BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN004O15

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57279.1|  alpha-expansin                                         347   6e-118   Ipomoea nil [qian niu]
gb|AEQ55271.1|  expansin                                                302   3e-100   Breonia chinensis
ref|NP_001234081.1|  expansin A4 precursor                              300   2e-99    Solanum lycopersicum
ref|XP_006341021.1|  PREDICTED: expansin-A3                             300   3e-99    Solanum tuberosum [potatoes]
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         297   3e-98    Jatropha curcas
emb|CDP06606.1|  unnamed protein product                                297   4e-98    Coffea canephora [robusta coffee]
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        296   6e-98    Nicotiana sylvestris
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        297   7e-98    Nicotiana sylvestris
ref|XP_004249634.1|  PREDICTED: expansin-A3                             295   1e-97    
gb|KHG12430.1|  Expansin-A4 -like protein                               295   2e-97    Gossypium arboreum [tree cotton]
gb|KJB76740.1|  hypothetical protein B456_012G104400                    295   2e-97    Gossypium raimondii
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        296   3e-97    Nicotiana tomentosiformis
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       294   3e-97    Theobroma cacao [chocolate]
ref|XP_004505858.1|  PREDICTED: expansin-A6-like                        294   4e-97    Cicer arietinum [garbanzo]
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       294   5e-97    
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        294   5e-97    
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        293   1e-96    Solanum tuberosum [potatoes]
gb|KHG30766.1|  Expansin-A4 -like protein                               292   2e-96    Gossypium arboreum [tree cotton]
gb|KHN21950.1|  Expansin-A4                                             294   2e-96    Glycine soja [wild soybean]
gb|KHG15821.1|  Expansin-A4 -like protein                               292   3e-96    Gossypium arboreum [tree cotton]
gb|KJB16930.1|  hypothetical protein B456_002G257400                    292   3e-96    Gossypium raimondii
gb|KJB36710.1|  hypothetical protein B456_006G172400                    292   3e-96    Gossypium raimondii
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        291   4e-96    Nicotiana sylvestris
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        291   4e-96    Nicotiana tomentosiformis
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                291   6e-96    Erythranthe guttata [common monkey flower]
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        291   7e-96    
gb|AFB77223.1|  expansin 1                                              291   8e-96    Betula platyphylla [Asian white birch]
gb|KJB46592.1|  hypothetical protein B456_007G376300                    290   2e-95    Gossypium raimondii
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        290   2e-95    Glycine max [soybeans]
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         290   3e-95    Jatropha curcas
ref|XP_007132063.1|  hypothetical protein PHAVU_011G063800g             289   4e-95    Phaseolus vulgaris [French bean]
ref|XP_010256907.1|  PREDICTED: expansin-A4                             289   4e-95    Nelumbo nucifera [Indian lotus]
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        289   5e-95    Glycine max [soybeans]
ref|XP_011094866.1|  PREDICTED: expansin-A6                             289   6e-95    Sesamum indicum [beniseed]
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             288   7e-95    Phaseolus vulgaris [French bean]
ref|XP_004300427.1|  PREDICTED: expansin-A6                             288   7e-95    Fragaria vesca subsp. vesca
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        288   9e-95    Nicotiana tomentosiformis
gb|AEE69071.1|  expansin-4                                              288   9e-95    Petunia hybrid cultivar [hybrid petunia]
ref|XP_003552173.1|  PREDICTED: expansin-A4                             288   9e-95    Glycine max [soybeans]
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        288   1e-94    Prunus mume [ume]
gb|ACJ48968.2|  expansin                                                288   1e-94    Breonia chinensis
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       287   2e-94    
gb|AAR82849.1|  expansin-1                                              287   2e-94    Petunia x hybrida [garden petunia]
gb|AIE54285.1|  expansin                                                287   2e-94    Nicotiana tabacum [American tobacco]
ref|XP_003538409.1|  PREDICTED: expansin-A6                             287   2e-94    Glycine max [soybeans]
ref|NP_001242978.1|  expansin-A4-like precursor                         287   3e-94    Glycine max [soybeans]
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             287   3e-94    Prunus persica
emb|CBI16120.3|  unnamed protein product                                287   3e-94    Vitis vinifera
dbj|BAC67193.1|  expansin                                               286   3e-94    Pyrus communis
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             286   4e-94    Prunus persica
gb|AEQ55274.1|  expansin                                                286   4e-94    Breonia chinensis
gb|KHN17924.1|  Expansin-A3                                             288   5e-94    Glycine soja [wild soybean]
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          286   5e-94    
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        286   5e-94    Solanum lycopersicum
ref|XP_002283530.1|  PREDICTED: expansin-A4                             286   5e-94    Vitis vinifera
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        286   5e-94    Glycine max [soybeans]
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        286   5e-94    Nicotiana sylvestris
ref|XP_008464122.1|  PREDICTED: expansin-A4                             286   5e-94    Cucumis melo [Oriental melon]
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        286   7e-94    Cicer arietinum [garbanzo]
ref|XP_010106493.1|  hypothetical protein L484_025251                   286   7e-94    Morus notabilis
gb|KEH39447.1|  expansin A10                                            286   7e-94    Medicago truncatula
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              286   7e-94    Triphysaria versicolor
gb|AFK34565.1|  unknown                                                 283   8e-94    Medicago truncatula
gb|AEQ55290.1|  expansin                                                286   8e-94    Breonia chinensis
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        286   8e-94    Solanum tuberosum [potatoes]
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      286   8e-94    Gossypium hirsutum [American cotton]
gb|AHL25255.1|  expansin                                                286   9e-94    Boehmeria nivea [Chinese silk-plant]
ref|XP_011019858.1|  PREDICTED: expansin-A6                             285   1e-93    Populus euphratica
ref|XP_011027216.1|  PREDICTED: expansin-A4                             285   1e-93    Populus euphratica
gb|AEQ55275.1|  expansin                                                285   1e-93    Breonia chinensis
gb|ACK36943.1|  expansin                                                285   1e-93    Annona cherimola [cherimoya]
ref|XP_009364387.1|  PREDICTED: expansin-A4                             285   1e-93    Pyrus x bretschneideri [bai li]
ref|XP_002309061.1|  expansin family protein                            285   1e-93    Populus trichocarpa [western balsam poplar]
ref|XP_003616412.1|  Expansin                                           285   2e-93    Medicago truncatula
ref|XP_002298353.1|  alpha-expansin 1 family protein                    285   2e-93    Populus trichocarpa [western balsam poplar]
emb|CDP09064.1|  unnamed protein product                                285   2e-93    Coffea canephora [robusta coffee]
gb|AAT11859.2|  expansin 1                                              285   2e-93    Mangifera indica
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               285   2e-93    Ricinus communis
ref|XP_011035307.1|  PREDICTED: expansin-A6                             285   2e-93    Populus euphratica
gb|AAR82850.1|  expansin-2                                              285   2e-93    Petunia x hybrida [garden petunia]
gb|AEN70914.1|  expansin                                                285   2e-93    Gossypium trilobum
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        285   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        284   3e-93    
ref|NP_001284471.1|  expansin-A4 precursor                              284   3e-93    Cucumis melo [Oriental melon]
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        284   3e-93    Nicotiana sylvestris
ref|XP_002283358.1|  PREDICTED: expansin-A4                             284   3e-93    Vitis vinifera
emb|CAH18933.1|  expansin                                               284   4e-93    Pyrus communis
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        284   4e-93    Nicotiana sylvestris
gb|AAL31480.1|AF319475_1  alpha-expansin 9 precursor                    283   5e-93    Cucumis sativus [cucumbers]
gb|AFZ78606.1|  expansin protein                                        284   5e-93    Populus tomentosa [Chinese white poplar]
ref|XP_003552064.1|  PREDICTED: expansin-A4                             284   5e-93    Glycine max [soybeans]
gb|AEN70891.1|  expansin                                                284   5e-93    Gossypium thurberi
gb|AEN70901.1|  expansin                                                283   6e-93    Gossypium barbadense var. brasiliense
gb|AFK40565.1|  unknown                                                 283   6e-93    Medicago truncatula
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        283   6e-93    Cicer arietinum [garbanzo]
gb|ADY68814.1|  expansin                                                283   6e-93    Gossypium barbadense [Egyptian cotton]
gb|ADY68817.1|  expansin                                                283   6e-93    Gossypium raimondii
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        283   7e-93    Cucumis sativus [cucumbers]
ref|NP_001234881.1|  expansin9 precursor                                283   7e-93    Solanum lycopersicum
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         283   8e-93    Rumex palustris
gb|AAR09168.1|  alpha-expansin 1                                        283   9e-93    Populus tremula x Populus tremuloides
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        283   9e-93    Pyrus x bretschneideri [bai li]
dbj|BAH36862.1|  alpha expansin                                         283   1e-92    Rosa hybrid cultivar
ref|XP_003597354.1|  Cell wall protein Exp5                             280   1e-92    
ref|XP_008357089.1|  PREDICTED: expansin-A6                             283   1e-92    
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        283   1e-92    Cucumis sativus [cucumbers]
ref|XP_008802710.1|  PREDICTED: expansin-A4                             283   1e-92    Phoenix dactylifera
gb|AEN70907.1|  expansin                                                283   1e-92    Gossypium armourianum
gb|ADY68815.1|  expansin                                                283   1e-92    Gossypium barbadense [Egyptian cotton]
gb|ADC35365.1|  alpha-expansin 2                                        283   1e-92    Coffea arabica [arabica coffee]
gb|AEN70893.1|  expansin                                                283   1e-92    Gossypium schwendimanii
gb|KEH22886.1|  expansin-A1-like protein                                283   2e-92    Medicago truncatula
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     282   2e-92    Eucalyptus grandis [rose gum]
ref|NP_001288899.1|  expansin-A6 precursor                              282   2e-92    Brassica rapa
emb|CDY31742.1|  BnaA04g16780D                                          282   2e-92    Brassica napus [oilseed rape]
ref|XP_010685747.1|  PREDICTED: expansin-A4                             282   2e-92    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB55836.1|  hypothetical protein B456_009G098800                    282   2e-92    Gossypium raimondii
gb|ACN94264.1|  expansin                                                282   2e-92    Rehmannia glutinosa [Chinese foxglove]
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         282   2e-92    Jatropha curcas
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        282   2e-92    Elaeis guineensis
gb|KJB73995.1|  hypothetical protein B456_011G266000                    282   3e-92    Gossypium raimondii
ref|XP_008461679.1|  PREDICTED: expansin-A4                             282   3e-92    Cucumis melo [Oriental melon]
gb|ADY68818.1|  expansin                                                281   3e-92    Gossypium hirsutum [American cotton]
emb|CDX77222.1|  BnaC04g40170D                                          281   4e-92    
emb|CAA59470.1|  orf                                                    281   4e-92    Pisum sativum [garden pea]
ref|XP_008223717.1|  PREDICTED: expansin-A4                             281   4e-92    Prunus mume [ume]
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             281   4e-92    Eutrema salsugineum [saltwater cress]
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             281   4e-92    Phaseolus vulgaris [French bean]
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             281   4e-92    Prunus persica
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         281   4e-92    Rumex palustris
ref|XP_011089478.1|  PREDICTED: expansin-A6                             281   5e-92    Sesamum indicum [beniseed]
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         281   5e-92    Rumex palustris
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        281   5e-92    Pyrus x bretschneideri [bai li]
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        281   5e-92    Malus domestica [apple tree]
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        281   5e-92    Pyrus x bretschneideri [bai li]
ref|NP_001236550.1|  expansin precursor                                 281   6e-92    
gb|AEN70900.1|  expansin                                                281   6e-92    Gossypium tomentosum
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        281   6e-92    Nicotiana tomentosiformis
gb|ACO07292.1|  expansin 10                                             281   7e-92    Cucumis sativus [cucumbers]
ref|NP_001233958.1|  expansin precursor                                 281   7e-92    Solanum lycopersicum
ref|XP_010067412.1|  PREDICTED: expansin-A4                             282   7e-92    Eucalyptus grandis [rose gum]
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        281   8e-92    Glycine max [soybeans]
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             281   8e-92    Phaseolus vulgaris [French bean]
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        281   8e-92    Cucumis melo [Oriental melon]
ref|XP_003543517.1|  PREDICTED: expansin-A4                             280   9e-92    Glycine max [soybeans]
gb|KHG20113.1|  Expansin-A4 -like protein                               281   9e-92    Gossypium arboreum [tree cotton]
gb|KJB08889.1|  hypothetical protein B456_001G111100                    281   9e-92    Gossypium raimondii
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        281   9e-92    Pyrus x bretschneideri [bai li]
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        280   1e-91    Nicotiana tomentosiformis
gb|ABO30976.2|  alpha expansin protein 1                                280   1e-91    Calotropis procera
gb|AEN70895.1|  expansin                                                280   1e-91    Gossypium mustelinum
gb|AFK44569.1|  unknown                                                 280   1e-91    Medicago truncatula
ref|XP_010690765.1|  PREDICTED: expansin-A4                             280   1e-91    Beta vulgaris subsp. vulgaris [field beet]
gb|AEU08407.1|  expansin 2                                              280   1e-91    Prunus salicina [Japanese plum]
gb|KEH30169.1|  expansin A10                                            280   1e-91    Medicago truncatula
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        280   1e-91    Nicotiana tomentosiformis
ref|XP_010521846.1|  PREDICTED: expansin-A6                             280   2e-91    Tarenaya hassleriana [spider flower]
gb|KHG24991.1|  Expansin-A4 -like protein                               280   2e-91    Gossypium arboreum [tree cotton]
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             280   2e-91    Phaseolus vulgaris [French bean]
gb|KJB78839.1|  hypothetical protein B456_013G022200                    280   2e-91    Gossypium raimondii
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        280   2e-91    
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    279   3e-91    Cucumis sativus [cucumbers]
ref|XP_008384848.1|  PREDICTED: expansin-A4                             279   3e-91    Malus domestica [apple tree]
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        279   3e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        279   4e-91    Eucalyptus grandis [rose gum]
dbj|BAC67194.1|  expansin                                               279   5e-91    Pyrus communis
ref|XP_010033123.1|  PREDICTED: expansin-A4                             279   5e-91    Eucalyptus grandis [rose gum]
ref|XP_002881024.1|  ATEXPA6                                            278   5e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             278   6e-91    Citrus clementina [clementine]
ref|XP_010528418.1|  PREDICTED: expansin-A3                             278   6e-91    Tarenaya hassleriana [spider flower]
gb|KHG29956.1|  Expansin-A4 -like protein                               278   7e-91    Gossypium arboreum [tree cotton]
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                278   8e-91    Erythranthe guttata [common monkey flower]
ref|NP_001234761.1|  expansin18 precursor                               278   8e-91    
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        278   1e-90    Prunus mume [ume]
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        278   1e-90    Populus euphratica
ref|XP_004302749.1|  PREDICTED: expansin-A6                             278   1e-90    Fragaria vesca subsp. vesca
emb|CAN73252.1|  hypothetical protein VITISV_027049                     277   2e-90    Vitis vinifera
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        277   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        277   2e-90    Malus domestica [apple tree]
ref|XP_010510558.1|  PREDICTED: expansin-A6                             277   2e-90    Camelina sativa [gold-of-pleasure]
gb|ABK93258.1|  unknown                                                 275   2e-90    Populus trichocarpa [western balsam poplar]
emb|CDY47883.1|  BnaA07g14280D                                          277   2e-90    Brassica napus [oilseed rape]
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             277   2e-90    Phaseolus vulgaris [French bean]
emb|CAA04385.1|  Expansin                                               277   2e-90    Brassica napus [oilseed rape]
emb|CDP00110.1|  unnamed protein product                                277   2e-90    Coffea canephora [robusta coffee]
ref|XP_006350774.1|  PREDICTED: expansin-A6                             277   2e-90    Solanum tuberosum [potatoes]
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             277   2e-90    Citrus clementina [clementine]
dbj|BAN09210.1|  alpha expansin                                         277   2e-90    Eustoma exaltatum subsp. russellianum [bluebells]
gb|KHN30166.1|  Expansin-A4                                             278   2e-90    Glycine soja [wild soybean]
ref|NP_180461.1|  expansin A6                                           277   3e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAK48848.1|AF350939_1  expansin                                      277   3e-90    Prunus cerasus [pie cherry]
ref|XP_002313434.1|  alpha-expansin 1 family protein                    277   3e-90    Populus trichocarpa [western balsam poplar]
gb|ABO32367.1|  expansin                                                276   3e-90    Litchi
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    276   3e-90    
ref|XP_010264435.1|  PREDICTED: expansin-A4                             276   4e-90    Nelumbo nucifera [Indian lotus]
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        276   4e-90    Phoenix dactylifera
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        276   4e-90    Phoenix dactylifera
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             276   4e-90    Capsella rubella
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    276   4e-90    Arabis alpina [alpine rockcress]
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             276   5e-90    Eutrema salsugineum [saltwater cress]
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        276   5e-90    Citrus sinensis [apfelsine]
ref|XP_010111142.1|  hypothetical protein L484_010756                   276   8e-90    Morus notabilis
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        275   8e-90    Citrus sinensis [apfelsine]
ref|XP_010517036.1|  PREDICTED: expansin-A3                             276   9e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006366490.1|  PREDICTED: expansin-A6                             275   9e-90    Solanum tuberosum [potatoes]
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             275   9e-90    Citrus clementina [clementine]
ref|XP_009380637.1|  PREDICTED: expansin-A4                             275   1e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP48989.1|  expansin                                                275   1e-89    Sambucus nigra
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        275   1e-89    Sesamum indicum [beniseed]
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        275   1e-89    Cicer arietinum [garbanzo]
ref|NP_181300.1|  expansin-A3                                           275   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        275   2e-89    Brassica rapa
ref|XP_010534508.1|  PREDICTED: expansin-A4                             275   2e-89    Tarenaya hassleriana [spider flower]
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        275   2e-89    Camelina sativa [gold-of-pleasure]
gb|KFK36651.1|  alpha-expansin 4                                        275   2e-89    Arabis alpina [alpine rockcress]
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          274   3e-89    Amborella trichopoda
gb|AAM62987.1|  expansin AtEx6                                          274   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077647.1|  PREDICTED: expansin-A6-like                        274   3e-89    
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        274   4e-89    Tarenaya hassleriana [spider flower]
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        274   4e-89    Populus euphratica
ref|XP_002266625.1|  PREDICTED: expansin-A6                             274   4e-89    Vitis vinifera
gb|EPS67093.1|  hypothetical protein M569_07682                         273   6e-89    Genlisea aurea
ref|XP_006294844.1|  hypothetical protein CARUB_v10023895mg             273   9e-89    Capsella rubella
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             273   1e-88    Eutrema salsugineum [saltwater cress]
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                273   1e-88    Erythranthe guttata [common monkey flower]
gb|KJB46593.1|  hypothetical protein B456_007G376300                    274   1e-88    Gossypium raimondii
