1|  phenylalanine ammonia-lyase                             198   6e-56   Hibiscus cannabinus [bimli-jute]
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       198   6e-56   Nicotiana tabacum [American tobacco]
gb|ABV44808.1|  phenylalanine ammonia lyase 1                           191   8e-56   Eriobotrya japonica [loquat]
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            198   8e-56   Lotus japonicus
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        198   8e-56   Vitis vinifera
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             198   8e-56   Vitis vinifera
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           197   1e-55   
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    197   1e-55   
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       197   1e-55   Camellia sinensis [black tea]
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        193   1e-55   
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    197   1e-55   Solanum tuberosum [potatoes]
ref|XP_007027354.1|  PHE ammonia lyase 1                                197   1e-55   Theobroma cacao [chocolate]
gb|AGF50183.1|  phenylalanine ammonia lyase                             189   1e-55   Salvia hypoleuca
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      197   1e-55   
gb|AFG30054.1|  phenylalanine ammonialyase                              197   1e-55   Malus hybrid cultivar
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     197   1e-55   Petroselinum crispum
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    197   1e-55   Petroselinum crispum
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            197   1e-55   Melissa officinalis [sweet balm]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             197   1e-55   Pyrus x bretschneideri [bai li]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 197   1e-55   Pyrus x bretschneideri [bai li]
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     197   2e-55   Solanum tuberosum [potatoes]
gb|AFP24940.1|  phenylalanine ammonia lyase                             197   2e-55   Prunus salicina [Japanese plum]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        197   2e-55   Cicer arietinum [garbanzo]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             197   2e-55   Morus alba
gb|AAU08174.1|  phenylalanine ammonia-lyase                             197   2e-55   Camellia sinensis [black tea]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    197   2e-55   Pyrus x bretschneideri [bai li]
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     197   2e-55   Prunus avium [gean]
gb|AFK47120.1|  unknown                                                 186   2e-55   Lotus japonicus
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    192   2e-55
gb|AAA34179.2|  phenylalanine ammonia lyase                             197   2e-55   Solanum lycopersicum
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    197   2e-55   Solanum lycopersicum
gb|AEX32790.1|  phenylalanine ammonia-lyase                             197   2e-55   Vitis vinifera
dbj|BAD94354.1|  phenylalanine ammonia lyase                            190   3e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             196   3e-55   Populus tomentosa [Chinese white poplar]
emb|CAN77065.1|  hypothetical protein VITISV_009233                     196   3e-55   Vitis vinifera
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        196   3e-55   Vitis vinifera
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             196   3e-55   Sesamum indicum [beniseed]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              196   3e-55   Vitis vinifera
gb|AEY94464.1|  phenylalanine ammonia-lyase                             189   3e-55   Prunella vulgaris
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             196   3e-55   Vitis vinifera
emb|CAN61378.1|  hypothetical protein VITISV_032212                     196   3e-55   Vitis vinifera
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             196   3e-55   Vitis vinifera
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         196   3e-55   Populus trichocarpa [western balsam poplar]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             196   3e-55   Gossypium arboreum [tree cotton]
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        196   3e-55   Vitis vinifera
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        196   3e-55   Vitis vinifera
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 196   4e-55   Manihot esculenta [manioc]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           196   4e-55   Prunus mume [ume]
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     196   4e-55   Petroselinum crispum
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     196   4e-55   Daucus carota [carrots]
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            196   4e-55   Lotus japonicus
gb|ACF94716.1|  phenylalanine ammonia lyase                             196   4e-55   Robinia pseudoacacia [black locust]
gb|AID16077.1|  phenylalanine ammonium lyase                            196   4e-55   Morus alba
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                196   4e-55   Erythranthe guttata [common monkey flower]
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 196   4e-55   Rubus idaeus [European raspberry]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             196   4e-55   Vitis vinifera
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    196   5e-55   Populus euphratica
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        196   5e-55   Medicago truncatula
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             196   5e-55   Vitis vinifera
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        194   6e-55   
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         196   6e-55   Populus euphratica
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            195   6e-55   Lotus japonicus
gb|KJB46525.1|  hypothetical protein B456_007G373600                    195   7e-55   Gossypium raimondii
gb|AGL50914.1|  phenylalanine ammonia lyase                             195   7e-55   Pyrus communis
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    195   7e-55   Populus euphratica
gb|AGL81344.1|  phenylalanine ammonia lyase                             195   8e-55   Pyrus communis
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        195   8e-55   Solanum tuberosum [potatoes]
gb|KJB46526.1|  hypothetical protein B456_007G373700                    194   9e-55   Gossypium raimondii
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           195   9e-55   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            195   1e-54   Citrus clementina x Citrus reticulata
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            195   1e-54   Lotus japonicus
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        195   1e-54   Citrus sinensis [apfelsine]
gb|ABB70117.2|  phenylalanine ammonia lyase                             195   1e-54   Pyrus communis
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        192   1e-54   
gb|ABD42947.1|  phenylalanine ammonia lyase                             194   1e-54   Acacia auriculiformis x Acacia mangium
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             194   1e-54   Vitis vinifera
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       194   1e-54   Stylosanthes humilis [alfafinha do nordeste]
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       194   2e-54   Digitalis lanata [Grecian foxglove]
emb|CDX74991.1|  BnaA05g07370D                                          188   2e-54   
emb|CDX91331.1|  BnaC04g08190D                                          188   2e-54   
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             194   2e-54   
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             194   2e-54   Prunus persica
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              194   2e-54   Ricinus communis
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             194   2e-54   
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                194   2e-54   Medicago truncatula
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                194   2e-54   Medicago truncatula
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           193   2e-54   Glycine soja [wild soybean]
gb|KJB36583.1|  hypothetical protein B456_006G166000                    194   3e-54   Gossypium raimondii
gb|ACC63889.1|  phenylalanine ammonia-lyase                             194   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         193   3e-54   Populus trichocarpa [western balsam poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             193   3e-54   Populus szechuanica
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   191   3e-54   Citrus sinensis [apfelsine]
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      193   3e-54   Cicer arietinum [garbanzo]
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      193   3e-54   
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             193   3e-54   Populus tomentosa [Chinese white poplar]
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      191   4e-54   
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    193   5e-54   Glycine max [soybeans]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           193   5e-54   Fragaria vesca subsp. vesca
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   193   5e-54   Populus tremuloides
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        193   5e-54   Morus notabilis
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            183   5e-54   Phaseolus vulgaris [French bean]
gb|AEE81750.1|  phenylalanine ammonia lyase                             193   5e-54   Morus alba var. multicaulis
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      193   5e-54   
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           192   6e-54   Glycine soja [wild soybean]
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             192   6e-54   Perilla frutescens [beefsteak-mint]
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    192   6e-54   
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             192   6e-54   Olea europaea
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        193   7e-54   
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    192   7e-54   Lithospermum erythrorhizon
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             192   7e-54   Gossypium arboreum [tree cotton]
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    192   7e-54   
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             192   8e-54   Populus tomentosa [Chinese white poplar]
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            192   8e-54   Populus sieboldii x Populus grandidentata
gb|AAQ74878.1|  phenylalanine ammonia lyase                             192   8e-54   Populus trichocarpa x Populus deltoides
gb|AGA84059.1|  phenylalanine ammonia lyase                             192   8e-54   Picrorhiza kurrooa
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      192   9e-54   Camelina sativa [gold-of-pleasure]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           192   1e-53   Scutellaria baicalensis [Baikal skullcap]
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     191   1e-53   Glycine soja [wild soybean]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   192   1e-53   Rehmannia glutinosa [Chinese foxglove]
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    192   1e-53   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             192   1e-53   Capsella rubella
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             192   1e-53   Capsella rubella
gb|KJB62426.1|  hypothetical protein B456_009G416300                    192   1e-53   Gossypium raimondii
gb|AHY94892.1|  phenylalanine ammonia lyase                             191   1e-53   Prunella vulgaris
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             191   2e-53   Gossypium arboreum [tree cotton]
gb|ACF94715.1|  phenylalanine ammonia lyase                             184   2e-53   Robinia pseudoacacia [black locust]
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           191   2e-53   Camelina sativa [gold-of-pleasure]
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    191   2e-53   Populus sieboldii x Populus grandidentata
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             191   2e-53   Beta vulgaris subsp. vulgaris [field beet]
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       191   2e-53   Pisum sativum [garden pea]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         191   2e-53   Populus trichocarpa [western balsam poplar]
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       191   2e-53   Populus trichocarpa [western balsam poplar]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       191   2e-53   Citrus limon [lemon]
gb|AAC18870.1|  phenylalanine ammonia lyase                             191   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      191   2e-53   Cucumis melo [Oriental melon]
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    191   3e-53   Phaseolus vulgaris [French bean]
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             191   3e-53   
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         191   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AIY26016.1|  PAL                                                     191   3e-53   Jasminum sambac [Arabian jasmine]
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      191   3e-53   Glycine max [soybeans]
emb|CDY18464.1|  BnaA04g21230D                                          186   3e-53   Brassica napus [oilseed rape]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         191   3e-53   Populus trichocarpa [western balsam poplar]
gb|ABE03772.1|  phenylalanine ammonia-lyase                             191   3e-53   Arnebia euchroma
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        191   3e-53   Populus euphratica
gb|ACE95170.1|  phenylalanine ammonia-lyase                             191   3e-53   Populus tomentosa [Chinese white poplar]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             191   3e-53   Phaseolus vulgaris [French bean]
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    190   4e-53   Populus sieboldii x Populus grandidentata
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             190   4e-53   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             190   5e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          190   5e-53   Vitis vinifera
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             190   5e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           190   5e-53   Brassica rapa
gb|ABC69916.1|  phenylalanine ammonia-lyase                             190   5e-53   Brassica napus [oilseed rape]
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           190   5e-53   Camelina sativa [gold-of-pleasure]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             190   5e-53   Euphorbia pulcherrima
gb|ACM44926.1|  phenylalanine ammonia-lyase                             190   6e-53   Euphorbia pulcherrima
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    190   6e-53   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AAX22055.1|  phenylalanine ammonia-lyase                             190   6e-53   Brassica napus [oilseed rape]
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            190   6e-53   Brassica oleracea var. botrytis [cauliflower]
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    190   6e-53   Brassica rapa
gb|AEW43005.1|  phenylalanine ammonia lyase                             184   6e-53   Leucaena leucocephala [cassie]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           190   6e-53   Manihot esculenta [manioc]
gb|AGF50182.1|  phenylalanine ammonia lyase                             181   6e-53   Salvia officinalis
gb|ACZ36441.1|  phenylalanine ammonialyase                              190   7e-53   Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             189   7e-53   Sesamum indicum [beniseed]
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      189   8e-53   Camelina sativa [gold-of-pleasure]
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             180   8e-53   Pyrus pyrifolia [sha li]
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      189   1e-52   Brassica rapa
gb|ABF50788.1|  phenylalanine ammonia-lyase                             189   1e-52   Isatis tinctoria [woad]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             189   1e-52   Gossypium arboreum [tree cotton]
gb|AFU90757.1|  phenylalanine ammonia-lyase                             189   1e-52   Epimedium sagittatum
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           189   1e-52   Brassica rapa
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       189   2e-52   Medicago sativa [alfalfa]
dbj|BAP11146.1|  putative phenylalanine ammonia-lyase                   176   2e-52   Zanthoxylum ailanthoides
gb|ABV71917.1|  PAL                                                     179   2e-52   Plectranthus scutellarioides
gb|AAM12956.1|  phenylalanine ammonia-lyase                             189   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AIA24411.1|  phenylalanine ammonia-lyase                             188   2e-52   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AAC18871.1|  phenylalanine ammonia lyase                             188   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         188   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AFP86474.1|  phenylalanine ammonia-lyase                             189   2e-52   Brassica rapa subsp. chinensis [bok-choy]
gb|ADR78835.1|  phenylalanine ammonia lyase                             186   2e-52   Ziziphus jujuba [Chinese jujube]
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             188   3e-52   Eutrema salsugineum [saltwater cress]
gb|ABI33979.1|  phenylalanine ammonia lyase                             188   3e-52   Jatropha curcas
gb|ADA81868.1|  phenylalanine ammonia-lyase                             188   3e-52   Brassica rapa subsp. chinensis [bok-choy]
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           188   3e-52   Populus tomentosa [Chinese white poplar]
dbj|BAH20339.1|  AT3G53260                                              187   3e-52   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            188   3e-52   Lotus japonicus
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 188   3e-52   Pyrus x bretschneideri [bai li]
gb|ADO64252.1|  PAL                                                     187   3e-52   Epimedium sagittatum
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       187   4e-52   Pisum sativum [garden pea]
prf||2001451A  Phe ammonia lyase                                        187   4e-52
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              187   4e-52   Ricinus communis
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      187   4e-52   Camelina sativa [gold-of-pleasure]
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   187   4e-52   Citrus sinensis [apfelsine]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             187   5e-52   Citrus clementina [clementine]
gb|AGE10589.1|  phenylalanine amononia-lyase                            187   5e-52   Lonicera japonica [Japanese honeysuckle]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   187   5e-52   Citrus sinensis [apfelsine]
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             187   6e-52   Citrus clementina [clementine]
gb|ACR15762.1|  phenylalanine ammonia-lyase                             187   6e-52   Litchi chinensis [litchi]
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             187   6e-52   Phaseolus vulgaris [French bean]
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    187   6e-52   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AAX22053.1|  phenylalanine ammonia-lyase                             187   6e-52   Brassica napus [oilseed rape]
gb|ADY02660.1|  phenylalanine ammonia lyase                             187   7e-52   Parrya nudicaulis
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      187   7e-52   Camelina sativa [gold-of-pleasure]
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    184   8e-52   Phaseolus vulgaris [French bean]
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    184   8e-52
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     187   8e-52   Nicotiana tomentosiformis
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       187   8e-52   Trifolium subterraneum
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           187   9e-52   Astragalus membranaceus
prf||2006271A  Phe ammonia lyase                                        187   9e-52
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             179   1e-51   
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                186   1e-51   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           186   1e-51   
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        186   1e-51   
ref|XP_004173759.1|  PREDICTED: phenylalanine ammonia-lyase-like        173   1e-51   
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        186   1e-51   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             186   1e-51   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    186   1e-51   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      186   1e-51   
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         186   1e-51   
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             186   1e-51   
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        186   1e-51   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    186   2e-51   
gb|AAZ29732.1|  phenylalanine ammonia lyase                             186   2e-51   
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            186   2e-51   
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             186   2e-51   
gb|AAY82485.1|  phenylalanine ammonia-lyase                             183   2e-51   
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           185   2e-51   
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   185   3e-51   
gb|ACA30407.1|  phenylalanine ammonia-lyase                             185   3e-51   
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      185   3e-51   
gb|ADY02661.1|  phenylalanine ammonia lyase                             185   3e-51   
gb|AAZ29734.1|  phenylalanine ammonia lyase                             185   4e-51   
gb|AGY49231.1|  phenylalanine ammonia lyase                             185   4e-51   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            185   4e-51   
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             185   4e-51   
gb|AAZ29735.1|  phenylalanine ammonia lyase                             184   5e-51   
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          178   5e-51   
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       184   5e-51   
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             184   5e-51   
gb|AIL23235.1|  phenylalanine ammonia-lyase                             184   5e-51   
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        184   6e-51   
gb|AJO53274.1|  phenylalanine ammonia-lyase                             184   6e-51   
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       176   6e-51   
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       182   6e-51   
gb|KJB73539.1|  hypothetical protein B456_011G238400                    184   6e-51   
gb|ACV30588.1|  phenylalanine ammonia-lyase                             176   7e-51   
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   179   8e-51   
gb|ABD73282.1|  phenylalanine ammonia-lyase                             184   9e-51   
gb|AGH13333.1|  phenylalanine ammonia-lyase                             184   1e-50   
gb|AIB06732.1|  phenylalanine ammonia lyase                             183   1e-50   
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      183   1e-50   
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           183   1e-50   
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        183   1e-50   
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    182   1e-50   
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           183   1e-50   
gb|AJO53273.1|  phenylalanine ammonia-lyase                             183   1e-50   
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             183   1e-50   
gb|AAM28276.1|  phenylalanine ammonia-lyase                             176   1e-50   
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 182   2e-50   
gb|AAX84839.1|  phenylalanine ammonia-lyase                             183   2e-50   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           183   2e-50   
gb|ADY02662.1|  phenylalanine ammonia lyase                             183   2e-50   
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    182   2e-50
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             183   2e-50   
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           183   2e-50   
gb|ADD82537.1|  phenylalanine ammonia-lyase                             182   2e-50   
dbj|BAM34464.1|  phenylalanine ammonia-lyase                            170   2e-50   
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     182   2e-50   
gb|AFU82540.1|  phenylalanine ammonia-lyase                             171   2e-50   
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           182   3e-50   
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           182   3e-50   
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    182   3e-50   
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      182   3e-50   
gb|AAD45384.1|  phenylalanine ammonia-lyase                             182   3e-50   
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        182   3e-50   
gb|AGV54597.1|  phenylalanine ammonia-lyase                             182   3e-50   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           182   4e-50   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             182   4e-50   
gb|AAR31107.1|  phenylalanine ammonia-lyase                             182   4e-50   
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 182   4e-50   
gb|AFP49806.1|  phenylalanine ammonialyase 1                            182   4e-50   
gb|ACM62741.1|  phenylalanine ammonia-lyase                             182   4e-50   
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            182   4e-50   
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    182   5e-50   
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           182   5e-50   
gb|KJB16792.1|  hypothetical protein B456_002G248000                    181   6e-50   
gb|ABR14606.1|  phenylalanine ammonia-lyase                             181   6e-50   
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             181   6e-50   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             181   7e-50   
gb|AER12109.1|  PAL                                                     181   8e-50   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           181   8e-50   
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             181   9e-50   
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     181   9e-50   
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   181   1e-49   
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    181   1e-49   
gb|AID69536.1|  phenylalanine ammonia-lyase                             179   1e-49   
gb|ABN79671.2|  phenylalanine ammonia-lyase                             181   1e-49   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             180   2e-49   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             179   2e-49   
gb|AAZ29733.1|  phenylalanine ammonia lyase                             180   2e-49   
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          180   2e-49   
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    180   2e-49   
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      180   2e-49   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      180   2e-49   
gb|AEJ88223.1|  phenylalanine ammonia lyase                             180   2e-49   
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             180   2e-49   
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             179   3e-49   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        179   3e-49   
ref|XP_004173413.1|  PREDICTED: phenylalanine ammonia-lyase class...    167   3e-49   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           179   3e-49   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           179   3e-49   
gb|AAY82486.1|  phenylalanine ammonia-lyase                             179   3e-49   
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           179   3e-49   
gb|AGU91428.1|  phenylalanine ammonia-lyase                             179   4e-49   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             179   4e-49   
gb|ACT32033.1|  phenylalanine ammonia-lyase                             179   5e-49   
gb|AGE10591.1|  phenylalanine amononia-lyase                            179   5e-49   
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     179   5e-49   
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   178   7e-49   
gb|ADD12041.1|  phenylalanine ammonia lyase                             178   7e-49   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      178   8e-49   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            178   8e-49   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        178   8e-49   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        178   8e-49   
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       175   9e-49   
dbj|BAM28965.1|  phenylalanine ammonia lyase                            171   1e-48   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              178   1e-48   
gb|AHF20178.1|  phenylalanine ammonia lyase                             177   1e-48   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             177   1e-48   
gb|ACG80828.1|  phenylalanine ammonia lyase                             176   1e-48   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             177   2e-48   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             177   2e-48   
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       177   2e-48   
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        177   2e-48   
gb|ACG56648.1|  phenylalanine ammonia lyase                             177   2e-48   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        177   2e-48   
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        177   2e-48   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    177   2e-48   
gb|AAA50849.1|  phenylalanine ammonia-lyase                             165   2e-48   
gb|AEH02821.1|  phenylalanine ammonia lyase                             177   2e-48   
ref|XP_007016787.1|  PHE ammonia lyase 1                                177   2e-48   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             177   3e-48   
gb|AEC11891.1|  PAL1                                                    177   3e-48   
gb|AAV98199.1|  phenylalanine ammonialyase 1                            177   3e-48   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             176   3e-48   
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        176   3e-48   
gb|ACT21093.1|  phenylalanine ammonia-lyase                             176   3e-48   
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    176   4e-48   
gb|AFR41214.1|  phenylalanine ammonia-lyase                             163   4e-48   
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         176   5e-48   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             176   6e-48   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             176   6e-48   
gb|ACG56647.1|  phenylalanine ammonia lyase                             176   6e-48   
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        176   6e-48   
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           170   7e-48   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             175   8e-48   
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        175   9e-48   
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       175   9e-48   
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       171   1e-47   
gb|AIZ76770.1|  PAL2                                                    170   1e-47   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             175   1e-47   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             175   1e-47   
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          175   1e-47   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             175   1e-47   
gb|AIZ76768.1|  PAL2                                                    170   1e-47   
gb|AAW78932.1|  phenylalanine-ammonia lyase                             174   2e-47   
gb|AGC23439.1|  phenylalanine ammonia-lyase                             174   2e-47   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             174   2e-47   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             174   2e-47   
gb|AHA42443.1|  phenylalanine ammonia lyase                             174   2e-47   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        174   2e-47   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            174   2e-47   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        174   2e-47   
gb|AGE10605.1|  phenylalanine amononia-lyase                            167   3e-47   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            174   4e-47   
gb|AAD47085.1|AF167487_1  phenylalanine ammonia lyase                   169   4e-47   
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        173   4e-47   
gb|EMS57329.1|  Phenylalanine ammonia-lyase                             170   4e-47   
gb|ACG80829.1|  phenylalanine ammonia lyase                             172   5e-47   
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        173   5e-47   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            173   7e-47   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          172   7e-47   
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        172   7e-47   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            173   8e-47   
emb|CAA68064.1|  phenylalanine ammonia-lyase                            167   9e-47   
dbj|BAF93189.1|  putative phenylalanine ammonia-lyase                   171   1e-46   
gb|AIZ76769.1|  PAL2                                                    170   1e-46   
dbj|BAM05604.1|  phenylalanine ammonia lyase                            168   1e-46   
gb|EMS57330.1|  Phenylalanine ammonia-lyase                             167   2e-46   
dbj|BAJ85028.1|  predicted protein                                      171   2e-46   
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        171   2e-46   
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             171   2e-46   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            171   2e-46   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           171   2e-46   
gb|AIC66437.1|  phenylalanine ammonia lyase                             171   2e-46   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             171   2e-46   
gb|AIZ76767.1|  PAL2                                                    170   2e-46   
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        171   3e-46   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             171   3e-46   
emb|CDY08611.1|  BnaA05g28470D                                          171   3e-46   
ref|XP_004173358.1|  PREDICTED: phenylalanine ammonia-lyase-like        170   3e-46   
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        171   3e-46   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        171   3e-46   
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           171   4e-46   
gb|AFP49807.1|  phenylalanine ammonialyase 4                            171   4e-46   
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            170   4e-46   
ref|NP_001053326.1|  Os04g0518400                                       170   5e-46   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       170   5e-46   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        170   6e-46   
emb|CDY00922.1|  BnaC05g42780D                                          170   6e-46   
gb|EMT29668.1|  Phenylalanine ammonia-lyase                             170   6e-46   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        170   6e-46   
prf||1807329B  Phe ammonia lyase                                        170   6e-46
gb|EMS63272.1|  Phenylalanine ammonia-lyase                             170   6e-46   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           170   7e-46   
dbj|BAJ88975.1|  predicted protein                                      170   7e-46   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             170   8e-46   
ref|XP_003580144.1|  PREDICTED: phenylalanine ammonia-lyase             170   8e-46   
emb|CAA89005.1|  phenylalanine ammonia-lyase                            167   1e-45   
gb|EMT29669.1|  Phenylalanine ammonia-lyase                             169   1e-45   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        169   2e-45   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             169   2e-45   
ref|XP_006652523.1|  PREDICTED: phenylalanine ammonia-lyase-like        169   2e-45   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             169   2e-45   
gb|ADB97626.1|  phenylalanine ammonia-lyase                             169   2e-45   
dbj|BAJ85603.1|  predicted protein                                      169   2e-45   
gb|EMT28133.1|  Phenylalanine ammonia-lyase                             168   2e-45   
gb|AJO53272.1|  phenylalanine ammonia-lyase                             168   3e-45   
gb|AFR41236.1|  phenylalanine ammonia-lyase                             155   3e-45   
sp|Q43210.1|PALY_WHEAT  RecName: Full=Phenylalanine ammonia-lyase       168   3e-45   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             167   5e-45   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   246 bits (628),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 115/116 (99%), Positives = 116/116 (100%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL
Sbjct  592  ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  651