gb|AFK33369.1|  unknown                                                 270   1e-88    Lotus japonicus
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          272   1e-88    Populus trichocarpa [western balsam poplar]
ref|XP_002881524.1|  ATEXPA3                                            272   2e-88    Arabidopsis lyrata subsp. lyrata
gb|ABK93541.1|  unknown                                                 272   2e-88    Populus trichocarpa [western balsam poplar]
ref|NP_001150534.1|  alpha-expansin 6 precursor                         272   2e-88    
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        271   3e-88    Camelina sativa [gold-of-pleasure]
emb|CDY07642.1|  BnaA03g18690D                                          271   3e-88    Brassica napus [oilseed rape]
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        271   3e-88    Camelina sativa [gold-of-pleasure]
gb|AAV85475.1|  expansin                                                271   4e-88    Populus tomentosa [Chinese white poplar]
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        271   4e-88    Brassica rapa
emb|CDX74942.1|  BnaA05g06880D                                          271   4e-88    
ref|NP_001288852.1|  expansin-A3 precursor                              271   4e-88    Brassica rapa
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        271   5e-88    Tarenaya hassleriana [spider flower]
ref|XP_010111457.1|  hypothetical protein L484_021280                   271   5e-88    Morus notabilis
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        271   5e-88    Elaeis guineensis
emb|CDX80810.1|  BnaC03g00640D                                          271   5e-88    
ref|XP_004145295.1|  PREDICTED: expansin-A4-like                        271   6e-88    
gb|KHN33378.1|  Expansin-A4                                             270   8e-88    Glycine soja [wild soybean]
ref|XP_010937609.1|  PREDICTED: expansin-A4                             270   9e-88    Elaeis guineensis
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        270   1e-87    Phoenix dactylifera
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             270   2e-87    Capsella rubella
dbj|BAE06067.1|  expansin                                               270   2e-87    Sagittaria pygmaea
ref|NP_001288961.1|  expansin-A4 precursor                              269   2e-87    Brassica rapa
emb|CDY07024.1|  BnaA04g22910D                                          269   3e-87    
ref|XP_010490643.1|  PREDICTED: expansin-A9                             269   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        269   3e-87    Brassica rapa
emb|CDY69611.1|  BnaCnng64440D                                          269   3e-87    Brassica napus [oilseed rape]
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          269   3e-87    Sorghum bicolor [broomcorn]
ref|XP_009122794.1|  PREDICTED: expansin-A9                             269   3e-87    Brassica rapa
gb|ACF87150.1|  unknown                                                 269   4e-87    Zea mays [maize]
ref|XP_010558331.1|  PREDICTED: expansin-A9                             269   4e-87    Tarenaya hassleriana [spider flower]
gb|ACA05164.1|  expansin 1                                              268   4e-87    Dimocarpus longan [longan]
emb|CDY24952.1|  BnaC03g22200D                                          268   6e-87    Brassica napus [oilseed rape]
gb|ACT67493.1|  expansin A1                                             268   6e-87    Raphanus sativus
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             268   8e-87    Capsella rubella
emb|CDY10456.1|  BnaCnng03570D                                          268   8e-87    Brassica napus [oilseed rape]
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             268   1e-86    Eutrema salsugineum [saltwater cress]
ref|NP_181500.1|  expansin A4                                           268   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        267   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        267   1e-86    Setaria italica
ref|XP_009388613.1|  PREDICTED: expansin-A7                             267   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002878036.1|  ATEXPA16                                           266   3e-86    Arabidopsis lyrata subsp. lyrata
ref|XP_002881669.1|  ATEXPA4                                            266   3e-86    
gb|KJB08890.1|  hypothetical protein B456_001G111100                    267   4e-86    Gossypium raimondii
ref|XP_010554612.1|  PREDICTED: expansin-A4                             266   4e-86    Tarenaya hassleriana [spider flower]
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        266   6e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010505648.1|  PREDICTED: expansin-A4                             265   1e-85    Camelina sativa [gold-of-pleasure]
ref|NP_001288942.1|  expansin-A16 precursor                             265   1e-85    Brassica rapa
emb|CDY48101.1|  BnaC02g03580D                                          265   1e-85    Brassica napus [oilseed rape]
emb|CDY20467.1|  BnaC04g05770D                                          265   1e-85    Brassica napus [oilseed rape]
emb|CDY04847.1|  BnaAnng00290D                                          265   1e-85    
ref|XP_002870966.1|  ATEXPA9                                            265   1e-85    Arabidopsis lyrata subsp. lyrata
ref|NP_001288956.1|  expansin-A9-like precursor                         265   1e-85    Brassica rapa
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        265   2e-85    
gb|EPS64820.1|  hypothetical protein M569_09956                         265   2e-85    
gb|ACU17612.1|  unknown                                                 261   2e-85    
ref|NP_195846.1|  expansin A9                                           265   2e-85    
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        265   2e-85    
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        264   2e-85    
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        264   3e-85    
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        263   4e-85    
gb|ABN09939.1|  expansin A4                                             263   4e-85    
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    263   6e-85    
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        263   7e-85    
ref|NP_001051731.1|  Os03g0822000                                       263   7e-85    
gb|ABK24904.1|  unknown                                                 263   9e-85    
gb|AAQ08016.1|  expansin                                                263   9e-85    
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       262   2e-84    
ref|XP_010516124.1|  PREDICTED: expansin-A16                            262   2e-84    
emb|CDY40233.1|  BnaA09g35150D                                          262   2e-84    
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             262   2e-84    
gb|ABN09942.1|  expansin A5                                             261   3e-84    
ref|XP_003563572.1|  PREDICTED: expansin-A7                             261   4e-84    
ref|NP_191109.1|  expansin A16                                          261   6e-84    
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    261   6e-84    
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       260   1e-83    
gb|ABM54492.1|  expansin 2                                              260   1e-83    
ref|XP_007205739.1|  hypothetical protein PRUPE_ppa010180mg             256   3e-83    
gb|KJB20063.1|  hypothetical protein B456_003G131000                    256   4e-83    
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    258   5e-83    
ref|XP_008458865.1|  PREDICTED: expansin-A4                             258   6e-83    
gb|ABN09940.1|  expansin A5                                             258   9e-83    
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             258   9e-83    
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       258   1e-82    
emb|CDX76090.1|  BnaA04g03540D                                          257   1e-82    
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    257   1e-82    
gb|AAS48878.1|  expansin EXPA9                                          256   5e-82    
gb|AAN60246.1|  unknown                                                 254   5e-82    
gb|KHN07218.1|  Expansin-A4                                             255   5e-82    
gb|ACG46282.1|  alpha-expansin 6 precursor                              256   7e-82    
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        255   9e-82    
emb|CDY41218.1|  BnaC08g26400D                                          255   9e-82    
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       254   2e-81    
emb|CDY02943.1|  BnaC04g25430D                                          254   3e-81    
gb|KFK34800.1|  hypothetical protein AALP_AA5G194900                    251   1e-80    
gb|AAL01624.1|  expansin                                                247   8e-80    
gb|AAL87021.1|  cell wall protein EXP2 precursor                        249   2e-79    
gb|ABM66430.1|  expansin 3                                              249   2e-79    
gb|ACF84785.1|  unknown                                                 249   3e-79    
ref|XP_010509297.1|  PREDICTED: expansin-A3-like                        245   4e-79    
gb|ACO52788.1|  EXP6                                                    243   2e-78    
gb|AFW67136.1|  hypothetical protein ZEAMMB73_591538                    243   3e-78    
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        246   3e-78    
gb|EPS68567.1|  hypothetical protein M569_06200                         246   4e-78    
gb|ACO52755.1|  EXP6                                                    241   5e-78    
gb|ACO52796.1|  EXP6                                                    241   6e-78    
gb|ACO52786.1|  EXP6                                                    240   2e-77    
gb|ACO52763.1|  EXP6                                                    240   2e-77    
gb|ACO52804.1|  EXP6                                                    240   2e-77    
gb|ACO52759.1|  EXP6                                                    239   3e-77    
ref|NP_001267685.1|  expansin-A16-like                                  243   4e-77    
gb|AAL87024.1|  cell wall protein Exp5                                  239   7e-77    
gb|ACO52757.1|  EXP6                                                    238   7e-77    
gb|EYU19913.1|  hypothetical protein MIMGU_mgv1a012177mg                242   1e-76    
gb|ACO52765.1|  EXP6                                                    236   8e-76    
gb|ACO52791.1|  EXP6                                                    236   9e-76    
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       238   3e-75    
gb|ACO52767.1|  EXP6                                                    233   6e-75    
dbj|BAD00017.1|  expansin                                               236   9e-75    
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        237   1e-74    
gb|ACO57092.1|  EXP6                                                    232   2e-74    
gb|AFK34543.1|  unknown                                                 235   4e-74    
emb|CAB65694.1|  Expansin 18                                            233   4e-74    
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             235   5e-74    
ref|NP_001275780.1|  expansin 2 precursor                               235   5e-74    
gb|AGU13763.1|  expansin                                                235   6e-74    
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        234   7e-74    
ref|XP_003607738.1|  Expansin                                           236   8e-74    
ref|XP_010257816.1|  PREDICTED: expansin-A1                             234   8e-74    
emb|CDY24897.1|  BnaC03g22750D                                          234   1e-73    
gb|AJR32958.1|  expansin                                                234   1e-73    
ref|NP_001185357.1|  expansin A1                                        234   1e-73    
gb|AAL87023.1|  cell wall protein Exp4 precursor                        234   1e-73    
ref|XP_010103644.1|  hypothetical protein L484_011237                   234   1e-73    
ref|NP_849869.1|  expansin A1                                           234   1e-73    
ref|NP_001117573.1|  expansin A1                                        234   2e-73    
ref|NP_001289251.1|  expansin-A4-like precursor                         234   2e-73    
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               233   2e-73    
gb|ADN03964.1|  EXP1                                                    234   2e-73    
ref|NP_177112.1|  expansin A1                                           233   2e-73    
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       233   2e-73    
gb|ACO52780.1|  EXP6                                                    229   3e-73    
ref|XP_002887242.1|  ATEXPA1                                            233   3e-73    
ref|XP_010108480.1|  hypothetical protein L484_010673                   233   3e-73    
gb|AEQ55268.1|  expansin                                                233   4e-73    
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             233   4e-73    
gb|AAM08930.1|  expansin 1                                              233   5e-73    
gb|ABO32366.1|  expansin                                                232   6e-73    
gb|AHL25252.1|  expansin                                                232   6e-73    
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        232   7e-73    
ref|XP_009399909.1|  PREDICTED: expansin-A2-like                        234   7e-73    
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  232   8e-73    
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   232   1e-72    
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  231   1e-72    
ref|XP_003613849.1|  Expansin                                           231   1e-72    
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        231   1e-72    
gb|ACO52764.1|  EXP6                                                    227   1e-72    
gb|KCW65774.1|  hypothetical protein EUGRSUZ_G03134                     231   1e-72    
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        231   1e-72    
gb|AEQ55270.1|  expansin                                                231   2e-72    
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        231   2e-72    
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        231   2e-72    
gb|KFK42332.1|  hypothetical protein AALP_AA2G242600                    231   2e-72    
ref|XP_009384771.1|  PREDICTED: expansin-A2                             231   2e-72    
ref|XP_010670609.1|  PREDICTED: expansin-A4                             231   2e-72    
gb|ADD14631.1|  expansin precursor                                      229   3e-72    
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             233   3e-72    
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             231   3e-72    
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        230   3e-72    
ref|XP_004970396.1|  PREDICTED: expansin-A2-like                        230   4e-72    
gb|AAM22631.1|AF428184_1  expansin 17 precursor                         227   4e-72    
ref|NP_001281040.1|  expansin-A4-like precursor                         230   5e-72    
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         229   6e-72    
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        229   6e-72    
dbj|BAJ10397.1|  alpha-expansin                                         230   6e-72    
ref|XP_003568245.1|  PREDICTED: expansin-A4                             229   6e-72    
gb|ACM90161.1|  expansin 3                                              230   6e-72    
emb|CDP04049.1|  unnamed protein product                                229   8e-72    
gb|ACK43222.1|  expansin 2                                              229   8e-72    
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        229   9e-72    
gb|ADC35366.1|  alpha-expansin 3                                        229   9e-72    
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             229   1e-71    
gb|KEH35550.1|  expansin A10                                            229   1e-71    
gb|AAC33529.1|  expansin                                                229   1e-71    
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        229   1e-71    
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        229   1e-71    
gb|AAB38070.1|  expansin At-EXPA1                                       228   1e-71    
gb|AAG13982.1|AF297521_1  expansin 1                                    229   1e-71    
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        229   1e-71    
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       229   1e-71    
gb|KHG18125.1|  Expansin-A10 -like protein                              229   1e-71    
ref|XP_004155305.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A1-...    229   1e-71    
ref|XP_004135171.1|  PREDICTED: expansin-A1-like                        229   1e-71    
ref|NP_001267550.1|  expansin-A8-like precursor                         229   1e-71    
gb|AEQ55272.1|  expansin                                                229   1e-71    
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             229   2e-71    
ref|XP_010452431.1|  PREDICTED: expansin-A2                             229   2e-71    
dbj|BAJ10398.1|  alpha-expansin                                         229   2e-71    
ref|XP_008446373.1|  PREDICTED: expansin-A1                             228   2e-71    
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               229   2e-71    
gb|AFK24457.1|  expansin 4                                              228   2e-71    
ref|XP_011076589.1|  PREDICTED: expansin-A4-like                        228   2e-71    
gb|ACA05166.1|  expansin 3                                              228   2e-71    
emb|CBI15823.3|  unnamed protein product                                228   2e-71    
ref|NP_001240136.1|  expansin-A1-like precursor                         228   2e-71    
ref|XP_009399910.1|  PREDICTED: expansin-A2-like                        228   2e-71    
gb|ACI02326.1|  expansion-related protein                               228   2e-71    
gb|KEH35551.1|  expansin A10                                            228   2e-71    
gb|AEQ55284.1|  expansin                                                228   2e-71    
ref|XP_010423483.1|  PREDICTED: expansin-A2-like                        228   2e-71    
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       228   2e-71    
gb|AEQ55269.1|  expansin                                                228   3e-71    
gb|AAM46682.1|AF442773_1  expansin 1                                    225   3e-71    
ref|XP_002323665.1|  expansin S1 precursor family protein               228   3e-71    
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              228   3e-71    
gb|AFK24458.1|  expansin 5                                              228   3e-71    
ref|XP_003544930.1|  PREDICTED: expansin-A8                             228   3e-71    
gb|AAR10411.2|  EXP1                                                    226   3e-71    
gb|AAB81662.1|  expansin                                                228   3e-71    
ref|XP_010511994.1|  PREDICTED: expansin-A1                             228   3e-71    
gb|KJB80218.1|  hypothetical protein B456_013G086900                    228   4e-71    
emb|CDP13911.1|  unnamed protein product                                227   4e-71    
ref|XP_007209512.1|  hypothetical protein PRUPE_ppa010443mg             228   4e-71    
ref|XP_002276565.3|  PREDICTED: expansin-A4                             228   4e-71    
gb|ABR17119.1|  unknown                                                 228   4e-71    
gb|KDP20276.1|  hypothetical protein JCGZ_06862                         228   4e-71    
gb|EYU20096.1|  hypothetical protein MIMGU_mgv1a012489mg                228   4e-71    
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        228   4e-71    
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        228   4e-71    
gb|AAD13634.1|  expansin                                                224   4e-71    
gb|AAR82851.1|  expansin-3                                              227   5e-71    
ref|XP_008239926.1|  PREDICTED: expansin-A1-like                        227   5e-71    
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         227   5e-71    
ref|XP_006829796.1|  hypothetical protein AMTR_s00119p00058870          227   5e-71    
gb|KHN32128.1|  Expansin-A4                                             226   5e-71    
ref|XP_009404081.1|  PREDICTED: expansin-A15                            227   5e-71    
ref|NP_001055842.1|  Os05g0477600                                       227   6e-71    
ref|XP_008808309.1|  PREDICTED: expansin-A2-like                        227   6e-71    
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        227   7e-71    
ref|XP_011013147.1|  PREDICTED: expansin-A1                             227   7e-71    
ref|XP_002963702.1|  hypothetical protein SELMODRAFT_230202             227   8e-71    
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        227   8e-71    
gb|AAL87022.1|  cell wall protein EXP3 precursor                        227   8e-71    
ref|XP_008456949.1|  PREDICTED: expansin-A8-like                        227   8e-71    
gb|AEQ28765.1|  expansin 3                                              227   9e-71    
gb|ACA05165.1|  expansin 2                                              226   1e-70    
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             226   1e-70    
ref|XP_007037392.1|  Expansin A1, ALPHA 1.2,EXPA1                       228   1e-70    
ref|XP_004307732.1|  PREDICTED: expansin-A10                            226   1e-70    
gb|AFK38068.1|  unknown                                                 226   1e-70    
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          226   1e-70    
ref|XP_007017076.1|  Expansin A8, ALPHA 1.11,EXPA8                      226   1e-70    
ref|XP_006391003.1|  hypothetical protein EUTSA_v10019043mg             226   1e-70    
gb|AGF90536.1|  expansin 2                                              226   1e-70    
gb|AAG13983.1|AF297522_1  expansin 2                                    226   1e-70    
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        226   2e-70    
emb|CDP12277.1|  unnamed protein product                                226   2e-70    
gb|ADD14630.1|  expansin precursor                                      224   2e-70    
gb|AEL88239.1|  expansin                                                225   2e-70    
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        226   2e-70    
gb|AAD47901.1|AF085330_1  expansin                                      226   2e-70    
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         226   2e-70    
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        226   2e-70    
ref|NP_001288866.1|  expansin-A1 precursor                              226   2e-70    
gb|ABB59694.1|  alpha-expansin 2                                        226   2e-70    
ref|XP_010502317.1|  PREDICTED: expansin-A15                            226   2e-70    
gb|ACK87022.1|  expansin                                                226   2e-70    
ref|NP_001266033.1|  expansin-A15-like precursor                        226   2e-70    
ref|NP_001044656.1|  Os01g0823100                                       226   2e-70    
gb|ABA62612.1|  expansin                                                226   2e-70    
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             226   2e-70    
emb|CDY40938.1|  BnaC06g30760D                                          226   2e-70    
gb|AEQ55281.1|  expansin                                                225   2e-70    
gb|AAL40354.1|AF448467_1  alpha-expansin                                226   2e-70    