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELGTE+LTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC
Sbjct  652  YKFIREELGTEMLTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  707



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 116/116 (100%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGEHEKNVSTSIFQKIAAFEDELKA+LPKEVEGARSA+ENGNPAIPNRITECRSYPL
Sbjct  593  ALQNGEHEKNVSTSIFQKIAAFEDELKAVLPKEVEGARSAIENGNPAIPNRITECRSYPL  652

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEKV+SPGEVCDKVFTAVCDGGIIDPLLECLKSW+GAPLPIC
Sbjct  653  YKFVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDGAPLPIC  708



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  152  ALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAALESGNPAIPNRIKECRSYPL  211

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE LTGEKV+SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  212  YKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSRGEIIDPLLECLESWNGAPLPIC  267



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   213 bits (543),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 96/116 (83%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAIPNRITECRSYPL
Sbjct  600  AMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALESGNPAIPNRITECRSYPL  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+R+ELGTE+LTGEKV+SPGE CDKVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  660  YRFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  715



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKN+STSIFQKIAAFEDELK LLPKEVE AR+ LE+GNPA+PNRI ECRSYPL
Sbjct  152  ALKNGETEKNLSTSIFQKIAAFEDELKTLLPKEVESARAVLESGNPAVPNRIKECRSYPL  211

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  346
            YKFIREELGT  LTGEKV SPGE  DKVFTA+C G IIDPL+ECL+SWNGAPLPI
Sbjct  212  YKFIREELGTVYLTGEKVTSPGEEFDKVFTAMCKGQIIDPLMECLQSWNGAPLPI  266



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   210 bits (535),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 94/116 (81%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRITECRSYPL
Sbjct  602  AMKNGESEKNVNSSIFQKIGAFEDELKAVLPKEVENARAALESGNPAIANRITECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+R+ELGTE+LTGE+V+SPGE CDKVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  662  YRFVRKELGTELLTGERVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ E+N+STSIFQKIAAFEDELK LLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  119  ALNNGDKERNLSTSIFQKIAAFEDELKTLLPKEVESARAALESGNPAIPNRIKECRSYPL  178

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  346
            YKF+REELGTE LTGEKV+SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPI
Sbjct  179  YKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLECLESWNGAPLPI  233



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGE+EKN  TSIF K+AAFEDELKA+LPKEVE AR A+E+GNPAIPNRI ECRSYPL
Sbjct  592  ALQNGENEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPL  651

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G IIDPLLECLKSW+GAPLPIC
Sbjct  652  YKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  707



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  152  ALTNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPL  211

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REEL T+ LTGEKV+SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPIC
Sbjct  212  YKFVREELATDYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPIC  267



>gb|ADP09383.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=132

 Score =   192 bits (489),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  17   ALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPL  76

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L+CL+ WNGAPLPIC
Sbjct  77   YKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILDCLEGWNGAPLPIC  132



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGE EKN  TSIF K+AAFEDELKA+LPKEVE AR A+E+GNPAIPNRI ECRSYPL
Sbjct  596  ALQNGESEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G IIDPLLECLKSW+GAPLPIC
Sbjct  656  YKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  711



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   197 bits (502),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPA+PN+I ECRSYPL
Sbjct  196  ALVNGEYEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAMPNKINECRSYPL  255

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+R+ELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  256  YKFVRKELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  311



>emb|CAJ43711.1| phenylalanine ammonia lyase [Plantago major]
Length=129

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN +TSIF KI AFE+ELK +LPKEVE AR +LE GNPAI NRI ECRSYPL
Sbjct  14   ALKNGENEKNANTSIFHKIEAFENELKTVLPKEVESARISLEKGNPAIANRINECRSYPL  73

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELGT +LTGEKV SPGE CDKVFTA+C+G I+DPLL+CL+SWNGAPLPIC
Sbjct  74   YKFIREELGTNLLTGEKVVSPGEECDKVFTAMCNGLIVDPLLKCLESWNGAPLPIC  129



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   206 bits (523),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE GNPAI NRITECRSYPL
Sbjct  602  AMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALECGNPAIANRITECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+R+ELGTE+LTGE+V+SPGE C+KVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  662  YRFVRKELGTELLTGERVRSPGEECEKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>gb|AFR41237.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=117

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI  FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  2    ALVNGERERNSTTSIFQKIGTFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  61

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  62   YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  117



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPL
Sbjct  417  ALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPL  476

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G +IDPLLECLKSWNGAPLPIC
Sbjct  477  YRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQVIDPLLECLKSWNGAPLPIC  532



>gb|AFR41234.1| phenylalanine ammonia-lyase, partial [Populus nigra]
 gb|AFR41240.1| phenylalanine ammonia-lyase, partial [Populus nigra]
 gb|AFR41241.1| phenylalanine ammonia-lyase, partial [Populus nigra]
 gb|AFR41242.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=120

 Score =   191 bits (485),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI  FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  5    ALVNGERERNSTTSIFQKIGTFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  64

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  65   YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  120



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E GN A+PNRI ECRSYPL
Sbjct  120  ALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIEGGNAAVPNRIAECRSYPL  179

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  180  YKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  235



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   205 bits (521),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 92/116 (79%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPL
Sbjct  606  AMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  666  YRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKN+++SIFQKI AFEDEL A+LPKEVE AR+ LE+GNP+IPNRITECRSYPL
Sbjct  326  AMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECRSYPL  385

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  386  YRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  441



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   204 bits (520),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 92/116 (79%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ LE+GNP+IPNRITECRSYPL
Sbjct  607  AMNNGESEKNVNSSIFQKIVAFEDELKAMLPKEVESARAVLESGNPSIPNRITECRSYPL  666

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YK +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECL+SWNGAPLPIC
Sbjct  667  YKLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLQSWNGAPLPIC  722



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   204 bits (520),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A+ NGE EKNV++SIFQKI AFEDELK +LPKEVE AR  +E+GNPAIPNRITECRSYPL
Sbjct  604  AMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPNRITECRSYPL  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  664  YRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  719



>gb|AFR41211.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41212.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41213.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41215.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41216.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41217.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41219.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
Length=120

 Score =   189 bits (481),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  5    ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  64

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  65   YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  120



>gb|AFR41221.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41222.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41223.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41224.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41225.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41226.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41228.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41229.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41230.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
Length=118

 Score =   189 bits (481),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  3    ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  62

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  63   YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  118



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   204 bits (520),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A+ NGE EKNV++SIFQKI AFEDELK +LPKEVE AR  +E+GNPAIPNRITECRSYPL
Sbjct  608  AMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPNRITECRSYPL  667

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  668  YRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   204 bits (519),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 92/116 (79%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDELKA LPKEVE AR+ +E+GNPAIPNRITECRSYPL
Sbjct  606  AMKNGESEKNVNSSIFQKIVAFEDELKAALPKEVESARAVVESGNPAIPNRITECRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  666  YRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR A ENGNPAI N+I ECRSYPL
Sbjct  200  ALANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECRSYPL  259

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REE+GT +LTGEKV+SPGE  DKVFTA+C G IIDP+L+CLK WNGAPLPIC
Sbjct  260  YKFVREEIGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  315



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPL
Sbjct  602  ALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  662  YRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPL
Sbjct  602  ALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  662  YRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>emb|CDP06747.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPL
Sbjct  442  ALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPL  501

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGTE+L+GEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  502  YKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  557



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  193  ALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPL  252

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  253  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  308



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   195 bits (496),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPL
Sbjct  202  ALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPL  261

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNGAPLPIC
Sbjct  262  YKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPIC  317



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+A+E+GNPAIPNRI ECRSYPL
Sbjct  600  ALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPNRIKECRSYPL  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE LTGEKV SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  660  YKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNGAPLPIC  715



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+A+E+GNPAIPNRI ECRSYPL
Sbjct  600  ALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPNRIKECRSYPL  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE LTGEKV SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  660  YKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNGAPLPIC  715



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ EKNVSTSIFQKI AFE+EL ALLPKEVE AR A+E+GNP IPNRI ECRSYPL
Sbjct  193  ALKNGDAEKNVSTSIFQKIRAFEEELMALLPKEVESARRAVESGNPGIPNRIKECRSYPL  252

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT  LTGEK  SPGE  DKVFTA+C+G +IDPLL+CLKSWNGAPLPIC
Sbjct  253  YKFVREELGTGFLTGEKALSPGEEFDKVFTAMCEGQVIDPLLDCLKSWNGAPLPIC  308



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   203 bits (516),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRI ECRSYPL
Sbjct  597  ALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  657  YRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   203 bits (516),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRI ECRSYPL
Sbjct  597  ALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  657  YRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE E NV++SIFQKI AFEDELKA+LPKEVE AR  LE+GNP IPNRITECRSYPL
Sbjct  607  AMKNGESESNVNSSIFQKIVAFEDELKAVLPKEVESARVVLESGNPVIPNRITECRSYPL  666

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  667  YRFVRKELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  722



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPL
Sbjct  606  AMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G IIDPLLECLKSWNGAP+PIC
Sbjct  666  YRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC  721



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  603  ALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVETARAALESGNPAIPNRIKECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE LTGEKV+SPGE  +KVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  663  YKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGAPLPIC  718



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR ALE+GNPAI NRI ECRSYPL
Sbjct  597  ALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARIALESGNPAIANRIKECRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  657  YRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGE EKNV+TSIFQKIAAFEDELK +LPKEVE AR+ALENGNPAIPNRI ECRSYPL
Sbjct  601  ALQNGESEKNVNTSIFQKIAAFEDELKTVLPKEVESARTALENGNPAIPNRIKECRSYPL  660

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE++G E LTGEK +SPGE  DKVFTA+C+  IIDPLLECLK WNGAPLPIC
Sbjct  661  YKFVREDVGAEFLTGEKDRSPGEEFDKVFTAMCNEKIIDPLLECLKEWNGAPLPIC  716



>ref|XP_002862326.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38584.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  105  ALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  164

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP+LECL  WNGAP+PIC
Sbjct  165  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMLECLNEWNGAPIPIC  220



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPL
Sbjct  596  ALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGTE+L+GEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  656  YKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  711



>gb|AFR41220.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
Length=117

 Score =   187 bits (474),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIF KI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  2    ALVNGERERNSTTSIFXKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  61

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  62   YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  117



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGE+EKN S+SIFQKI AFE+ELK++LP+EVE AR ALE+GNPAI NRI ECRSYPL
Sbjct  596  ALQNGENEKNASSSIFQKIVAFEEELKSVLPREVESARVALESGNPAIANRINECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGE+V+SPGE CDKVFTA+C+G IID LLECLK WNGAPLP+C
Sbjct  656  YKFVREELGTELLTGERVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPVC  711



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKN+++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPL
Sbjct  606  AMKNGESEKNLNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G IIDPLLECLKSWNGAP+PIC
Sbjct  666  YRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC  721



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN++TSIFQKIA FE+ELKALLPKEVE AR+A E+GN AIPN+I ECRSYPL
Sbjct  196  ALVNGENEKNLNTSIFQKIATFEEELKALLPKEVESARAAYESGNAAIPNKINECRSYPL  255

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  256  YKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  311



>gb|AFR41232.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=120

 Score =   186 bits (473),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL N   E+N +TSIFQKI  FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  5    ALVNXXRERNSTTSIFQKIGTFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  64

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  65   YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  120



>dbj|BAD95069.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=120

 Score =   186 bits (473),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  5    ALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  64

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  65   YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  120



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDELK +LP EVE AR  LE+GNP+IPNRITECRSYPL
Sbjct  594  AMKNGESEKNVNSSIFQKIGAFEDELKVVLPNEVENARVILESGNPSIPNRITECRSYPL  653

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  654  YRFVRKELGTELLTGERVRSPGEDIDKVFTALCNGQIIDPLLECLKSWNGAPLPIC  709



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPL
Sbjct  596  ALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  656  YKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  711



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  301  ALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPL  360

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  361  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  416



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPL
Sbjct  602  ALVNGENEKNSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPNKINECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  662  YKFVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  717



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+ENGNPAIPNRI +CRSYPL
Sbjct  559  ALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVENGNPAIPNRIRKCRSYPL  618

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  619  YKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMNKGQIVDPLLECLQEWNGAPLPIC  674



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKN STSIFQKI  FE+ELKALLPKEVE AR ALE+G+PA+PNRI ECRSYPL
Sbjct  167  ALKNGEGEKNASTSIFQKIEQFEEELKALLPKEVEAARLALESGSPAVPNRIAECRSYPL  226

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG   LTGEK  SPGE CDKVFTA+C+G I+DPLL+CLK WNG PLPIC
Sbjct  227  YKFVREELGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>dbj|BAF36973.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=569

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL N E+EKN +TSIFQKI+ FEDELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPL
Sbjct  454  ALVNAENEKNQNTSIFQKISTFEDELKSLLPKEVESARNAYESGNPVIPNKINECRSYPL  513

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  514  YKFVREELGTELLTGEKVRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  569



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL N E+EKN++TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPL
Sbjct  573  ALVNEENEKNMNTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECRSYPL  632

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGTE+LTGEKV+SPGE CDK+FTA+C+G IIDPLLECL  WNGAPLPIC
Sbjct  633  YKFVREGLGTELLTGEKVRSPGEECDKLFTAICEGKIIDPLLECLGEWNGAPLPIC  688



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP+IPNRITECRSYPL
Sbjct  608  AMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECRSYPL  667

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  668  YRLVRQELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  584  ALTNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPL  643

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE LTGEK +SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPIC
Sbjct  644  YKFVREELGTEYLTGEKARSPGEEFDKVFTAMSRGEIIDPLLACLESWNGAPLPIC  699



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN STSIFQKI AFE+ELKALLPKEVE AR ALE GNPA+PNRITECRSYPL
Sbjct  596  ALKNGENEKNASTSIFQKIEAFEEELKALLPKEVESARMALEAGNPAVPNRITECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREE GTE LTGEKV SPGE CDKVFTA+ +G IID LL CL++WNGAPLPIC
Sbjct  656  YKFIREEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDSLLTCLEAWNGAPLPIC  711



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E N STSIFQKI AFE+ELKALLPKEVE AR  LENGNPAIPNRITECRSYPL
Sbjct  596  ALMNGEKEHNSSTSIFQKIGAFEEELKALLPKEVESARHELENGNPAIPNRITECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  656  YKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>gb|AFR41218.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
Length=118

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL   E E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  3    ALVXXERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  62

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  63   YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  118



>dbj|BAF36969.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=437

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EK+  TSIFQKI +FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPL
Sbjct  322  ALVNGENEKDSKTSIFQKIGSFEDELKSLLPKEVESARAAYESGNPAIPNKINECRSYPL  381

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  382  YKFVREELGTELLTGEKSRSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  437



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  465  ALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPL  524

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  525  YKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  580



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E N STSIFQKI  FEDELKALLPKEVE AR  LENGNPAIPNRITECRSYPL
Sbjct  596  ALMNGEKEHNSSTSIFQKIGVFEDELKALLPKEVESARLELENGNPAIPNRITECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  656  YKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN ++SIFQKI AFE ELKA+LPKEVE AR +LENGNPAI NRI ECRSYPL
Sbjct  597  ALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  657  YRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKIAAFE+ELK +LPKEVE AR +LENGN AIPNRI +CRSYPL
Sbjct  600  ALTNGENEKNTSTSIFQKIAAFEEELKVVLPKEVESARVSLENGNAAIPNRIKDCRSYPL  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REE+GT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  660  YKFVREEIGTGLLTGEKVKSPGEEFDKVFTAICQGKIIDPMLECLKEWNGAPLPIC  715



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN ++SIFQKI AFE ELKA+LPKEVE AR +LENGNPAI NRI ECRSYPL
Sbjct  597  ALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  657  YRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   191 bits (484),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ E++ STSIFQKIAAFE+ELKALLPKEVE  R+  ENG  AIPNRI ECRSYPL
Sbjct  215  ALSNGDKERSTSTSIFQKIAAFEEELKALLPKEVETTRAEYENGKTAIPNRIKECRSYPL  274

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  346
            YKF+REELGT++LTGEKV+SPGE CDKVF+A+C G +IDPLL+CLK WNGAPLPI
Sbjct  275  YKFVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  329



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPL
Sbjct  589  ALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPNKINECRSYPL  648

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  649  YKFVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  704



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKNVSTSIFQKI AFE+ELKALLPKEVE  R+ LE+GNP IPNRI +CRSYPL
Sbjct  595  ALNNGENEKNVSTSIFQKIVAFEEELKALLPKEVESTRAGLESGNPFIPNRIKDCRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL  WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSGWNGAPLPIC  710



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  605  ALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  665  YKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  605  ALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  665  YKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKN+STSIFQKI AFE+E+K LLPKEVE  R+A+ENGN AIPNRI ECRSYPL
Sbjct  599  ALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPL++CLK WNGAPLPIC
Sbjct  659  YKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>ref|XP_003625662.1| Phenylalanine ammonia-lyase [Medicago truncatula]
Length=456

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPL
Sbjct  341  ALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPL  400

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  401  YKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  456



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NG  E NV++SIFQKI AFE+ELKA+LPKEVE AR+ LE+GNP+IPNRITECRSYPL
Sbjct  604  AMKNGVSETNVNSSIFQKIVAFEEELKAVLPKEVESARAMLESGNPSIPNRITECRSYPL  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  664  YRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  719



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQK+AAFE+ELKA+LPKEVE AR +LENGN  IPNRI ECRSYPL
Sbjct  607  ALANGENEKNASTSIFQKVAAFEEELKAILPKEVESARLSLENGNAGIPNRIQECRSYPL  666

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  667  YKFVREELGTGLLTGENVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  722



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKN STSIF KI  FE+ELKALLPKEVE AR ALE+G+PA+PNRI ECRSYPL
Sbjct  167  ALKNGEGEKNASTSIFHKIEQFEEELKALLPKEVEAARMALESGSPAVPNRIAECRSYPL  226