>dbj|BAO57279.1| alpha-expansin [Ipomoea nil]
Length=257

 Score =   347 bits (890),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  427
            QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  120

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  168



>gb|AEQ55271.1| expansin [Breonia chinensis]
 gb|AEQ55286.1| expansin [Breonia chinensis]
Length=258

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 156/169 (92%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA V +LCIA LLC LT V+ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAQVGLLCIATLLCFLTVVNARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN  ALSTALFNNGLSCGACFE+KC+N  + C PGNPSIF+TATNFCPPNFALPND
Sbjct  61   QGYGVNTGALSTALFNNGLSCGACFELKCANAPKWCLPGNPSIFITATNFCPPNFALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRK+GGIRFTV
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKRGGIRFTV  169



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 156/172 (91%), Gaps = 3/172 (2%)
 Frame = +2

Query  65   KMAAVRVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  238
            KMAA  +L   I +LLC LTAV+ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGN
Sbjct  3    KMAANMMLYITITVLLCFLTAVNARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGN  62

Query  239  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  415
            LYSQGYGVNNAALST LFNNGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNFAL
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFAL  122

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PND+GGWCNPPRPHFDLAMPMFLKI  YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  123  PNDDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVTYRRVPCRKQGGIRFTI  174



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 156/172 (91%), Gaps = 3/172 (2%)
 Frame = +2

Query  65   KMAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  238
            KMAA  +L I   +LLC LTAV+ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGN
Sbjct  3    KMAATMMLYITTTILLCFLTAVNARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGN  62

Query  239  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  415
            LYSQGYGVNNAALST LFNNGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNFAL
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFAL  122

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PND+GGWCNPPRPHFDLAMPMFLKI  YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  123  PNDDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVTYRRVPCRKQGGIRFTI  174



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   297 bits (760),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA + VLCI  L      V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MANLDVLCIISLFSLFWVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC++D + C+PG+PSIF+TATNFCPPNFALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPKWCNPGSPSIFITATNFCPPNFALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVNFRRIPCRKQGGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNFRRIPCRKQGGIRFTI  169



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +  LCIA LLC LT V+AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAQMCPLCIAALLCFLTVVNARLPGAYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFN+GLSCGACFE+KC++D + C PG+PSIF+TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNDGLSCGACFELKCADDPKWCLPGSPSIFITATNFCPPNFALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVNFRR+PCRK+GGIRFTV
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVNFRRVPCRKRGGIRFTV  169



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   296 bits (758),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 154/170 (91%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIA-LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA  ++LCIA  LLC LTAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAVTKILCIAATLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVNNAALST LFNNGLSCGACFEIKC +D + C PGNPSIFVTATNFCPPNFALPN
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDGKWCLPGNPSIFVTATNFCPPNFALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            D+GGWCNPPRPHFDLAMPMFLKI  YRAGIVPV +RR+PCRK GGIRFT+
Sbjct  121  DDGGWCNPPRPHFDLAMPMFLKIGQYRAGIVPVTYRRVPCRKAGGIRFTI  170



>ref|XP_009787901.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=293

 Score =   297 bits (761),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
             LCIA +LC LT+V+A+I G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    TLCIASVLCFLTSVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  263  NNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
            NNAALST LFNNGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPN+ALPNDNGGWCN
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNYALPNDNGGWCN  126

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFTV
Sbjct  127  PPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTV  169



>ref|XP_004249634.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
Length=259

 Score =   295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA    LCIA LLC LT V+A+I GVY+GG W +AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAVNWALCIATLLCFLTVVNAKIAGVYTGGPWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFALPN  421
            QGYGVNNAALSTALFNNGLSCGACFEIKC++ +   C+PGNPSI VT TNFCPPN+ALPN
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIV VN+RR+PCRKQGGIRFTV
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAVYRAGIVAVNYRRVPCRKQGGIRFTV  170



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            +++ +LC A L+C    V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTA+FNNGLSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+ALP+DN
Sbjct  68   GYGVNTAALSTAIFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDN  127

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+
Sbjct  128  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTI  175



>gb|KJB76740.1| hypothetical protein B456_012G104400 [Gossypium raimondii]
Length=264

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            +++ +LC A L+C    V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTALFNNGLSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+ALP+DN
Sbjct  68   GYGVNTAALSTALFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDN  127