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE+LG   LTGEK  SPGE CDKVFTA+C+G I+DPLL+CLK WNG PLPIC
Sbjct  227  YKFVREQLGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  605  ALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  665  YKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  605  ALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  665  YKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  601  ALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPL  660

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  661  YKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  716



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  599  ALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  659  YKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  714



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKN STSIFQKI AFE+ELK LLPKEVE AR+ALE+GNPAI NRI ECRSYPL
Sbjct  594  ALKNGEGEKNASTSIFQKIEAFEEELKTLLPKEVESARTALESGNPAIANRIAECRSYPL  653

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELG + LTGEKV SPGE CDKVFTA+ +G IIDPLLECL+ WNGAPLPIC
Sbjct  654  YKFIREELGADFLTGEKVVSPGEECDKVFTALSNGLIIDPLLECLQGWNGAPLPIC  709



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  604  ALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPL  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  664  YKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  604  ALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPL  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  664  YKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKN+++SIFQKI AFEDEL A+LPKEVE AR+ LE+GNP+IPNRITECRSYPL
Sbjct  605  AMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G I DPLLECLKSWNGAPLPIC
Sbjct  665  YRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQINDPLLECLKSWNGAPLPIC  720



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPL
Sbjct  602  ALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNGAPLPIC
Sbjct  662  YKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPIC  717



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN++TSIFQKIA FEDELK LLPKEVE AR+A E+GNPAIPN+I  CRSYPL
Sbjct  608  ALVNGENEKNLNTSIFQKIATFEDELKTLLPKEVESARAAYESGNPAIPNKINGCRSYPL  667

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLP+C
Sbjct  668  YKFVREELGTSLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPVC  723



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPL
Sbjct  611  ALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPL  670

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVFTA+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  671  YKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  726



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKN+STSIFQKI AFE+E+K LLPKEVE  R+A+ENGN AIPNRI ECRSYPL
Sbjct  599  ALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPL++CLK WNGAPLPIC
Sbjct  659  YKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  604  ALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPL  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  664  YKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPL
Sbjct  602  ALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVFTA+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  662  YKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  717



>gb|AFK47120.1| unknown [Lotus japonicus]
Length=206

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+N + EKNV+TSIFQKIA FEDELKA+LPKEVE AR A +NG  AIPN+I ECRSYPL
Sbjct  91   ALENADAEKNVNTSIFQKIAIFEDELKAILPKEVESARVAYDNGESAIPNKIKECRSYPL  150

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  151  YKFVREELGTGLLTGEKVKSPGEDFDKLFTAMCQGKIIDPILECLGEWNGAPLPIC  206



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN +TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I ECRSYPL
Sbjct  301  ALANGENEKNTNTSIFQKIASFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPL  360

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  361  YKFVREELGTALLTGERVISPGEECDKVFTALCQGNIIDPLLECLGEWNGAPLPIC  416



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+  E+GNP I NRITECRSYPL
Sbjct  589  AMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRNRITECRSYPL  648

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  649  YRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPIC  704



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+  E+GNP I NRITECRSYPL
Sbjct  589  AMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRNRITECRSYPL  648

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  649  YRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPIC  704



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAICEGKIIDPLLDCLSAWNGAPLPIC  710



>dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=357

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  242  ALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  301

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  302  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  357



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRITECRSYPL
Sbjct  596  ALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  656  YKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  592  ALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECRSYPL  651

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  652  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  707



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ EK++STSIFQKI AFEDELKALLPKEVE AR ALE+GNPAI NRITECRSYPL
Sbjct  596  ALKNGDGEKSLSTSIFQKIEAFEDELKALLPKEVESARIALESGNPAIANRITECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELGT  LTGEKV SPGE CDKVFTA+  G I+DPLL+CL  WNGAPLPIC
Sbjct  656  YKFIREELGTNFLTGEKVTSPGEECDKVFTALSKGLIVDPLLKCLDGWNGAPLPIC  711



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G PA+ NRI ECRSYPL
Sbjct  234  ALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECRSYPL  293

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIRE LGT  LTGEK  SPGE CDKVFTA+CDG I+DPLLECL+ WNG PLPIC
Sbjct  294  YKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  349



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR A+E+GNP+ PNRI ECRSYPL
Sbjct  595  ALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGAVESGNPSTPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  571  ALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPL  630

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  631  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  686



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRITECRSYPL
Sbjct  596  ALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  656  YKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR+++ENGN AIPN+I ECRS+PL
Sbjct  605  ALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECRSFPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  665  YKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  720



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR A ENGNPAI N+I ECRSYPL
Sbjct  597  ALANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REE+GT +LTGEK++SPGE  DKVFTA+C G IIDP+L+CLK WNGAPLPIC
Sbjct  657  YKFVREEIGTGLLTGEKIRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  712



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPL
Sbjct  602  ALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  662  YKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG++E+N++TSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPL
Sbjct  601  ALKNGDNERNMNTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPL  660

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+R+ELG E LTGEKV SPGE  DKVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  661  YKFVRKELGIEYLTGEKVTSPGEEFDKVFIAMSKGEIIDPLLECLESWNGAPLPIC  716



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKN+STSIFQKIAAFEDELKALLPKEVE AR+ +E+GNPAIPNRI ECRSYPL
Sbjct  593  ALKNGETEKNLSTSIFQKIAAFEDELKALLPKEVESARAVVESGNPAIPNRIKECRSYPL  652

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELGT  LTGEKV SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPI 
Sbjct  653  YKFIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPIA  708



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPL
Sbjct  569  ALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECRSYPL  628

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPL+ECL  WNGAPLPIC
Sbjct  629  YKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNGAPLPIC  684



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN++TSIFQKIA FEDELKALLPKEVE AR+A E+GNPAIPN+I ECRSYPL
Sbjct  604  ALVNGEYEKNLNTSIFQKIATFEDELKALLPKEVESARAAYESGNPAIPNKIKECRSYPL  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPG   DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  664  YKFVREELGTGLLTGEKVRSPGGEFDKLFTAMCRGKIIDPLLECLGEWNGAPLPIC  719



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKIAAFE+ELKALLPKEVE AR+A ENGN AI N+ITECRSYPL
Sbjct  611  ALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECRSYPL  670

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE+LGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL+ WNG PLPIC
Sbjct  671  YKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLRGWNGEPLPIC  726



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   196 bits (499),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+++KN +TSIFQKI AFE+ELKA+LPKEVE ARSA+ENGN A+ NRI ECRSYPL
Sbjct  675  ALKNGDNQKNAATSIFQKIEAFEEELKAVLPKEVESARSAVENGNAAVGNRIKECRSYPL  734

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE LTGEK+ SPGE CDKVFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  735  YKFMREELGTEFLTGEKLTSPGEECDKVFTALSKGLIVDPLLECLEGWNGAPLPIC  790



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELK +LPKEVE AR+A E+GN AIPNRI ECRSYPL
Sbjct  615  ALTNGENEKNASTSIFQKITAFEEELKTILPKEVESARAAYESGNAAIPNRIVECRSYPL  674

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVFTA+C G IIDP+L+CL  WNG PLPIC
Sbjct  675  YKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGNIIDPILDCLSGWNGEPLPIC  730



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_011041027.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X2 [Populus 
euphratica]
Length=711

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  596  ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  656  YKFVREELGTRLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  711



>ref|XP_003591877.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES62128.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=722

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNG+ E N STSIFQKI AFE+ELKALLPKEVE AR  +ENGNPA+PN I ECRSYPL
Sbjct  607  ALQNGDKEANSSTSIFQKIGAFEEELKALLPKEVENARVEIENGNPAVPNMIKECRSYPL  666

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEK++SPGE CDKVFTA+CDG  IDP+L+CLK WNG PLPIC
Sbjct  667  YKFMRETLGTSLLTGEKIRSPGEDCDKVFTAMCDGRFIDPMLDCLKEWNGVPLPIC  722



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDELK +LP EVE AR  LE G+P IPNRITECRSYPL
Sbjct  467  AMKNGESEKNVNSSIFQKIGAFEDELKVVLPDEVENARVVLEGGSPLIPNRITECRSYPL  526

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  346
            Y+F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPI
Sbjct  527  YRFVRKELGTELLTGERVRSPGEDVDKVFTALCNGQIIDPLLECLKSWNGAPLPI  581



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  596  ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  656  YKFVREELGTRLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  711



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPL
Sbjct  575  ALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECRSYPL  634

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPL+ECL  WNGAPLPIC
Sbjct  635  YKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNGAPLPIC  690



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG +E N STSIFQKIAAFE+ELK LLPKEVE +R +++NGNPAIPN+ITECRSYPL
Sbjct  603  ALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIQNGNPAIPNKITECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  663  YKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  718



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  605  ALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  665  YKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_011041026.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X1 [Populus 
euphratica]
Length=749

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  634  ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPL  693

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  694  YKFVREELGTRLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  749



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  605  ALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  665  YKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EK+ ++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP+IPNRITECRSYPL
Sbjct  608  AMKNGESEKHFNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECRSYPL  667

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  668  YRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  723



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG +E N STSIFQKIAAFE+ELK LLPKEVE +R ++ENGNPAIPN+IT+CRSYPL
Sbjct  555  ALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIENGNPAIPNKITKCRSYPL  614

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  615  YKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  670



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  605  ALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  665  YKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>emb|CAB42793.1| phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata]
Length=721

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPL
Sbjct  606  ALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  666  YRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP I N+I ECRSYPL
Sbjct  615  ALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTISNKINECRSYPL  674

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  675  YKFVREELGTELLTGEKSRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  730



>ref|XP_006481493.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
Length=721

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPL
Sbjct  606  ALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  666  YRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPL
Sbjct  605  ALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  665  YKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKIAAFE+ELK+LLPKEVE AR A ENGN AI N+ITECRSYPL
Sbjct  420  ALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVESARIAYENGNAAISNKITECRSYPL  479

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  480  YKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  535



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG++EKN STSIFQKIAAFE+ELK LLPKEVE AR+A ENGN ++PN+I ECRSYPL
Sbjct  599  ALENGDNEKNSSTSIFQKIAAFEEELKTLLPKEVERARTAYENGNSSVPNKIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE+LG  +LTGEK +SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  659  YKFVREDLGAGLLTGEKTRSPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  714



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPL
Sbjct  595  ALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  YKFVREELGTGLLTGETVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL N E+EKNV+TSIFQKI  FE+ELK LLPKEVEGAR A ENG  AIPN+I ECRSYPL
Sbjct  600  ALANAENEKNVNTSIFQKITTFEEELKTLLPKEVEGARIAYENGQSAIPNKIKECRSYPL  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLEC+  WNGAPLP+C
Sbjct  660  YKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGAPLPLC  715