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLK+A YRAGIVPV+FRR+PCRKQGGIRFT+
Sbjct  128  GGWCNPPRPHFDLAMPMFLKMAEYRAGIVPVSFRRVPCRKQGGIRFTI  175



>ref|XP_009607348.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=293

 Score =   296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
             L IA +LC LTAV+A+I G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    TLYIASVLCFLTAVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  263  NNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
            NNAALST LFNNGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPNFALPNDNGGWCN
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNFALPNDNGGWCN  126

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+
Sbjct  127  PPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTI  169



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   294 bits (753),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA V V+C+ L + S+    A+IPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVVSVVCVLLFISSMWMAEAKIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  169



>ref|XP_004505858.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   294 bits (753),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +2

Query  80   RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            ++L IA ++ S+  V ARIPG+YSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  4    KILYIAFIISSMWIVEARIPGLYSGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  260  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGW
Sbjct  64   VNTAALSTALFNNGLSCGACFEIKCANDREWCHSGSPSIFITATNFCPPNFALPNDNGGW  123

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK GGIRFTV
Sbjct  124  CNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKHGGIRFTV  168



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   294 bits (752),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            +++ VLC A LL     V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  7    SSLTVLCFASLLSFSVVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  66

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTALFNNGLSCGACFEIKC+ND R C PG+PSIFVTATNFCPPN+ALP+DN
Sbjct  67   GYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNYALPSDN  126

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+
Sbjct  127  GGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTI  174



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   294 bits (752),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            A  VLCIA ++    AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  4    ANNVLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQG  63

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNG
Sbjct  64   YGVNTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNG  123

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFTV
Sbjct  124  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTV  170



>ref|XP_006349505.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=259

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA    LCIA LLC LT V+A+I GVY+GG+W +AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAVNWALCIASLLCFLTVVNAKIVGVYTGGSWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFALPN  421
            QGYGVNNAALSTALFN+GLSCG+CFEIKC++ +   C+PGNPSI VT TNFCPPN+ALPN
Sbjct  61   QGYGVNNAALSTALFNSGLSCGSCFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIV VN+RR+PCRKQGGIRFTV
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAVYRAGIVAVNYRRVPCRKQGGIRFTV  170



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   292 bits (748),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            ++ +LC   LL   T+V+ARIPGV+S G+W+TAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  7    SLTLLCFTSLLPFFTSVNARIPGVFSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNFALP+DNG
Sbjct  67   YGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNG  126

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFTV
Sbjct  127  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTV  173



>gb|KHN21950.1| Expansin-A4 [Glycine soja]
Length=299

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
             A  VLCIA ++    AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  3    VANNVLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQ  62

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDN
Sbjct  63   GYGVNTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDN  122

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFTV
Sbjct  123  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTV  170



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            ++ VLC A LL  L  V+ARIPGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  175



>gb|KJB16930.1| hypothetical protein B456_002G257400 [Gossypium raimondii]
Length=264

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            ++  +L +A L      V+ARIPGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  8    SSFTMLHLASLFSIFVLVNARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTALFNNGLSCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALP+DN
Sbjct  68   GYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPSDN  127

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+
Sbjct  128  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTI  175



>gb|KJB36710.1| hypothetical protein B456_006G172400 [Gossypium raimondii]
Length=264

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            ++ VLC A LL  L  V+ARIPGVY+GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVYTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFNNGLSCG CFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSTALFNNGLSCGGCFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  175



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +  LCIA LL  LTA +A++PGVY+GG WQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSLLTAANAKVPGVYTGGPWQSAHATFYGGEDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  427
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLA PMFLK A YRAGIVPV +RR+PC+K GGIRFT+
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTI  168



>ref|XP_009587747.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=259

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            M   ++LCI   LLC LTAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MVVTKILCITTTLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKC-SNDRSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVNNAALST LFNNGLSCGACFEIKC  +D+ C PGNPSIFVTATNFCPPNFALPN
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDDKWCLPGNPSIFVTATNFCPPNFALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            D+GGWCNPPRPHFDLAMPMFLKI  YRAGIVPV++RR+ CRK GGIRFT+
Sbjct  121  DDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVSYRRVACRKAGGIRFTI  170



>gb|EYU41729.1| hypothetical protein MIMGU_mgv1a012073mg [Erythranthe guttata]
Length=262

 Score =   291 bits (745),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 150/166 (90%), Gaps = 3/166 (2%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +LC A +LC LT+  ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCFATVLCFLTSAQARIPGVYAGGPWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  263  NNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFALPNDNGG  433
            N AALSTALFNNGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPNFALPNDNGG
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCDAAQDSKWCNPGSPSILVTATNFCPPNFALPNDNGG  127

Query  434  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            WCNPPR HFDLAMPMFLKIA YRAGIVPVNFRRIPCRKQGG+RFT+
Sbjct  128  WCNPPRTHFDLAMPMFLKIAQYRAGIVPVNFRRIPCRKQGGMRFTI  173



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +R+LCIA LL    A  ARIPGVY+GGAW+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFLRMLCIASLLSLFMAABARIPGVYTGGAWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSIFVTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFAQPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTI  169



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   291 bits (744),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+ V CI  L+  LT V A+IPGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAALCVACIVSLMALLTLVDAKIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  169



>gb|KJB46592.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=262

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            ++ +LC   LL   T+V+A+IPGVYS G+W+TAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  7    SLALLCFTSLLPFFTSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNFALP+DNG
Sbjct  67   YGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNG  126

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GGIRFTV
Sbjct  127  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKHGGIRFTV  173



>ref|XP_003519349.1| PREDICTED: expansin-A4-like [Glycine max]
Length=257

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +  + L+   LT+  ARIPG YSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  5    IAIVTLIAVVLTSTEARIPGAYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  263  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+ALPNDNGGWC
Sbjct  65   NTAALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWC  124

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGG+RFT+
Sbjct  125  NPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGMRFTI  168



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 153/171 (89%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV--HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA VR+L +A ++ SL  V   ARIPG Y GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAMVRMLSVASVVMSLMWVVAEARIPGNYMGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTI  171



>ref|XP_007132063.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
 gb|ESW04057.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
Length=259

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            LCIA ++     V ARIPG+YSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  8    LCIAFVISLTWMVEARIPGIYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  67

Query  266  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPN+ALPNDNGGWCN
Sbjct  68   TAALSTALFNNGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNYALPNDNGGWCN  127

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK GGIRFTV
Sbjct  128  PPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKHGGIRFTV  170



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            A V V+   LL+  LT V ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  4    ATVNVVSAVLLISFLTLVDARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTALFN GLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDN
Sbjct  64   GYGVNTAALSTALFNAGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDN  123

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  124  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGIRFTI  171



>ref|XP_003544219.1| PREDICTED: expansin-A6-like [Glycine max]
Length=260

 Score =   289 bits (739),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +2

Query  92   IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  271
            I  L+  L +  AR+PGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN A
Sbjct  11   IVTLITLLASTEARVPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  70

Query  272  ALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  448
            ALSTALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPP
Sbjct  71   ALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPP  130

Query  449  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            RPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGG+RFT+
Sbjct  131  RPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGMRFTI  171



>ref|XP_011094866.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=262

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 154/172 (90%), Gaps = 4/172 (2%)
 Frame = +2

Query  68   MAAVRVL-CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            +AA+++L CI+ +LC LT   ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  2    LAAMKLLLCISSILCFLTCSDARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  61

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFAL  415
            SQGYGVN AALSTALFNNGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPN+AL
Sbjct  62   SQGYGVNTAALSTALFNNGLSCGACFEIKCDAAQDPKWCNPGSPSILVTATNFCPPNYAL  121

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PNDNGGWCNPPR HFDLAMPMFLKIA Y AGIVPVNFRRIPCRKQGGIRFT+
Sbjct  122  PNDNGGWCNPPREHFDLAMPMFLKIAQYSAGIVPVNFRRIPCRKQGGIRFTI  173



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   288 bits (738),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+  L IA L     +  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAIVFLYIASLASLFVSTSARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+ CRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAFRRVACRKTGGIRFTI  169



>ref|XP_004300427.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=259

 Score =   288 bits (738),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 154/170 (91%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA   + CIA LL SLT++  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMASLACIAALLISLTSITEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPS  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   288 bits (737),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +  LCIA LL  LT  +A++PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  427
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLA PMFLK A YRAGIVPV +RR+PC+K GGIRFT+
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTI  168



>gb|AEE69071.1| expansin-4 [Petunia hybrid cultivar]
Length=248

 Score =   288 bits (736),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 147/156 (94%), Gaps = 1/156 (1%)
 Frame = +2

Query  107  CSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  286
            C LTAV+A+IPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST 
Sbjct  4    CFLTAVYAKIPGVYIGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTV  63

Query  287  LFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  463
            LFN+GLSCGACFE+KC+ND   C PGNPSIFVTATNFCPPN+ALPND+GGWCNPPRPHFD
Sbjct  64   LFNSGLSCGACFELKCTNDEPWCLPGNPSIFVTATNFCPPNYALPNDDGGWCNPPRPHFD  123

Query  464  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+
Sbjct  124  LAMPMFLKIAQYRAGIVPVNYRRVPCRKQGGIRFTI  159



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   288 bits (737),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+  L IA L     A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAIVFLHIASLASLFVATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNFALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKTGGIRFTI  169



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA + +LCI +L+  + T V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMTLLCIVSLIALASTIVEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTI  170



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+ +  I  L   LT   ARIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAMCLTSIVALSLLLTLAEARIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC++D + C PG+PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRF +
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFQI  169



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            V C+  L   L AV ARIPGVYSG  WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VACLVALNLILVAVEARIPGVYSGAEWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIFVTATNFCPPN+ALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANEPQWCHAGSPSIFVTATNFCPPNYALPSDNGGWC  126

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  170



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            V C+ +L+L  L  V ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VACVTSLVLLMLLTVEARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VNN ALSTALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPN+ALPNDNGGW
Sbjct  67   VNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYALPNDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTI  171



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +  LCIA LL  LT  +A++PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  427
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLA PMFLK A YRAGIVPV +RR+PC+K GGI+FT+
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIKFTI  168



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA + ++ I  LL  +    A+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAMLNIIAIVSLLLLMIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GG+RFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTI  169



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            A  VLCI  ++     V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  4    ANNVLCIFFIISLTCMVQARIPGVYSAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQG  63

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNG
Sbjct  64   YGVNTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNG  123

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+
Sbjct  124  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTI  170



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA + +LCI +L+  + T V ARIPGVYSG AWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMALLCIVSLIALASTIVEARIPGVYSGEAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFTV
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTV  170



>emb|CBI16120.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA   V+C A L+   + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRKQGGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTI  169



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   286 bits (733),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA++RVL IA +L    A +ARIPGVY+GG+W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGSWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTI  169



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   286 bits (733),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA V +LCIA LL    A +ARIPGVY+GG W+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFVHMLCIASLLSLFMAANARIPGVYTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            +GYGVN AALSTALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+ALPND
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPPR HFDLAMPMFL+IA Y+AGIVPV+FRR+PCRK+GG+RFT+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTI  169



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   286 bits (733),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 3/169 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA V + CIA +L  +    ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIVVLTCIASVLALV--AEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  58

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN  ALSTALFN+GLSCGACFE+KC+ND   C PG+PSIF+TATNFCPPN+ALPND
Sbjct  59   QGYGVNTGALSTALFNSGLSCGACFELKCANDPGWCHPGSPSIFITATNFCPPNYALPND  118

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+
Sbjct  119  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTI  167



>gb|KHN17924.1| Expansin-A3 [Glycine soja]
Length=307

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA + ++ I  LL  +    A+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAMLNIIAIVSLLLLIIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GG+RFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTI  169



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA    +C+A L+  LT V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIRATICVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRF +
Sbjct  121  NGGWCNPPRPHFDLAMPVFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQI  169



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   286 bits (732),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA   + CIA LL  LT V +++ GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITWMFCIASLLSFLTIVESKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  427
             GYGVNNAALST LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDN  120

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDL+MP+FL+IA YRAGIVPV +RR+PC+KQGGIRFT+
Sbjct  121  GGWCNPPRPHFDLSMPVFLQIAQYRAGIVPVTYRRVPCKKQGGIRFTI  168



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   286 bits (732),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA   V+C A L+   + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRKQGGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTI  169



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 151/169 (89%), Gaps = 3/169 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA + ++ I  LL  LT  HA+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  7    MAMLNIISILSLL--LTQSHAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  64

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C+PGNPSI VTATNFCPPN+ALP D
Sbjct  65   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNYALPTD  124

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+ CRKQGG+RFT+
Sbjct  125  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVACRKQGGMRFTI  173



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   286 bits (732),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSL--TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  +   CI  L+ SL    V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MEMLNFFCIFSLIISLFLLTVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVNNAALSTALFNNGLSCGACFEIKC N  + C  G+PSI +TATNFCPPN+ALP
Sbjct  61   YSQGYGVNNAALSTALFNNGLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTI  171



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   286 bits (732),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA    LCIALLL     + ARIPGVYSGG WQ+AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MATPISLCIALLLSFSLLIDARIPGVYSGGPWQSAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  169



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   286 bits (731),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA  +L IA L     A  ARIPG YSGG WQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAATVLLSIASLASLFVATTARIPGFYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCG+CFEIKC  D R C+PGNPSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFEIKCDQDPRWCNPGNPSILITATNFCPPNFAQPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKKGGIRFTI  169



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   286 bits (731),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA + V  IA LL  +    ARIPGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAGLTVTWIASLLSLMWMAEARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGV+ AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  169



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   286 bits (732),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 152/171 (89%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTI  171



>gb|AAF32410.1|AF230277_1 alpha-expansin 2 [Triphysaria versicolor]
Length=262

 Score =   286 bits (732),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 147/166 (89%), Gaps = 3/166 (2%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +LCIA  +C LT+  ARIPG+YSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIATFICFLTSAQARIPGIYSGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  263  NNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFALPNDNGG  433
            N AALSTALFNNGLSCGACFEI+C    + + C+PG PSI VTATNFCPPNFA P+DNGG
Sbjct  68   NTAALSTALFNNGLSCGACFEIRCDMAQDGKWCNPGTPSILVTATNFCPPNFAQPSDNGG  127

Query  434  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            WCNPPR HFDLAMPMFLKIA YRAGIVPVN+RRIPCRKQGGIRFT+
Sbjct  128  WCNPPRTHFDLAMPMFLKIAQYRAGIVPVNYRRIPCRKQGGIRFTI  173



>gb|AFK34565.1| unknown [Medicago truncatula]
Length=191

 Score =   283 bits (725),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 152/171 (89%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTI  171



>gb|AEQ55290.1| expansin [Breonia chinensis]
Length=259

 Score =   286 bits (731),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA V ++CIA  L L  L A  ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAVVGLVCIASVLALAGLVA-EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFN+GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+ALP
Sbjct  60   YSQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALP  119

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGG RFT+
Sbjct  120  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGTRFTI  170



>ref|XP_006339024.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=257

 Score =   286 bits (731),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA   +LCIA LL  LT V +++ GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITWMLCIASLLSFLTTVDSKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  427
             GYGVNNAALST LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDN  120

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDL+MP+FL+IA YRAGIVPV +RR+PC+KQ GIRFT+
Sbjct  121  GGWCNPPRPHFDLSMPVFLQIAQYRAGIVPVTYRRVPCKKQEGIRFTI  168



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   286 bits (731),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            ++ VLC A LL     V+ARIPGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFFGWVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALS ALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSPALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  175



>gb|AHL25255.1| expansin [Boehmeria nivea]
Length=260

 Score =   286 bits (731),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 3/168 (2%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            AA ++ C+  L+    A  ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  6    AAWKIACLVSLMT--LATEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTALFN+GLSCGACFE+KC+ND +SC  G+PSI VTATNFCPPN+ALPND+
Sbjct  64   GYGVNTAALSTALFNSGLSCGACFELKCANDPKSCHSGSPSIIVTATNFCPPNYALPNDH  123

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+
Sbjct  124  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGVRFTI  171



>ref|XP_011019858.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=260

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +LCI  L+      HARIPGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIVFLISVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC++D R C+PGNPSIFVTATNFCPPNFA  +DNGGWC
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSIFVTATNFCPPNFAQASDNGGWC  127

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV  RR+PCRKQGGIRFT+
Sbjct  128  NPPRPHFDLAMPMFLKIAQYRAGIVPVAHRRVPCRKQGGIRFTI  171



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA     C+A L+  LT V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIRATTCVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFN+GLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNSGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRF +
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQI  169



>gb|AEQ55275.1| expansin [Breonia chinensis]
Length=259

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA V ++CIA  L L  L A  ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAIVGLVCIASVLALAGLVA-EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFN+GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+ALP
Sbjct  60   YSQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALP  119

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGG RFT+
Sbjct  120  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGTRFTI  170



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 2/166 (1%)
 Frame = +2

Query  77   VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  256
            +R    +L+LC L+ V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  6    IRTFVASLILC-LSLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  257  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  433
            GVN A LSTA FNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+ALP+DNGG
Sbjct  65   GVNTAVLSTAFFNNGLSCGACFEIKCADDPKWCHSGSPSILITATNFCPPNYALPSDNGG  124

Query  434  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            WCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+
Sbjct  125  WCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTI  170



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V V  CIA LL SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN  ALSTALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  171



>ref|XP_002309061.1| expansin family protein [Populus trichocarpa]
 gb|ABK94860.1| unknown [Populus trichocarpa]
 gb|EEE92584.1| expansin family protein [Populus trichocarpa]
Length=260

 Score =   285 bits (729),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +LCI  L       HARIPGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIVFLTSVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC++D R C+PGNPSI VTATNFCPPNFA P+DNGGWC
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNFAQPSDNGGWC  127

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV  RR+PCRKQGGIRFT+
Sbjct  128  NPPRPHFDLAMPMFLKIAQYRAGIVPVAHRRVPCRKQGGIRFTI  171



>ref|XP_003616412.1| Expansin [Medicago truncatula]
 gb|AES99370.1| expansin A10 [Medicago truncatula]
Length=259

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            M  + +  I + L   LT+  AR+PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MTKLNITTIFSFLALLLTSTEARLPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCG+CFE+KCSND S C PG+PSI VTATNFCPPNFA  +
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGSCFELKCSNDPSWCHPGSPSILVTATNFCPPNFAQAS  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIR+T+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGIRYTI  170



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 153/173 (88%), Gaps = 5/173 (3%)
 Frame = +2

Query  68   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  235
            MA   ++CIA    +++ SL    ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMAEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  412
            NLYSQGYGV+ AALSTALFNNGL+CG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLTCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  173



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 152/171 (89%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA V ++CIA  L L  +    ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAVVGLVCIASVLALAFMLGAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALF++GLSCGACFEIKC++D   C PG+PSIFVTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFSSGLSCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNYALP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTI  171



>gb|AAT11859.2| expansin 1 [Mangifera indica]
Length=260

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M  + + CI  L C +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  3    MVGLSMACILSLRCLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  62

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  63   QGYGVNTAALSTALFNNGFSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSD  122

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCR++GGIRFT+
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRERGGIRFTI  171



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   285 bits (728),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  65   KMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            KM +V +  + LL+  + A  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  2    KMGSV-ISGVILLVMLMGASEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPNFALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  170



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 153/173 (88%), Gaps = 5/173 (3%)
 Frame = +2

Query  68   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  235
            MA   ++CIA    +++ SL    ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  412
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  173



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 152/173 (88%), Gaps = 5/173 (3%)
 Frame = +2

Query  68   MAAVRVLC--IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA++ V+   I  LL  ++ V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MASMGVMATYILALLFLISLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFA  412
            YSQGYGVN AALSTALFNNGLSCGACFE+KC+ND   + C PGNPSI +TATNFCPPN+A
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNYA  120

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
             PNDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  121  KPNDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTM  173



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   285 bits (728),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPNFALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNFALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   285 bits (728),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA++RVL IA +L    A +ARIPGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC +D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTI  169



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 1/150 (1%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  305  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  481
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  482  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  170



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 1/150 (1%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  305  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  481
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  482  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  170



>ref|XP_009768238.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=257

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 144/157 (92%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  283
            L  + AV  RIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALST
Sbjct  12   LILVAAVEGRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALST  71

Query  284  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  460
            ALFNNGLSCGACFEIKC  D +SC  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHF
Sbjct  72   ALFNNGLSCGACFEIKCDKDPQSCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHF  131

Query  461  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  132  DLAMPMFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTI  168



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M  V V+C   +   L    ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MGLVAVVCFVAMASVLKLGEARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND   C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTI  169



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   284 bits (727),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA++RVL IA +L      +ARIPGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMEANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTI  169



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   284 bits (727),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 149/173 (86%), Gaps = 5/173 (3%)
 Frame = +2

Query  62   GKMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            G M  +  +   + L SL  V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  2    GSMGVITSIVGLIFLVSL--VEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  59

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFA  412
            YSQGYGVN AALSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A
Sbjct  60   YSQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYA  119

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
             PNDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRIPCRK+GGIRFT+
Sbjct  120  KPNDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRIPCRKRGGIRFTI  172



>gb|AAL31480.1|AF319475_1 alpha-expansin 9 precursor [Cucumis sativus]
Length=245

 Score =   283 bits (725),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  301
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  302  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  478
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  139

Query  479  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  140  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  170



>gb|AFZ78606.1| expansin protein [Populus tomentosa]
Length=262

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 153/173 (88%), Gaps = 5/173 (3%)
 Frame = +2

Query  68   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  235
            MA   ++CIA    +++ SL    ARIPGVYSGGAW+ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMRSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGADASGTMGGACGYG  60

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  412
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  173



>ref|XP_003552064.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +  LCIA L+    A  ARIPGV++GGAWQ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAGMVPLCIASLVTLFVATSARIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSIVITATNFCPPNFALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA Y+AGIVPV++RR+PCRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYKAGIVPVSYRRVPCRKVGGIRFTI  169



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   283 bits (725),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|AFK40565.1| unknown [Medicago truncatula]
Length=231

 Score =   283 bits (723),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMP FLKIA YRAGIVPV FRR+PCRK+GGIRFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPTFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTI  171



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   283 bits (725),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 150/167 (90%), Gaps = 2/167 (1%)
 Frame = +2

Query  77   VRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            + ++ I  L+ SLT +  +RIPG Y+GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  2    MTIVYIVSLIMSLTWLAESRIPGNYNGGAWETAHATFYGGSDASGTMGGACGYGNLYSQG  61

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFN GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNG
Sbjct  62   YGVNTAALSTALFNKGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNG  121

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRKQGGIRFTV
Sbjct  122  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTV  168



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
 gb|KJB20062.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=259

 Score =   283 bits (725),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   283 bits (725),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   283 bits (725),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA    LCI LLL     + ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MATPFSLCIPLLLSFSLLIEARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  169



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   283 bits (724),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  92   IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  271
            + ++L  L  V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNA
Sbjct  8    LIIILVILVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNA  67

Query  272  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  448
            ALSTALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPP
Sbjct  68   ALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPP  127

Query  449  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            R HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  128  RTHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTI  168



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   283 bits (724),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFTV
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTV  169



>gb|AAR09168.1| alpha-expansin 1 [Populus tremula x Populus tremuloides]
Length=262

 Score =   283 bits (725),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 153/173 (88%), Gaps = 5/173 (3%)
 Frame = +2

Query  68   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  235
            MA   ++CIA    +++ SL    ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGSDASGTMGGACGYG  60

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  412
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  173



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   283 bits (724),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  68   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  238
            MAA+  +LCIA L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGN  60

Query  239  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  415
            LYSQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  172



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA++ +LCIA L   L   +ARIPG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MASLHLLCIASLASLLILANARIPGPYTGGPWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEI+C +D R C+PG PSIFVTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNFAQPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKRGGIRFTI  169



>ref|XP_003597354.1| Cell wall protein Exp5 [Medicago truncatula]
Length=180

 Score =   280 bits (716),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGI FT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIXFTI  171



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V V  CIA LL SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MGVVSVSTCIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMXGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN  ALSTALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  171



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  301
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  302  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  478
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  139

Query  479  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  140  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  170



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +R++ +A LL  L    ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGV+ AALSTALFN+GLSCGACFEIKC+++ + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVDTAALSTALFNDGLSCGACFEIKCADEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  121  DGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTI  169



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+ + CI  L   LT   ARIPGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAMGLTCIVALSLLLTLTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFL+IA YRAGIVPV++RR+PCRKQGGIRF +
Sbjct  121  NGGWCNPPRPHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQI  169



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSIWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|KEH22886.1| expansin-A1-like protein [Medicago truncatula]
Length=258

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA + +L IA L     A  ARIPGVYSGG W +AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAGILLLTIASLASLFAATTARIPGVYSGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAQPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKAGGIRFTI  169



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAV-RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA+V RV+ +  L+   T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  170



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTI  171



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTI  171



>ref|XP_010685747.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   GKMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            G  +   ++ +  L  + T V ARIPG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  2    GMFSIFNIVSLMTLWVTSTLVDARIPGNYQGGSWQSAHATFYGGSDASGTMGGACGYGNL  61

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFN+GLSCGACFE+KC+ND R C PG+PSI +TATNFCPPNFALP
Sbjct  62   YSQGYGVNTAALSTALFNSGLSCGACFELKCANDPRWCHPGSPSILITATNFCPPNFALP  121

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPRPHFDLAMPMFLK+A YRAGIVPV FRR+PCRK+GGIRFT+
Sbjct  122  NDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVAFRRVPCRKRGGIRFTM  172



>gb|KJB55836.1| hypothetical protein B456_009G098800 [Gossypium raimondii]
Length=259

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            M     +CI + L+ S+    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MGIAGAVCIIVGLISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|ACN94264.1| expansin [Rehmannia glutinosa]
 gb|ACN94265.1| expansin [Rehmannia glutinosa]
Length=260

 Score =   282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVL-CIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA + V+ CIA L+  L   + ARIPG Y GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MALLAVIACIASLISVLPPPIEARIPGNYGGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNG SCGACFEIKC+ND+  C  G+PSIFVTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANDKQWCHAGSPSIFVTATNFCPPNYALP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPVNFRR+PCRKQGGIRFT+
Sbjct  121  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVNFRRVPCRKQGGIRFTI  171



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M     + I  LL  L    ARIPGVYSGG+W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MGLKGTISIFCLLLVLKLADARIPGVYSGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  169



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 1/158 (1%)
 Frame = +2

Query  101  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  280
            LL  LT   ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLADARIPGVYAGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  281  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  457
            TALFN GLSCGACFEIKC++D R C PG+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPH
Sbjct  74   TALFNEGLSCGACFEIKCADDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPH  133

Query  458  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  134  FDLAMPMFLKIAQYRAGIVPVSYRRVPCRKSGGIRFTI  171



>gb|KJB73995.1| hypothetical protein B456_011G266000 [Gossypium raimondii]
Length=258

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA      +  L+   TAV ARIPGVYSGGAWQ+AHATFYGG DASGTMGGACG+GNLYS
Sbjct  1    MAIKGFTYLVYLIIISTAVEARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGFGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  169



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 144/152 (95%), Gaps = 1/152 (1%)
 Frame = +2

Query  119  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  298
             VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  20   TVHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  79

Query  299  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  475
            GLSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  80   GLSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  139

Query  476  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            MFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  140  MFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTI  171



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   281 bits (720),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
             QGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   GQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTI  171



>emb|CAA59470.1| orf [Pisum sativum]
Length=258

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+ +L IA L        ARIPGVY+GG W +AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAILLLTIASLTSLFAPTTARIPGVYTGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAEPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKAGGIRFTI  169



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  89   CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  266  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVH-ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            VLC+  +L  LTA++ ARIPGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADLTAIYEARIPGVYNGGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTI  171