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN STSIFQKI AFE ELKA+LPKEVE AR ALE+G PAI NRITECRSYPL
Sbjct  598  ALKNGENEKNASTSIFQKIEAFEAELKAVLPKEVESARVALEDGKPAIANRITECRSYPL  657

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELGT  LTGEKV SPGE CD+VFTA+  G I+DPLL+CL+ WNGAPLPIC
Sbjct  658  YKFIREELGTNFLTGEKVMSPGEECDRVFTAMSKGLIVDPLLKCLEGWNGAPLPIC  713



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECRSYPL
Sbjct  265  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPL  324

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  325  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  380



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECRSYPL
Sbjct  265  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPL  324

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  325  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  380



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP I NRITECRSYPL
Sbjct  605  AMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPLIRNRITECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLK WNGAPLPIC
Sbjct  665  YRLVREELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKRWNGAPLPIC  720



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G   +PNRITECRSYPL
Sbjct  602  ALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGTAGVPNRITECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGE+V+SPGE CDKVF+A+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  662  YKFVREELGAEYLTGEEVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR+  +NGNPAIPN+I ECRSYPL
Sbjct  604  ALLNGEKEKNSSTSIFQKIGAFEEELKALLPKEVENARTEYDNGNPAIPNKIKECRSYPL  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEK++SPGE  DKVF+A+C G +IDP+LECLK WNGAPLPIC
Sbjct  664  YKFVREELGTGLLTGEKIRSPGEEFDKVFSAMCAGKLIDPMLECLKEWNGAPLPIC  719



>ref|XP_006428758.1| hypothetical protein CICLE_v10011134mg [Citrus clementina]
 gb|ESR41998.1| hypothetical protein CICLE_v10011134mg [Citrus clementina]
Length=757

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPL
Sbjct  642  ALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPL  701

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  702  YRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  757



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPL
Sbjct  609  ALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPL  668

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  669  YKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  724



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPL
Sbjct  609  ALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPL  668

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  669  YKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  724



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNG+ E + STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  504  ALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPL  563

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G  IDPLL+CLK WNGAPLPIC
Sbjct  564  YKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  619



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR+++ENGN AIPN+I ECRS+PL
Sbjct  605  ALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECRSFPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  665  YKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGRIIDPMLECLEEWNGAPLPIC  720



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  596  ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  656  YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  596  ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  656  YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  596  ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  656  YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|KDO50672.1| hypothetical protein CISIN_1g037382mg [Citrus sinensis]
Length=555

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPL
Sbjct  440  ALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPL  499

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+ +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  500  YRLVREELGTNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLWEWNGAPLPIC  555



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ E N STSIFQKI AFE ELK LLPKEVE  R  +ENGNPA+PNRI ECRSYPL
Sbjct  603  ALENGDREGNSSTSIFQKIGAFEQELKTLLPKEVESVRVDVENGNPAVPNRIIECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEK++SPGE CDKVF A+CDG  IDP+L+CLK WNGAPLPIC
Sbjct  663  YKFVRENLGTSLLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNGAPLPIC  718



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ EKN +TSIFQKI AFE+ELK LLPKEVEGAR   ENGN AIPNRI ECRSYPL
Sbjct  598  ALMNGDREKNSTTSIFQKIGAFEEELKTLLPKEVEGARIEFENGNAAIPNRIEECRSYPL  657

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEKV SPGE CDKVF+A+C G +IDPLLECLK WNGAPLPIC
Sbjct  658  YKFVREVLGTSLLTGEKVISPGEECDKVFSAMCAGKLIDPLLECLKEWNGAPLPIC  713



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  596  ALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  656  YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>ref|XP_010107516.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
 gb|EXC16198.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
Length=534

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKIAAFE+ELK+ LPKEVE AR A ENGN AI N+ITECRSYPL
Sbjct  419  ALTNGESEKNTSTSIFQKIAAFEEELKSFLPKEVESARIAYENGNAAISNKITECRSYPL  478

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  479  YKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  534



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNG+ E + STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  602  ALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G  IDPLL+CLK WNGAPLPIC
Sbjct  662  YKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  717



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN +TSIFQKI+AFE+ELK +LPKEVE AR+A E+GN AIPNRI ECRSYPL
Sbjct  609  ALTNGENEKNANTSIFQKISAFEEELKTILPKEVESARAACESGNAAIPNRIIECRSYPL  668

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG E LTGEKV+SPGE CDKVFTA+C G IIDP+L+CL  WNG PLPIC
Sbjct  669  YKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGKIIDPILDCLSGWNGEPLPIC  724



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STS+FQKIAAFEDELKALLPKEVE AR+A ++GN AI N+I ECRSYPL
Sbjct  599  ALANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIENKIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V+SPGE  DKVFTA+C+G IIDP+LECL  WNGAPLPIC
Sbjct  659  YKFVREELGTGLLTGENVRSPGEEFDKVFTAMCEGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKIAAFE+ELK+LLPKEVE AR A ENGN AI N+ITECRSYPL
Sbjct  610  ALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVESARIAYENGNAAISNKITECRSYPL  669

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  670  YKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  725



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL N E+EK+V+TSIFQKIA FE+ELK +LPKEVE  R+A E+G  AIPN+I ECRSYPL
Sbjct  125  ALINAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPNKIKECRSYPL  184

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  185  YKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  240



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKIAAFE+ELKALLPKEVE AR+A ENGN AI N+ITECRSYPL
Sbjct  611  ALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECRSYPL  670

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE+LGT +LTGEKV+SPGE  DKV+TA+C G +IDP+L CL  WNG PLPIC
Sbjct  671  YKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLACLSGWNGEPLPIC  726



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECRSYPL
Sbjct  602  ALANGENEKNTSTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  662  YKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  717



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNG+ E N STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  504  ALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPL  563

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK W GAPLPIC
Sbjct  564  YKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  619



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE GNPAI NRI+ECRSYPL
Sbjct  596  ALKNGETEKNVSTSIFHKIEAFEEELKALLPKEVESARIALEGGNPAIANRISECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELG   LTGEK  SPGE CD+VFTA+ +G I+DPLL CL+ WNGAPLPIC
Sbjct  656  YKFIREELGASFLTGEKTTSPGEECDRVFTALSNGLIVDPLLNCLQGWNGAPLPIC  711



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +2

Query  17   EHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  196
            ++EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLYK +R
Sbjct  608  KNEKNVNSSIFQKIVAFEDELKAVLPKEVENARAVVESGNPAIPNRITECRSYPLYKLVR  667

Query  197  EELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            ++LGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLK+WNGAP+PIC
Sbjct  668  QQLGTELLTGEKVRSPGEDIEKVFTAICNGEIIDPLLECLKNWNGAPIPIC  718



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EK  +TSIFQKI AFEDEL A LPKEVE AR ALE+GNPAIPN+I ECRSYPL
Sbjct  598  ALKNGETEKEANTSIFQKIGAFEDELIANLPKEVESARIALESGNPAIPNKINECRSYPL  657

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEKV+SPGE CDKVFTA+  G IIDPLLECL  WNG PLPIC
Sbjct  658  YKFVREELGTELLTGEKVRSPGEECDKVFTAMSKGLIIDPLLECLNGWNGEPLPIC  713



>ref|XP_010107518.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16200.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=769

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKIAAFE+ELK+LLPKEVE AR A ENGN AI N+ITECRSYPL
Sbjct  654  ALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVESARIAYENGNAAISNKITECRSYPL  713

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  714  YKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  769



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EK+V+TSIF KIA FE+ELKA+LPKEVE AR+++ENG PAI NRI ECRSYPL
Sbjct  595  ALDNGENEKDVNTSIFHKIAIFEEELKAILPKEVENARASVENGIPAISNRIEECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE+LTGEKV+SPGE  DKVFTA+C+G ++DPLL CL++WNGAPLPIC
Sbjct  655  YKFVREELGTELLTGEKVRSPGEELDKVFTAMCEGKLVDPLLACLEAWNGAPLPIC  710



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKIA FE+EL A+LPKEVE AR  LENGN AIPN I +CRSYPL
Sbjct  606  ALTNGESEKNTSTSIFQKIADFEEELHAVLPKEVESARVTLENGNAAIPNMIKDCRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  666  YKFVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +2

Query  17   EHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  196
            ++EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLYK +R
Sbjct  609  KNEKNVNSSIFQKIVAFEDELKAVLPKEVENARAVVESGNPAIPNRITECRSYPLYKLVR  668

Query  197  EELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            ++LGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLK+WNGAP+PIC
Sbjct  669  QQLGTELLTGEKVRSPGEDIEKVFTAICNGEIIDPLLECLKNWNGAPIPIC  719



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPL
Sbjct  599  ALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  659  YKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STS+FQKIAAFEDELKALLPKEVE AR+A ++GN AI N+I ECRSYPL
Sbjct  600  ALANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIENKIKECRSYPL  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  660  YKFVREELGTGLLTGENVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  715



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  596  ALVNGERETNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  656  YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AGA84059.1| phenylalanine ammonia lyase [Picrorhiza kurrooa]
Length=713

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EKN STSIF KI AFE+ELK+LLPKEVE AR ALE GNPAI NRI ECRSYPL
Sbjct  598  ALKNGESEKNASTSIFHKIEAFEEELKSLLPKEVESARIALEAGNPAIGNRIKECRSYPL  657

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELGTE LTGEKV SPGE CDK+FTA+  G I+DPLL+CL+ WNGAPLPIC
Sbjct  658  YKFIREELGTEYLTGEKVISPGEECDKIFTAISKGLIVDPLLKCLEGWNGAPLPIC  713



>ref|XP_010426963.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   192 bits (488),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPNRITECRSYPL
Sbjct  603  ALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  663  YKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKMIDPLMDCLKEWNGAPIPIC  718



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN STSI Q+I AFE+ELKALLPKEVE AR ALE GNPA+PNRITECRSYPL
Sbjct  596  ALKNGENEKNASTSILQEIEAFEEELKALLPKEVESARMALEAGNPAVPNRITECRSYPL  655

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIR E GTE LTGEKV SPGE CDKVFTA+ +G IID LL CL++WNGAPLPIC
Sbjct  656  YKFIRGEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDQLLTCLEAWNGAPLPIC  711



>gb|KHN39030.1| Phenylalanine ammonia-lyase class 2 [Glycine soja]
Length=619

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN +TSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECRSYPL
Sbjct  504  ALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPL  563

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  564  YKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  619



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKNVSTSIFQKI AFE ELKA+LPKEVE AR ALE+GNPAI NRITECRSYPL
Sbjct  593  ALNNGESEKNVSTSIFQKIEAFEVELKAILPKEVESARIALESGNPAIGNRITECRSYPL  652

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREELGT  LTGEKV SPGE CDKVFTA+  G I+DPLL+CL+ WNGAP PIC
Sbjct  653  YKFIREELGTNYLTGEKVVSPGEECDKVFTALSKGLIVDPLLKCLEGWNGAPPPIC  708



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN +TSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECRSYPL
Sbjct  601  ALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPL  660

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  661  YKFVREELGTALLTGERVVSPGEECDKVFTAMCQGKIIDPLLECLGEWNGAPLPIC  716



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  611  ALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  670

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAPLPIC
Sbjct  671  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPLPIC  726



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   192 bits (487),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  +GN AIPNRI ECRSYPL
Sbjct  603  ALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGSGNAAIPNRIKECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNGAP+PIC
Sbjct  663  YKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  718



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI  FE+EL+A+LPKEVE AR  LENGN AIPN I +CRSYPL
Sbjct  606  ALTNGESEKNTSTSIFQKITDFEEELQAVLPKEVESARVTLENGNAAIPNMIKDCRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  666  YKFVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG+ EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G PA+ NRI ECRSYPL
Sbjct  595  ALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIRE LGT  LTGEK  SPGE CDKVFTA+CDG I+DPLLECL+ WNG PLPIC
Sbjct  655  YKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  710



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG +E N STSIFQKIAAFE+ELK LLPKEVE +R ++ENGN AIPN+I ECRSYPL
Sbjct  603  ALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSVENGNAAIPNKIMECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  663  YKFVREELGTGLLTGEKVKSPGEEFDKVFIAICQGKVIDPMLECLKEWNGAPLPIC  718



>gb|ACF94715.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=332

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL N + EKN++TSIFQKI  FE+ELK LLPKEVE AR A ENG  AIPN+I ECRSYPL
Sbjct  217  ALANADGEKNLNTSIFQKITTFEEELKTLLPKEVESARVAYENGQCAIPNKIEECRSYPL  276

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  277  YKFVREELGTGLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  332



>ref|XP_010515816.1| PREDICTED: phenylalanine ammonia-lyase 2 [Camelina sativa]
Length=718

 Score =   191 bits (486),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPNRITECRSYPL
Sbjct  603  ALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  663  YRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 [Populus sieboldii 
x Populus grandidentata]
 dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=682

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNP +PNRI ECRSYPL
Sbjct  567  ALVNGERETNSTTSIFQKIRSFEEELKTLLPKEVESARLEVENGNPVVPNRIKECRSYPL  626

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G ++DPLLECLK WNGAPLPIC
Sbjct  627  YKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGAPLPIC  682



>ref|XP_010684079.1| PREDICTED: phenylalanine ammonia-lyase [Beta vulgaris subsp. 
vulgaris]
 emb|CAH17686.1| phenylalanine ammonia lyase [Beta vulgaris]
Length=719

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ EKNVSTSIFQKI AFE+ELKA LPKEVE AR+A E+GN  IPNRI ECRSYP+
Sbjct  604  ALANGDSEKNVSTSIFQKIGAFEEELKARLPKEVEAARAAYESGNSVIPNRIKECRSYPV  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIREEL T +LTGEKV SPGE  DKVFTA+C G IIDPLL+CLK WNGAPLPIC
Sbjct  664  YKFIREELNTNLLTGEKVISPGEEIDKVFTAICQGKIIDPLLDCLKEWNGAPLPIC  719



>sp|Q04593.1|PAL2_PEA RecName: Full=Phenylalanine ammonia-lyase 2 [Pisum sativum]
 dbj|BAA00887.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=724

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN++TSIFQKIA FEDELK LLPKEVE AR A ENGN  I N+I ECRSYPL
Sbjct  609  ALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESARGAYENGNTTISNKIKECRSYPL  668

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPI 
Sbjct  669  YKFVREELGTSLLTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNGAPLPIS  724



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPL
Sbjct  600  ALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPL  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG+PLPIC
Sbjct  660  YKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPL
Sbjct  600  ALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPL  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG+PLPIC
Sbjct  660  YKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AIPNRI ECRSYPL
Sbjct  605  ALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIPNRIKECRSYPL  664

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YK +RE++GT +LTGEKV+SPGE  DKVFTA+C+G +IDP+LECLK WNGAPLPIC
Sbjct  665  YKIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGAPLPIC  720



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  610  ALVNGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  669

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  670  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN ++SIFQKI  FE+ELK +LPKEVE ARSA ENGNP + N+I +CRSYPL
Sbjct  599  ALANGEDEKNTNSSIFQKIHVFEEELKVVLPKEVESARSAYENGNPTVQNQIKKCRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIR+ELGTE+LTGEK +SPGEVC+KVFTA+C G +IDP+LECLK WNGAP+PIC
Sbjct  659  YKFIRKELGTELLTGEKAKSPGEVCEKVFTALCQGKMIDPILECLKEWNGAPIPIC  714



>sp|P19142.1|PAL2_PHAVU RecName: Full=Phenylalanine ammonia-lyase class 2; AltName: Full=Phenylalanine 
ammonia-lyase class II [Phaseolus vulgaris]
 prf||1807329A Phe ammonia lyase
Length=712

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I +CRSYPL
Sbjct  597  ALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE CDKVF+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  657  YKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC  712



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  610  ALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  669

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  670  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  610  ALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  669

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  670  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   191 bits (484),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL N E+EK+ STSIFQKI AFEDELKA+LPKEVE +R ALE+GNPAIPNRI +CRSYPL
Sbjct  597  ALNNTENEKSGSTSIFQKIEAFEDELKAVLPKEVESSRVALESGNPAIPNRIKDCRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+R+EL TE LTGE+V SPGEV DKVFTA+  G +IDP+LECLK WNGAPLPIC
Sbjct  657  YKFVRDELKTEFLTGERVTSPGEVLDKVFTAMSKGLMIDPMLECLKGWNGAPLPIC  712



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNG+ E N STSIFQKI AFE+EL ALLPKEVE +R  +ENGNPAIPNRI ECRSYPL
Sbjct  602  ALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESSRIEVENGNPAIPNRIKECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK W GAPLPIC
Sbjct  662  YKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  717



>emb|CDY18464.1| BnaA04g21230D [Brassica napus]
Length=423

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECRSYPL
Sbjct  308  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPL  367

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  368  YRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  423



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPL
Sbjct  599  ALANGENEKNTSTSVFQKITAFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  659  YKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|ABE03772.1| phenylalanine ammonia-lyase [Arnebia euchroma]
Length=709

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EK+V+TSIF KIA FEDELKA+LPKEVE AR+++ENG PAI NRI ECRSYPL
Sbjct  594  ALANGENEKDVNTSIFHKIAIFEDELKAILPKEVENARASVENGTPAILNRIEECRSYPL  653

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGTE LTGEKV+SPGE  DKVFTA+C+G ++DPLL CL++WN APLPIC
Sbjct  654  YKFVREELGTEFLTGEKVRSPGEELDKVFTALCEGKLVDPLLACLEAWNVAPLPIC  709



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPL
Sbjct  599  ALANGENEKNASTSVFQKIGAFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  659  YKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STS+FQKIA FE+ELKALLPKEVE AR+A ++GN AI N+I ECRSYPL
Sbjct  599  ALANGENEKNASTSVFQKIATFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  659  YKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I +CRSYPL
Sbjct  597  ALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV SPGE CDKVF+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  657  YKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC  712



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE  +N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  595  ALVNGEKVRNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  655  YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  710



>ref|XP_002315309.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
Length=707

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E+N +T+I QKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPL
Sbjct  592  ALVNGERERNSTTTILQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPL  651

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  652  YKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  707



>ref|XP_006403711.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
 dbj|BAJ33750.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45164.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
Length=725

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKNV+TSIFQKI AFE+ELKA LPKEVE  R+A  NG  AIPNRI ECRSYPL
Sbjct  610  ALCNGETEKNVATSIFQKIGAFEEELKATLPKEVEATRAAFGNGTAAIPNRIKECRSYPL  669

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNGAP+PIC
Sbjct  670  YKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  725



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN STSIFQKI AFEDELKALLPKEVE  R   ENGN AI NRI +CRSYPL
Sbjct  608  ALINGEREKNSSTSIFQKIVAFEDELKALLPKEVESTRIDYENGNSAISNRIKDCRSYPL  667

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG   LTGEK  SPGE CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  668  YKFVREELGASFLTGEKTTSPGEECDKVFTAMCAGKLIDPLLDCLKEWNGAPLPIC  723



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN +TSIFQKI AFE+ELKALLPKEVEGAR A E+G+PA+PNRI ECRSYP+
Sbjct  600  ALLNGENEKNSNTSIFQKITAFEEELKALLPKEVEGARIAYESGSPAVPNRIKECRSYPI  659

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE+L T +LTGEKV+SPGE  DKVF+A+C+G +IDPLL+CL+ WNGAPLPIC
Sbjct  660  YKFVREQLHTGLLTGEKVRSPGEEFDKVFSAMCEGKMIDPLLDCLRDWNGAPLPIC  715



>ref|XP_009141625.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=722

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  607  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPL  666

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  667  YRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>gb|ABC69916.1| phenylalanine ammonia-lyase [Brassica napus]
Length=722

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  607  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPL  666

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  667  YRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>ref|XP_010516949.1| PREDICTED: phenylalanine ammonia-lyase 1 [Camelina sativa]
Length=727

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  612  ALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  671

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REE+GTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  672  YRFVREEIGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  727



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   190 bits (482),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG++EKN +TSIFQKI+AFE ELK LLPKEVE AR+A E+GN  IPNRI ECRSYPL
Sbjct  606  ALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REE GT ILTG+KV+SPGE  DKVFTA+C G IIDPL++CLK WNGAPLPIC
Sbjct  666  YKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   190 bits (482),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG++EKN +TSIFQKI+AFE ELK LLPKEVE AR+A E+GN  IPNRI ECRSYPL
Sbjct  606  ALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPL  665

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REE GT ILTG+KV+SPGE  DKVFTA+C G IIDPL++CLK WNGAPLPIC
Sbjct  666  YKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>gb|ABY89691.1| phenylalanine ammonialyase 2 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  607  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPL  666

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  667  YRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>gb|AAX22055.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22056.1| phenylalanine ammonia-lyase [Brassica napus]
Length=723

 Score =   190 bits (482),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELK +LPKEV+ AR A  NG  AIPNRI ECRSYPL
Sbjct  608  ALSNGETEKNAVTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPL  667

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL+ECLK WNGAP+PIC
Sbjct  668  YKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  723



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   190 bits (482),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELK +LPKEV+ AR A  NG  AIPNRI ECRSYPL
Sbjct  608  ALSNGETEKNAVTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPL  667