>ref|XP_007133996.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
 gb|ESW05990.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
Length=258

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +  LCIA  +    A +ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAEMLSLCIASFVTLFVATNARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG PSI +TATNFCPPN ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGRPSIIITATNFCPPNLALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+ CRK GGIRF +
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVACRKAGGIRFMI  169



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  89   CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  266  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   281 bits (719),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLK A YRAGIVPV FRR+PCRK+GGIRFTV
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKFAEYRAGIVPVAFRRVPCRKRGGIRFTV  169



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            ++CIA L+  L     ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    IVCIASLISVLQPPAEARIPGVYTGGGWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFEIKC+ ++  C  G+PSIFVTATNFCPPN+ALPNDNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNYALPNDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKKGGIRFTI  171



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG+SCGACFEIKC++D R C PGNPSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGMSCGACFEIKCADDPRWCHPGNPSILITATNFCPPNFAEPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPP PHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFTV
Sbjct  121  NGGWCNPPLPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTV  169



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V V  CIA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  68   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  238
            MAA+  +LCIA L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  239  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  415
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            P+D+GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  PSDDGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  172



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V V  CIA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>ref|NP_001236550.1| expansin precursor [Glycine max]
 gb|AAO15999.1|AF516880_1 expansin [Glycine max]
Length=258

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA+  + IA L+    A  ARIPGVY+GG WQ+AHATFYG +DASGTMGG CGYGNLYS
Sbjct  1    MAAIVFIHIASLVSLFVATSARIPGVYTGGPWQSAHATFYGASDASGTMGGRCGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGI F +
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKVGGINFQI  169



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHAT YGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATLYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 147/164 (90%), Gaps = 2/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            + C+  L+  + AV +RIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  9    IACVFSLML-VVAVESRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            NN ALSTALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPNFALPNDNGGWC
Sbjct  68   NNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNFALPNDNGGWC  127

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPR HFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  128  NPPRSHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTI  171



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   281 bits (718),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 140/150 (93%), Gaps = 1/150 (1%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  305  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  481
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWC PPR HFD AMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCTPPRTHFDFAMPMF  140

Query  482  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  170



>ref|NP_001233958.1| expansin precursor [Solanum lycopersicum]
 gb|AAC63088.1| expansin [Solanum lycopersicum]
 gb|AAQ12264.1| expansin 1 protein [Solanum lycopersicum]
Length=261

 Score =   281 bits (718),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 146/168 (87%), Gaps = 3/168 (2%)
 Frame = +2

Query  77   VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  256
            + +L +  +      V  RIPGVYSGG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  5    IFILVLLFVDSCFNIVEGRIPGVYSGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  257  GVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GVN AALSTALFNNGLSCGACFE+KC+N    + C PGNPSI +TATNFCPPN+ALPNDN
Sbjct  65   GVNTAALSTALFNNGLSCGACFELKCTNTPNWKWCLPGNPSILITATNFCPPNYALPNDN  124

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLK+A YRAGIVPV +RRIPCRKQGGIRFT+
Sbjct  125  GGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVTYRRIPCRKQGGIRFTI  172



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAV-RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA+V RV+ +  L+   T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  49   MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  108

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALPN
Sbjct  109  SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPN  168

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  169  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  218



>ref|XP_003547326.1| PREDICTED: expansin-A4-like [Glycine max]
Length=256

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 147/164 (90%), Gaps = 4/164 (2%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            VLC   L+  +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLC---LMSLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  63

Query  263  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWC
Sbjct  64   NTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWC  123

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+
Sbjct  124  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACRKHGGIRFTI  167



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 152/171 (89%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA+ + L   ++L+   L +  ARIPGVY GGAW+TAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MASFQKLLAIVSLVTVLLASAEARIPGVYGGGAWETAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFN+GLSCGACFEIKC++D S C  G+PSI VTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNSGLSCGACFEIKCADDPSWCHAGSPSILVTATNFCPPNYALP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGG+RFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGMRFTI  171



>ref|XP_008457477.1| PREDICTED: expansin-A4-like [Cucumis melo]
Length=259

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +LCIA L+ ++    ARIPGVYSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPATARIPGVYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  126

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACRKPGGIRFTI  170



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   280 bits (717),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 146/162 (90%), Gaps = 4/162 (2%)
 Frame = +2

Query  98   LLLCSLT---AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  268
            +LLC ++    V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN 
Sbjct  7    VLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  66

Query  269  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNP  445
            AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNP
Sbjct  67   AALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNP  126

Query  446  PRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PRPHFDLAMPMFLKIA YRAGIVPV FRR+ CRK GGIRFT+
Sbjct  127  PRPHFDLAMPMFLKIAEYRAGIVPVAFRRVACRKHGGIRFTI  168



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   281 bits (718),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            M     +CI +  + S+    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MGIAGAVCIIVGFISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|KJB08889.1| hypothetical protein B456_001G111100 [Gossypium raimondii]
Length=260

 Score =   281 bits (718),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            V CI L L S   +  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VACILLFLSSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   281 bits (718),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 151/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  68   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  238
            MAA+  +LCI  L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  239  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  415
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  172



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 151/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  68   MAAVRVLC-IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA++ V+  I  L+  ++ V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASMGVITSIIGLIFLVSLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  415
            SQGYGVN AALSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A 
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAK  120

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PNDNGGWCNPPR HFDLAMPMFL IA YRAGIVPV +RRIPCRK+GGIRFT+
Sbjct  121  PNDNGGWCNPPRSHFDLAMPMFLNIAQYRAGIVPVTYRRIPCRKRGGIRFTI  172



>gb|ABO30976.2| alpha expansin protein 1 [Calotropis procera]
Length=260

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V + CI  +L  L   + ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMVNLACIVSILSLLVVGIQARIPGVYSGGTWQRAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  S-QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            S   YGVN AALSTALFNNGLSCGACFEIKC+N+ + C PG+PSIF+TATNFCPPNFALP
Sbjct  61   SPNEYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHPGSPSIFITATNFCPPNFALP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPRPHFDLAMPMFL+IA YRAGIVPV+FRR+PCRKQGGIRFT+
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLRIAEYRAGIVPVSFRRVPCRKQGGIRFTI  171



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR  FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRTRFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  170



>gb|AFK44569.1| unknown [Medicago truncatula]
Length=258

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M A  +    +++ S+  V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MVAKMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCRSGSPSIFITATNFCPPNFAQASD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFTV
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTV  169



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 153/170 (90%), Gaps = 3/170 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSL-TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA++ +L I L L SL + +HAR PGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASI-ILPITLSLFSLFSLIHARYPGVYSRGGWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFN+G SCGACFE+KC++D R C PG+PSIF+TATNFCPPN+ALP+
Sbjct  60   SQGYGVNTAALSTALFNSGQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNYALPS  119

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFT+
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKKGGIRFTI  169



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  89   CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  266  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+D+GGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDDGGWCN  128

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>gb|KEH30169.1| expansin A10 [Medicago truncatula]
Length=258

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M A  +    +++ S+  V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MVAKMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNFAQASD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFTV
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTV  169



>ref|XP_009613959.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = +2

Query  119  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  298
             V ARIPGVY+GG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFNN
Sbjct  20   TVEARIPGVYTGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  79

Query  299  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  475
            GLSCGACFEIKC N  + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMP
Sbjct  80   GLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAMP  139

Query  476  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            MFLKIA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  140  MFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTI  171



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA + ++ +  +L SLT +  ARIPGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMISLVFVLTILVSLTLMSEARIPGVYGGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNG  CGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+
Sbjct  61   SQGYGVNTAALSTALFNNGFRCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPS  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  170



>gb|KHG24991.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=260

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 149/168 (89%), Gaps = 2/168 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            A  V CI L + S   +  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  4    ASAVACIFLFISSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DN
Sbjct  64   GYGVNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDN  123

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  124  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLT-AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            VL IAL   S+   V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  3    VLGIALCFASIMWMVDARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  62

Query  260  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGW
Sbjct  63   VNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNGGW  122

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ C K GGIRFT+
Sbjct  123  CNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACMKHGGIRFTI  167



>gb|KJB78839.1| hypothetical protein B456_013G022200 [Gossypium raimondii]
Length=258

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA     C+  LL  +  V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MANWVDTCLVSLLFIIVTVEARIPGVYSDGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG SCGACFEIKC N  + C  G+PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCVNQPQWCHSGSPSIFITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  169



>ref|XP_004154408.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004173564.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN65728.1| hypothetical protein Csa_1G522540 [Cucumis sativus]
Length=259

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  126

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRKPGGIRFTI  170



>gb|AAL31477.1|AF319472_1 alpha-expansin 6 precursor [Cucumis sativus]
Length=259

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  126

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRKPGGIRFTI  170



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  V V   IA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTSIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNGLSCGACFE+KC+ D S C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCAEDPSWCHAGSPSIFITATNFCPPNFAQP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>ref|XP_010414459.1| PREDICTED: expansin-A6-like [Camelina sativa]
Length=257

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            L + +L   L  + ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLFVLTILLATIEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  266  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNG SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA P+DNGGWCN
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCN  125

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+
Sbjct  126  PPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTI  168



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   279 bits (713),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            V   +L+  SL  +  ARIPGVYSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VFAASLISFSLMWLADARIPGVYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTI  171



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 150/172 (87%), Gaps = 4/172 (2%)
 Frame = +2

Query  68   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  238
            MAA+  +LCI  L  L S   V ARIPGVY+G AWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGAAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  239  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  415
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  172



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 149/174 (86%), Gaps = 6/174 (3%)
 Frame = +2

Query  68   MAAVRVLCIALL-----LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGY  232
            MAA RV+ +AL      L +     ARIPG+Y+GG WQ+AHATFYGGADASGTMGGACGY
Sbjct  1    MAAARVMALALAFLGVALSATRMAEARIPGIYTGGPWQSAHATFYGGADASGTMGGACGY  60

Query  233  GNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  409
            GNLYSQGYGVN AALSTALFNNG SCGACFEIKC+ND + C  G+ SIFVTATNFCPPN+
Sbjct  61   GNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSSSIFVTATNFCPPNY  120

Query  410  ALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            A P+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  AQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTI  174



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   278 bits (712),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  266  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNG SCGACFE+KC++D R C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  125

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+
Sbjct  126  PPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTI  168



>ref|XP_006435550.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 ref|XP_006486470.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|ESR48790.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 gb|KDO69285.1| hypothetical protein CISIN_1g024916mg [Citrus sinensis]
Length=260

 Score =   278 bits (712),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 149/168 (89%), Gaps = 2/168 (1%)
 Frame = +2

Query  74   AVRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            AV ++CI   +  S  +V ARIPGVY G AWQ+AHATFYGG DASGTMGGACGYGNLYSQ
Sbjct  4    AVGIICIVTFVTFSSLSVDARIPGVYGGEAWQSAHATFYGGNDASGTMGGACGYGNLYSQ  63

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA P+DN
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHAGSPSIFVTATNFCPPNFAQPSDN  123

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  124  GGWCNPPRPHFDLAMPMFLKMAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   278 bits (712),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 147/164 (90%), Gaps = 2/164 (1%)
 Frame = +2

Query  86   LCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            L +A+    L A   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  12   LSLAITASFLVASATARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  71

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC+ D + C+PGNPSIFVTATNFCPPNFA P+D+GGWC
Sbjct  72   NTAALSTALFNNGLSCGACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNFAQPSDDGGWC  131

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPR HFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+
Sbjct  132  NPPRQHFDLAMPMFLKIAQYRAGIVPVSFRRVPCRKKGGIRFTI  175



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   278 bits (712),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA      +  L+   TAV ARIPG YSGG WQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAIKGFTYLVYLIIISTAVEARIPGFYSGGEWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGV+ AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVSTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  169



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   278 bits (711),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVL-CIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA + V+ CIA ++  L   + ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MALLAVIACIATIVSVLPPPIEARIPGVYSGGGWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVN AALSTALFNNG SCGACFEIKC+N++  C  G+PSI VTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANEKQWCHAGSPSILVTATNFCPPNYALP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPVNFRR+ CRKQGGIRFT+
Sbjct  121  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVNFRRVACRKQGGIRFTI  171



>ref|NP_001234761.1| expansin18 precursor [Solanum lycopersicum]
 emb|CAA06271.2| expansin18 [Solanum lycopersicum]
Length=260

 Score =   278 bits (711),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 147/165 (89%), Gaps = 4/165 (2%)
 Frame = +2

Query  86   LCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
             C+A L  L  LTA  ARIPGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  8    FCVASLFSLILLTA-EARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VNN ALSTALFNNGLSCGACFEIKC N  + C PG+PSIF+TATNFCPPNFALPNDNGGW
Sbjct  67   VNNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALPNDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFL IA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  127  CNPPRPHFDLAMPMFLHIAEYRAGIVPVVYRRVPCRKQGGIRFTI  171



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA V +LCIA LL    A +ARI G  +GG W+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFVHMLCIASLLSLFMAANARIRGFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            +GYGVN AALSTALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+ALPND
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPPR HFDLAMPMFL+IA Y+AGIVPV+FRR+PCRK+GG+RFT+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTI  169



>ref|XP_011042710.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=262

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 149/173 (86%), Gaps = 5/173 (3%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV----HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  235
            MA  R+LC    L  + ++     ARIPGVYSGGAW+TAHATFYGGADASGTMGGACGYG
Sbjct  1    MATSRLLCFTTTLLIMMSLMWKGEARIPGVYSGGAWETAHATFYGGADASGTMGGACGYG  60

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  412
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LP+DNGGWC PPRPHFDLAMPMFLKIA Y AGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  LPSDNGGWCTPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTI  173



>ref|XP_004302749.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=260

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +2

Query  77   VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  256
            +R+LCIA L   L   +ARIPG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  6    LRLLCIASLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGY  65

Query  257  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  433
            GVN AALSTALFNNGLSCGACFEIKC +D R C+ G PSIFVTATNFCPPNFA P+DNGG
Sbjct  66   GVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGG  125

Query  434  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            WCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PC K+GGIRFT+
Sbjct  126  WCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTI  171



>emb|CAN73252.1| hypothetical protein VITISV_027049 [Vitis vinifera]
Length=247

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 1/150 (1%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
             ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  9    EARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  68

Query  305  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  481
            SCGACFE+KC+ND   C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  69   SCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  128

Query  482  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LKIA YRAGIVPV+FRR+PCRKQGGIRFT+
Sbjct  129  LKIAEYRAGIVPVSFRRVPCRKQGGIRFTI  158



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            A+ V    +L  S     ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  6    ALAVTVALVLASSALLADARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGV  AALSTAL+N+GL CGACFEIKC++D R C  GNPSIF+TATNFCPPN+ALP+DNG
Sbjct  66   YGVETAALSTALYNDGLRCGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYALPSDNG  125

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GGIRFT+
Sbjct  126  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKSGGIRFTI  172



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 151/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  68   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  238
            MAA+  +LCI  L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  239  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  415
            LYSQGYGVN AALSTALFN+GLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            P+D+GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  PSDDGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  172



>ref|XP_010510558.1| PREDICTED: expansin-A6 [Camelina sativa]
 ref|XP_010470018.1| PREDICTED: expansin-A6 [Camelina sativa]
Length=256

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  92   IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  271
            +  +L  L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN A
Sbjct  7    VLFVLTILATSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  66

Query  272  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  448
            ALSTALFNNG SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA P+DNGGWCNPP
Sbjct  67   ALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPP  126

Query  449  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            RPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+
Sbjct  127  RPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTI  167



>gb|ABK93258.1| unknown [Populus trichocarpa]
Length=182

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 149/173 (86%), Gaps = 5/173 (3%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV----HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  235
            MA   +LC    L  + ++     ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  412
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LP+DNGGWCNPPRPHFDLAMPMFLKIA Y AGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTI  173



>emb|CDY47883.1| BnaA07g14280D [Brassica napus]
Length=260

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            VLCI  +L   T +   RIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GG+RFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKIGGMRFTI  171



>ref|XP_007163413.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
 gb|ESW35407.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
Length=258

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M  + +  I  LL  LT   A+IPG +SGG WQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MPMLNIFAIVSLLPFLTPSQAKIPGAFSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNG SCGACF+IKC++D + C PGNPSIFVTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFQIKCTHDPKWCLPGNPSIFVTATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+ CRK+GG+RFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVGCRKEGGMRFTM  169



>emb|CAA04385.1| Expansin [Brassica napus]
Length=260

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMG ACGYGNLY++GYG
Sbjct  7    VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGSACGYGNLYTKGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTI  171



>emb|CDP00110.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            + CI  L   LT   ARIPGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  3    LTCIIALSLLLTPTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  62

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+ALPNDNGGWC
Sbjct  63   NTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPNDNGGWC  122

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFL+IA YRAGIVPV++RR+PCRKQGGIRF +
Sbjct  123  NPPRPHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQI  166



>ref|XP_006350774.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=260

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 147/171 (86%), Gaps = 3/171 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV--HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            M  + V C    L SL  +   ARIPGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGFLNVACCVASLFSLILLTAEARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYGVNN ALSTALFNNGLSCGACFEIKC N  + C PG+PSIF+TATNFCPPNFALP
Sbjct  61   YSQGYGVNNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALP  120

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NDNGGWCNPPRPHFDLAMPMFL IA YRAGIVPV +RR+PCRKQGGIRFT+
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVVYRRVPCRKQGGIRFTI  171



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA  R+LC   L  SL A  +A+IPGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MALFRMLCFFSLALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFE+KC  D + C+PGNP+I +TATNFCPPNFA P+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPS  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTI  170



>dbj|BAN09210.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=262

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 140/152 (92%), Gaps = 3/152 (2%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
             ARIPGVYSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGVYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  305  SCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  475
            SCGACFEIKC ND   R C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMP
Sbjct  82   SCGACFEIKCINDPNWRWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMP  141

Query  476  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            MFL +A YRAGIVPV +RR+PCRK GG+RFT+
Sbjct  142  MFLNLAQYRAGIVPVTYRRVPCRKHGGVRFTI  173



>gb|KHN30166.1| Expansin-A4 [Glycine soja]
Length=292

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 145/162 (90%), Gaps = 4/162 (2%)
 Frame = +2

Query  98   LLLCSLT---AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  268
            +LLC ++    V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN 
Sbjct  7    VLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  66

Query  269  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNP  445
            AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCP N+ALPNDNGGWCNP
Sbjct  67   AALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPSNYALPNDNGGWCNP  126

Query  446  PRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PRPHFDLAMPMFLKIA YRAGIVPV FRR+ CRK GGIRFT+
Sbjct  127  PRPHFDLAMPMFLKIAEYRAGIVPVAFRRVACRKHGGIRFTI  168



>ref|NP_180461.1| expansin A6 [Arabidopsis thaliana]
 sp|Q38865.2|EXPA6_ARATH RecName: Full=Expansin-A6; Short=AtEXPA6; AltName: Full=Alpha-expansin-6; 
Short=At-EXP6; Short=AtEx6; AltName: Full=Ath-ExpAlpha-1.8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC33223.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAL25606.1| At2g28950/F8N16.24 [Arabidopsis thaliana]
 gb|AAB38072.2| expansin At-EXPA6 [Arabidopsis thaliana]
 gb|AAL62401.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAM15074.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAO30068.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AEC08194.1| expansin A6 [Arabidopsis thaliana]
Length=257

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  266  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  125

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+
Sbjct  126  PPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTI  168



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  89   CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            C+A LL S+  V  ARIPGVY+G AW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISVMWVAEARIPGVYTGDAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  266  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTI  171



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 149/173 (86%), Gaps = 5/173 (3%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV----HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  235
            MA   +LC    L  + ++     ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  412
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LP+DNGGWCNPPRPHFDLAMPMFLKIA Y AGIVPV +RR+PCRK+GGIRFT+
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTI  173



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   276 bits (707),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 149/169 (88%), Gaps = 3/169 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA   VLC  L L  LTA +A+IPGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVFNVLCF-LSLLFLTA-NAKIPGVYTGGPWESAHATFYGGSDASGTMGGACGYGNLYS  58

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  59   QGYGVNTAALSTALFNNGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSD  118

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  119  DGGWCNPPRTHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGIRFTI  167



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   276 bits (707),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +R++ +A LL  L    ARIPGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSSGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGV  AALSTALFN+G+SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNDGMSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +GGWCNPP PHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  121  DGGWCNPPXPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTI  169



>ref|XP_010264435.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  301
            V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VDARIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  302  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  478
            LSCGACFEIKC+ND + C PG PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGACFEIKCANDPQWCHPGGPSILITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPM  140

Query  479  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            FLKIA YRAGIVPV +RR+PCRK GGIRFT+
Sbjct  141  FLKIAEYRAGIVPVAYRRVPCRKHGGIRFTI  171



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +R++ +A +L  L+   ARI GVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASVLAFLSPAAARILGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGV  AALSTALFN G SCGACFEIKC++D S C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNEGQSCGACFEIKCADDPSWCHRGSPSIFITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTI  169



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +2

Query  101  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  280
            LL  LT   ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLADARIPGVYAGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  281  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  457
            TALFN+GLSCGACFEIKC  + R C PG+PSI +TATNFCPPN+ALP+DNGGWCNPPRPH
Sbjct  74   TALFNDGLSCGACFEIKCGEEPRWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPH  133

Query  458  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  134  FDLAMPMFLKIAQYRAGIVPVSYRRVPCRKAGGIRFTI  171



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA  +  +A++L +   VHARIPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVITLMAVMLATAFTVHARIPGVYTGGPWVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFAQASD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RRIPCRK+GGIRFT+
Sbjct  121  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTI  169



>gb|KFK32246.1| hypothetical protein AALP_AA6G217100 [Arabis alpina]
Length=257

 Score =   276 bits (706),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 3/164 (2%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            VL +  +L  LT   ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLLVLTILADLT--EARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWC
Sbjct  65   NTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWC  124

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+
Sbjct  125  NPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTI  168



>ref|XP_006410954.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
 dbj|BAJ34443.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52407.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
Length=263

 Score =   276 bits (706),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = +2

Query  77   VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            +R L +A+ +   L A +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFLWLAVTISFLLAATNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFNNG SCGACFEIKC++D R C PGNPSIFVTATNFCPPNFA P+D+G
Sbjct  68   YGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSIFVTATNFCPPNFAQPSDDG  127

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFTV
Sbjct  128  GWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTV  174



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   276 bits (706),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA  R+LC   +  SL A  +A+IPGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MALFRMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFE+KC  D + C+PGNP+I +TATNFCPPNFA P+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPS  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTI  170



>ref|XP_010111142.1| hypothetical protein L484_010756 [Morus notabilis]
 gb|EXC30507.1| hypothetical protein L484_010756 [Morus notabilis]
Length=258

 Score =   276 bits (705),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA +  + +  L+     V A+IPG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAPLSFIILLSLIACAAFVDAKIPGNYGGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI VTATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSILVTATNFCPPNYALPND  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGG+RFT+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGVRFTI  169



>ref|XP_006488339.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO72838.1| hypothetical protein CISIN_1g046524mg [Citrus sinensis]
Length=259

 Score =   275 bits (704),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V    + L L+C +    AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAVVNWAGVILSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALP+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPS  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTI  170



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   276 bits (705),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 148/172 (86%), Gaps = 4/172 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  238
            MA    +C+ L + +   LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGN
Sbjct  2    MATAFGICLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGN  61

Query  239  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  415
            LYSQGYGVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA 
Sbjct  62   LYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQ  121

Query  416  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            P+D+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFTV
Sbjct  122  PSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTV  173



>ref|XP_006366490.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=257

 Score =   275 bits (704),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
             C+ ++L  +  V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    FCLIIILVIIVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  266  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
            NAALSTALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+ALPNDNGGWCN
Sbjct  66   NAALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCN  125

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            PPR HFDLAMPMFLKIA YRAGIVPV +RR+ CRKQGGIRFT+
Sbjct  126  PPRTHFDLAMPMFLKIAEYRAGIVPVVYRRVSCRKQGGIRFTI  168



>ref|XP_006424843.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
 gb|ESR38083.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
Length=259

 Score =   275 bits (704),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA V    + L L+C +    AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAVVNWAGVILSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALP+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPS  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTI  170



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            +AV      +L  S     ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  6    SAVAATVALVLASSALLADARIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQ  65

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  427
            GYGV  AALSTALFN+GLSCGACFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+D+
Sbjct  66   GYGVETAALSTALFNDGLSCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNYALPSDD  125

Query  428  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  126  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTI  173



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = +2

Query  77   VRVLCIALLLCSL-TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            + + CIA L+ SL + V ARIPG Y GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  1    MSLACIASLVISLFSVVEARIPGNYGGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  60

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFN G SCGACFEIKC+ND + C  G+PSI VTATNFCPPN+ALPNDNG
Sbjct  61   YGVNTAALSTALFNKGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYALPNDNG  120

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGG+RFT+
Sbjct  121  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGVRFTI  167



>ref|XP_011077214.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=259

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  244
            MA +   CIA LL  L + V  RIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMGFSCIAALLLLLLSYVECRIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  245  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  421
            SQGYGVN AALSTALFNNG SCGACFEIKC ++ + C PG+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCRDEPQWCHPGSPSIFITATNFCPPNYALPN  120

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PC K+GGIRFT+
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCHKKGGIRFTI  170



>ref|XP_004490888.1| PREDICTED: expansin-A4-like [Cicer arietinum]
Length=260

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 140/150 (93%), Gaps = 1/150 (1%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
             ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN GL
Sbjct  22   EARIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNEGL  81

Query  305  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  481
            SCGACFEIKCS+D + C  G+PSI VTATNFCPPN+A P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCSDDPNWCHAGSPSILVTATNFCPPNYAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  482  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  142  LKIAQYRAGIVPVSYRRVPCRKQGGIRFTI  171



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = +2

Query  113  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  292
            LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  20   LTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  293  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  469
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLA
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLA  139

Query  470  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            MPMFLKI  YRAGIVPV++RR+PCRK GGIRFTV
Sbjct  140  MPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTV  173



>ref|XP_009124371.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A6 [Brassica rapa]
Length=260

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            VLCI  +L   T +   RIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
            VN AALSTALFNNG SCGACFE+ C++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGYSCGACFELXCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GG+RFT+
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKIGGMRFTI  171



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +2

Query  77   VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  256
            + V  + L +  L+   ARIPG+YSG AWQ+AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  7    ILVTALPLFVLFLSFADARIPGIYSGSAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  66

Query  257  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  433
            GVN AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGG
Sbjct  67   GVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNFAQPSDNGG  126

Query  434  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            WCNPPR HFDLAMPMFLKIA YRAGIVP+++RR+PCRK+GGIRFT+
Sbjct  127  WCNPPRAHFDLAMPMFLKIAEYRAGIVPISYRRVPCRKRGGIRFTI  172



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 4/166 (2%)
 Frame = +2

Query  86   LCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  256
            +C+ L + +   LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  8    ICLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  257  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  433
            GVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GG
Sbjct  68   GVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGG  127

Query  434  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            WCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFTV
Sbjct  128  WCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTV  173



>gb|KFK36651.1| alpha-expansin 4 [Arabis alpina]
Length=261

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  113  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  292
            LTA +A+IPGVY+GG WQ AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   LTASNAKIPGVYTGGPWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  293  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  469
            NNGLSCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLA
Sbjct  79   NNGLSCGACFEMKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLA  138

Query  470  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            MPMFLKI  YRAGIVPV++RR+PCRK GGIRFTV
Sbjct  139  MPMFLKIGIYRAGIVPVSYRRVPCRKLGGIRFTV  172