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL+ECLK WNGAP+PIC
Sbjct  668  YKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  723



>ref|XP_009116020.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 2 
[Brassica rapa]
Length=725

 Score =   190 bits (482),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELK +LPKEV+ AR A  NG  AIPNRI ECRSYPL
Sbjct  610  ALSNGETEKNAVTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPL  669

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL+ECLK WNGAP+PIC
Sbjct  670  YKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  725



>gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala]
Length=365

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNG  E + +TSIF KIAAFE ELK LLPKEVE AR  +ENG  AIPNRI ECRSYPL
Sbjct  250  ALQNGNRENDANTSIFLKIAAFEKELKTLLPKEVESARIEVENGKSAIPNRIKECRSYPL  309

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK WNGAPLP+C
Sbjct  310  YRFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNGAPLPLC  365



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            A+ NGE EKN STSIFQKI AFE+ELK LLPKEVE AR+  ENGNPAI N+I ECRSYPL
Sbjct  595  AMMNGEKEKNSSTSIFQKIGAFEEELKTLLPKEVESARTEYENGNPAISNKIKECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG  +LTGEK++SPGE  DKVF+A+C G +IDP+LECLK WNGAPLPIC
Sbjct  655  YKFVREELGCSLLTGEKIRSPGEEFDKVFSAICAGKLIDPMLECLKEWNGAPLPIC  710



>gb|AGF50182.1| phenylalanine ammonia lyase, partial [Salvia officinalis]
Length=282

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE EK+VSTSIF KI  FE+EL ALLPKEVE AR ALE+G+PA+PNRI ECRSYPL
Sbjct  167  ALKNGEGEKSVSTSIFHKIEQFEEELMALLPKEVESARIALESGSPAVPNRIAECRSYPL  226

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKFIRE+LG   LTGEK  SPGE CD VFTA+ +G I+DPLL+CLK+WNG PLPIC
Sbjct  227  YKFIREDLGAGFLTGEKAVSPGEECDMVFTALSNGLIVDPLLDCLKAWNGQPLPIC  282



>gb|ACZ36441.1| phenylalanine ammonialyase [Brassica oleracea var. alboglabra]
Length=714

 Score =   190 bits (482),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  599  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPL  658

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGT++LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  659  YRFVREELGTKLLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  714



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NG++EKN+STSIFQKI AFEDELKALLPKEVE AR ALE+GNPAI NRI ECRSYPL
Sbjct  597  ALKNGDNEKNLSTSIFQKIGAFEDELKALLPKEVESARIALESGNPAIANRIKECRSYPL  656

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+FIREELGT  LTGEKV SPGE  DKVFTA+  G I+DPLL+CL+ W+G+PLPIC
Sbjct  657  YRFIREELGTGFLTGEKVTSPGEEGDKVFTALSKGLIVDPLLKCLEGWSGSPLPIC  712



>ref|XP_010504083.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   189 bits (481),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPNRI ECRSYPL
Sbjct  603  ALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRIAECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  663  YRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>gb|AFQ92048.1| phenylalanine ammonia-lyase, partial [Pyrus pyrifolia]
Length=234

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE E +  TSIFQKI AFE+ELK LLPKEV+ A +  ENG  AIPNRI ECRSYPL
Sbjct  119  ALSNGEKEISTGTSIFQKITAFEEELKTLLPKEVDNAWAEYENGKTAIPNRIKECRSYPL  178

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  346
            YKF+REELGT++LTG+KV+SPGE CDKVF A+C G +IDPLL+CLK WNGAPLPI
Sbjct  179  YKFVREELGTDLLTGDKVRSPGEECDKVFNAMCAGKLIDPLLDCLKEWNGAPLPI  233



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   189 bits (480),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKNV TSIFQKI AFE+ELK +LPKEV+ AR A  NGN AIPNRI ECRSYPL
Sbjct  603  ALANGETEKNVETSIFQKIGAFEEELKTVLPKEVDAAREAYGNGNAAIPNRIKECRSYPL  662

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+R ELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNGAP+P+C
Sbjct  663  YKFVRGELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPLC  718



>gb|ABF50788.1| phenylalanine ammonia-lyase [Isatis tinctoria]
Length=725

 Score =   189 bits (480),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LPKEV+ AR+A ENG  AIPNRI ECRSYPL
Sbjct  610  ALVNGESEKNAVTSIFHKIGAFEEELKAVLPKEVDAARAAYENGTSAIPNRIKECRSYPL  669

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGT++LTG++V SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  670  YRFVREELGTQLLTGDRVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE AR+  ENGNPAIPN+I ECRSYPL
Sbjct  595  ALMNGDREKDSTTSIFQKIGVFEEELKTHLPKEVESARTEFENGNPAIPNKIEECRSYPL  654

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+RE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  655  YKFVREVLGTNLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE+EKN STSIFQKI+ FE+ELK LLPKEVE ARSA+E+ N AIPN+I +CRSYPL
Sbjct  601  ALSNGENEKNSSTSIFQKISLFEEELKVLLPKEVESARSAVESDNAAIPNQIKDCRSYPL  660

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+FIR ELGT +LTGEKV SPGE  DKVFTA+C+G +IDPLLECLK WNGAPLPIC
Sbjct  661  YRFIRGELGTALLTGEKVVSPGEEIDKVFTAMCEGKLIDPLLECLKEWNGAPLPIC  716



>ref|XP_009143533.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=719

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECRSYPL
Sbjct  604  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPL  663

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  664  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  719



>sp|P27990.1|PALY_MEDSA RecName: Full=Phenylalanine ammonia-lyase [Medicago sativa]
 emb|CAA41169.1| phenylalanine ammonia-lyase [Medicago sativa]
Length=725

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN +TSIFQKIA FE+ELK LLPKEVE AR+A E+GNP IPN+I  CRSYPL
Sbjct  610  ALVNGESEKNFNTSIFQKIATFEEELKTLLPKEVESARTAYESGNPTIPNKINGCRSYPL  669

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELGT +LTGE V SPGE CDK+F+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  670  YKFVREELGTGLLTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNGAPLPIC  725



>dbj|BAP11146.1| putative phenylalanine ammonia-lyase, partial [Zanthoxylum ailanthoides]
 dbj|BAP11147.1| putative phenylalanine ammonia-lyase, partial [Zanthoxylum ailanthoides]
 dbj|BAP11148.1| putative phenylalanine ammonia-lyase, partial [Zanthoxylum ailanthoides]
 dbj|BAP11149.1| putative phenylalanine ammonia-lyase, partial [Zanthoxylum ailanthoides]
Length=127

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +2

Query  38   TSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEI  217
            +SIFQKI AFE+ELK LLPKEVE AR  +ENGNP IPNRI ECRSYPLYKF+REELGT +
Sbjct  24   SSIFQKIVAFEEELKTLLPKEVENARQIVENGNPTIPNRIKECRSYPLYKFVREELGTSL  83

Query  218  LTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            LTGEKV+SPGE  DKVFTA+C G IIDP+L+CL  WNGAPLPIC
Sbjct  84   LTGEKVKSPGEEFDKVFTAMCQGKIIDPMLDCLSDWNGAPLPIC  127



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            ALQNGE+EKNV TSIF KI +FE+ELKALLPKE E AR +LE+GNPAI NRI ECRSYPL
Sbjct  120  ALQNGENEKNVGTSIFHKIESFEEELKALLPKEDESARISLESGNPAIANRIAECRSYPL  179

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLP  343
            YKFIR ELG   LTGEK  SPGE C+KVFTA+  G I+DPLLECL+ WNGAPLP
Sbjct  180  YKFIRGELGASFLTGEKATSPGEECEKVFTALSKGLIVDPLLECLQGWNGAPLP  233



>gb|AAM12956.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
 gb|AAN15354.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
Length=717

 Score =   189 bits (479),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE AR+A  NG   IPNRI ECRSYPL
Sbjct  602  ALSNGETEKNAVTSIFQKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPNRIKECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  662  YRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  717



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EK+ +TSIFQKI  FE+ELKALLPKEVE  RSA+E+GNPAIPNRI ECRSYPL
Sbjct  594  ALLNGESEKDPNTSIFQKINTFEEELKALLPKEVESIRSAIESGNPAIPNRIKECRSYPL  653

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+R ELGTE+LTGEKV+SPGE  DKVF+A+C G +IDPLLEC+  WNG+PLPIC
Sbjct  654  YKFVRGELGTELLTGEKVRSPGEEIDKVFSAMCQGKLIDPLLECVAEWNGSPLPIC  709



>gb|AAC18871.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=717

 Score =   188 bits (478),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE AR+A  NG   IPNRI ECRSYPL
Sbjct  602  ALSNGETEKNAVTSIFQKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPNRIKECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  662  YRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  717



>ref|NP_190894.1| phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
 sp|P45724.2|PAL2_ARATH RecName: Full=Phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
 gb|AAK32895.1|AF367308_1 AT3g53260/T4D2_190 [Arabidopsis thaliana]
 emb|CAB64229.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
 gb|AAM91425.1| AT3g53260/T4D2_190 [Arabidopsis thaliana]
 gb|AAP59439.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEE79055.1| phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
Length=717

 Score =   188 bits (478),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE AR+A  NG   IPNRI ECRSYPL
Sbjct  602  ALSNGETEKNAVTSIFQKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPNRIKECRSYPL  661

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  662  YRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  717



>gb|AFP86474.1| phenylalanine ammonia-lyase, partial [Brassica rapa subsp. chinensis]
Length=746

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECRSYPL
Sbjct  631  ALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPL  690

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  691  YRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  746



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL+NGE+E+N STSIFQKIAAFE+ELK LLPKEVE AR+  ENGNPAIPN+I E RSYPL
Sbjct  444  ALKNGENERNASTSIFQKIAAFEEELKTLLPKEVESARAEYENGNPAIPNKIKERRSYPL  503

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            YKF+REELG  +LTGEK +SPGE CDKVF+A+  G +IDP+LECLK WNGAPLPI 
Sbjct  504  YKFVREELGAGLLTGEKARSPGEECDKVFSAIYAGKLIDPMLECLKEWNGAPLPIS  559



>ref|XP_006410883.1| hypothetical protein EUTSA_v10016314mg [Eutrema salsugineum]
 gb|ESQ52336.1| hypothetical protein EUTSA_v10016314mg [Eutrema salsugineum]
Length=724

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    ALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  181
            AL NGE EKN  TSIF KI AFE+ELK +LPKEVE AR+A +NG  AIPNRI ECRSYPL
Sbjct  609  ALINGESEKNAVTSIFHKIGAFEEELKTVLPKEVEAARAAYDNGTSAIPNRIKECRSYPL  668

Query  182  YKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  349
            Y+F+REE+GTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  669  YRFVREEIGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  724



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720