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M+   VL +ALL   +    ARIPGVYSG  W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MSPKWVLALALLASIMVPAFARIPGVYSGSDWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGV  AALSTALFN+GLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNSGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+ CRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVSCRKPGGIRFTI  169



>gb|AAM62987.1| expansin AtEx6 [Arabidopsis thaliana]
Length=257

 Score =   274 bits (700),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  266  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  442
             AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  125

Query  443  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
             PRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+
Sbjct  126  XPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTI  168



>ref|XP_011077647.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=266

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 10/175 (6%)
 Frame = +2

Query  59   SGKMAAVR-VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  235
            S  +AA++ +LCIA +LC +T+ +ARIPGVY+GG W+ A +      DASGTMGGACGYG
Sbjct  9    SKMVAAMKLILCIATVLCFITSAYARIPGVYTGGPWEAARS------DASGTMGGACGYG  62

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPN  406
            NLYSQGYGVN AALSTALFNNGLSCGACFEIKC    + + C+PGNPSI +TATNFCPPN
Sbjct  63   NLYSQGYGVNTAALSTALFNNGLSCGACFEIKCDAAQDAKWCNPGNPSILITATNFCPPN  122

Query  407  FALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +ALPNDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+
Sbjct  123  YALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTI  177



>ref|XP_010557251.1| PREDICTED: expansin-A6-like [Tarenaya hassleriana]
Length=259

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 3/166 (2%)
 Frame = +2

Query  77   VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  256
            V VL + + L S++   ARIPGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  7    VFVLTVLVGLTSMS--EARIPGVYRGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  257  GVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGG  433
            GV+ AALSTALFNNG  CGACFEIKC+ND + C  G+PSIF+TATNFCPPNFALP+DNGG
Sbjct  65   GVSTAALSTALFNNGYRCGACFEIKCANDPTWCHSGSPSIFITATNFCPPNFALPSDNGG  124

Query  434  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            WCNPPRPHFDLAMPMFL+IA YRAGIVPV +RR+PCRK+GGIRFT+
Sbjct  125  WCNPPRPHFDLAMPMFLRIAEYRAGIVPVAYRRVPCRKRGGIRFTI  170



>ref|XP_011031225.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=258

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA   +    L+  L+ V ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAARATISFISLVLLLSLVEARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTI  169



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  301
            VHARIPGVY+ G W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G
Sbjct  19   VHARIPGVYTSGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  78

Query  302  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  478
            LSCGACFEIKC+ND + C  G+PSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  79   LSCGACFEIKCANDPKWCHSGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  138

Query  479  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            FLKIA YRAGIVPV FRR+ CRK GGIRFTV
Sbjct  139  FLKIAEYRAGIVPVAFRRVSCRKSGGIRFTV  169



>gb|EPS67093.1| hypothetical protein M569_07682, partial [Genlisea aurea]
Length=261

 Score =   273 bits (699),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  86   LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  265
            L ++  L  + + HARIPGVY+G  W++AHATFYGGADASGTMGGACGYGNLYSQGYGVN
Sbjct  8    LFVSAALSFIASSHARIPGVYAGTGWESAHATFYGGADASGTMGGACGYGNLYSQGYGVN  67

Query  266  NAALSTALFNNGLSCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGW  436
             AALSTALFN GLSCGACFEI+C    + R CSPG PSI VTATNFCPPN+ALP+D GGW
Sbjct  68   TAALSTALFNTGLSCGACFEIRCDESQDGRWCSPGRPSISVTATNFCPPNYALPSDKGGW  127

Query  437  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            CNPPRPHFDLAMPMFLKIA YRAGIV VNFRRIPCRK GGIRFTV
Sbjct  128  CNPPRPHFDLAMPMFLKIAEYRAGIVAVNFRRIPCRKAGGIRFTV  172



>ref|XP_006294844.1| hypothetical protein CARUB_v10023895mg [Capsella rubella]
 gb|EOA27742.1| hypothetical protein CARUB_v10023895mg [Capsella rubella]
Length=256

 Score =   273 bits (697),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 1/150 (1%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
             ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  18   EARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  77

Query  305  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  481
            SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  78   SCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  137

Query  482  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LKIA YRAGIVPV+FRR+PCRK+GGIRFT+
Sbjct  138  LKIAEYRAGIVPVSFRRVPCRKRGGIRFTI  167



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA V+++ +      L    A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIVKLVILFTTFLFLNIADAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+D
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTI  169



>gb|EYU26594.1| hypothetical protein MIMGU_mgv1a012061mg [Erythranthe guttata]
Length=262

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +2

Query  71   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  250
            AA  +L I  +LC +T   A+I GVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  4    AATLLLYIGSILCFITTARAKIFGVYAGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  251  GYGVNNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFALPN  421
            GYGVN AALSTALFNNGLSCGACFEIKC    + +SC+PG+PSI +TATNFCPPN ALPN
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFEIKCDAAQDSKSCNPGSPSILITATNFCPPNNALPN  123

Query  422  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            DNGGWCNPPR HFDLA+PMF+KIA +RAGIV VN+RR+ CRKQGG+RFTV
Sbjct  124  DNGGWCNPPRTHFDLAVPMFIKIAEFRAGIVAVNYRRVACRKQGGVRFTV  173



>gb|KJB46593.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=293

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 153/198 (77%), Gaps = 32/198 (16%)
 Frame = +2

Query  74   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMG------------  217
            ++ +LC   LL   T+V+A+IPGVYS G+W+TAHATFYGG+DASGTMG            
Sbjct  7    SLALLCFTSLLPFFTSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGISQITLPSPPSK  66

Query  218  -------------------GACGYGNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSN  340
                               GACGYGNLYSQGYGVN AALSTALFNNGLSCGACFEIKC++
Sbjct  67   SHIFMTLHLIVFFFCCFLGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCAS  126

Query  341  D-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVP  517
            D R C PG+PSIFVTATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVP
Sbjct  127  DPRWCHPGSPSIFVTATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  186

Query  518  VNFRRIPCRKQGGIRFTV  571
            V+FRR+PCRK GGIRFTV
Sbjct  187  VSFRRVPCRKHGGIRFTV  204



>gb|AFK33369.1| unknown [Lotus japonicus]
Length=180

 Score =   270 bits (689),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 3/162 (2%)
 Frame = +2

Query  80   RVLCI--ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            RVLC+  A L+  +  V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  7    RVLCLYMASLISLMWMVQARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNG
Sbjct  67   YGVNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNG  126

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGG  556
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCR   G
Sbjct  127  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRSLVG  168



>ref|XP_002312101.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEE89468.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 1/150 (1%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
             ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  305  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  481
            SCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  482  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKPGGIRFTI  169



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   272 bits (696),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +2

Query  113  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  292
             TA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  20   FTASNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  293  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  469
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLA
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLA  139

Query  470  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            MPMFLKI  YRAGIVPV++RR+PCRK GGIRFTV
Sbjct  140  MPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTV  173



>gb|ABK93541.1| unknown [Populus trichocarpa]
Length=258

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 1/150 (1%)
 Frame = +2

Query  125  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  304
             ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  305  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  481
            SCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  482  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKPGGIRFTI  169



>ref|NP_001150534.1| alpha-expansin 6 precursor [Zea mays]
 gb|ACG39445.1| alpha-expansin 6 precursor [Zea mays]
Length=263

 Score =   272 bits (696),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 143/167 (86%), Gaps = 8/167 (5%)
 Frame = +2

Query  95   ALLLCSLTAVH-----ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  259
            ALLL   TA+      ARIPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    ALLLVVATAMMFSPAAARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  260  VNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            VNNAALSTALFN GLSCGACFEIKC +    R C PG+PSI VTATNFCPPN+ALP+D+G
Sbjct  67   VNNAALSTALFNQGLSCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYALPSDDG  126

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPRPHFDLAMPMFL IA YRAGIVPV +RR+PCRK GG+RFT+
Sbjct  127  GWCNPPRPHFDLAMPMFLHIAEYRAGIVPVTYRRVPCRKSGGVRFTI  173



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVLTLMAVMVVTALTVNAKIPGVYNGGPWVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RRIPCRK+GGIRFT+
Sbjct  121  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTI  169



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +D
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTI  169



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVLTLMAVMVATALTVNAKIPGVYNGGPWINAHATFYGGADASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RRIPCRK+GGIRFT+
Sbjct  121  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTI  169



>gb|AAV85475.1| expansin [Populus tomentosa]
Length=258

 Score =   271 bits (693),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MAA   +    L+  L+ V ARIPGVY+G  WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAARATISFISLVLLLSLVEARIPGVYTGADWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCR+ GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCREPGGIRFTI  169



>ref|XP_009130690.1| PREDICTED: expansin-A9-like [Brassica rapa]
 emb|CDY55128.1| BnaA03g55050D [Brassica napus]
Length=261

 Score =   271 bits (693),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 146/169 (86%), Gaps = 3/169 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M A+ ++ +A L  +LT V+A+IPGVY+GG W  AHATFYG ADASGTMGGACGYGNLYS
Sbjct  6    MTAMAIMVVAAL--TLTTVNAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  63

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNFA  +D
Sbjct  64   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASD  123

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RRIPCRK+GG+RFT+
Sbjct  124  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGMRFTI  172



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +2

Query  77   VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            +R + +A+     LT  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFMWLAVTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFNNG SCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+G
Sbjct  68   YGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDG  127

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  128  GWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTI  174



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +2

Query  77   VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            +R + +A+     LT  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFMWLAVTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFNNG SCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+G
Sbjct  68   YGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDG  127

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  128  GWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTI  174



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  80   RVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  253
            R+L   + L +   +   ARIPGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYSQG
Sbjct  6    RILLNTLPLFVLFFSFADARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYSQG  65

Query  254  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  430
            YGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPNFA P+DNG
Sbjct  66   YGVNTAALSTALFNNGFSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFAQPSDNG  125

Query  431  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            GWCNPPR HFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  126  GWCNPPRAHFDLAMPMFLKLAEYRAGIVPVSYRRVPCRKRGGIRFTI  172



>ref|XP_010111457.1| hypothetical protein L484_021280 [Morus notabilis]
 gb|EXC30980.1| hypothetical protein L484_021280 [Morus notabilis]
Length=263

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 149/174 (86%), Gaps = 6/174 (3%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTA-----VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGY  232
            MAA+  L I L + SL +       ARI GVY+G  W +AHATFYGG+DASGTMGGACGY
Sbjct  1    MAALFTLPILLPIASLLSLLFLSADARIGGVYTGSPWDSAHATFYGGSDASGTMGGACGY  60

Query  233  GNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  409
            GNLYSQGYGVN AALSTALFNNGLSCG+CFE+KC  D + C PG+PSIF+TATNFCPPNF
Sbjct  61   GNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCDGDPKWCHPGSPSIFITATNFCPPNF  120

Query  410  ALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            ALPNDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+
Sbjct  121  ALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTI  174



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M  +R++ +A +L   +   ARI GV++GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MGIMRLVALASILAFFSPAAARIMGVFTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYGV  AALSTALFN+G SCGACFEIKC ++ + C PG+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNDGQSCGACFEIKCVDEPQWCHPGSPSIFITATNFCPPNYALPSD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTI  169



>emb|CDX80810.1| BnaC03g00640D [Brassica napus]
Length=261

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 146/169 (86%), Gaps = 3/169 (2%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            M A+ ++ +A L  +LT V+A+IPGVY+GG W  AHATFYG ADASGTMGGACGYGNLYS
Sbjct  6    MTAMAIMVVAAL--TLTTVNAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  63

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  424
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNFA  +D
Sbjct  64   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASD  123

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RRIPCRK+GG+RFT+
Sbjct  124  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGMRFTI  172



>ref|XP_004145295.1| PREDICTED: expansin-A4-like [Cucumis sativus]
Length=258

 Score =   271 bits (692),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  262
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMG  CGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMG-RCGYGNLYSQGYGV  65

Query  263  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  439
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  66   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  125

Query  440  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+
Sbjct  126  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRKPGGIRFTI  169



>gb|KHN33378.1| Expansin-A4 [Glycine soja]
Length=254

 Score =   270 bits (691),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 146/173 (84%), Gaps = 13/173 (8%)
 Frame = +2

Query  83   VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG---------  235
            VLC   L+  +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYG         
Sbjct  7    VLC---LMSLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGWVCGACGYG  63

Query  236  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  412
            NLYSQGYGVN AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCP N+A
Sbjct  64   NLYSQGYGVNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPSNYA  123

Query  413  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            LPNDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+
Sbjct  124  LPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACRKHGGIRFTI  176



>ref|XP_010937609.1| PREDICTED: expansin-A4 [Elaeis guineensis]
Length=260

 Score =   270 bits (691),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +2

Query  92   IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  271
            +  LL   T   ARIPGVY+G +WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  A
Sbjct  11   VMTLLAFATLGDARIPGVYTGESWQKAHATFYGGSDASGTMGGACGYGNLYSQGYGVETA  70

Query  272  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  448
            ALSTALFN+GLSCGACFEIKC++D + C  G PSIF+TATNFCPPN+ALP+DNGGWCNPP
Sbjct  71   ALSTALFNDGLSCGACFEIKCADDPQWCHHGGPSIFITATNFCPPNYALPSDNGGWCNPP  130

Query  449  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            RPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  131  RPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKSGGIRFTI  171



>ref|XP_008799850.1| PREDICTED: expansin-A6-like [Phoenix dactylifera]
Length=260

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = +2

Query  101  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  280
            LL  LT   ARIPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLGDARIPGVYTGGPWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  281  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  457
            TALFN+G SCGACFEIKC  D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPH
Sbjct  74   TALFNDGQSCGACFEIKCGEDLKWCHHGSPSIFITATNFCPPNYALPSDNGGWCNPPRPH  133

Query  458  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+
Sbjct  134  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTI  171



>ref|XP_006294816.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
 gb|EOA27714.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
Length=262

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = +2

Query  86   LCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  256
            +C+ L + +   LTA  A+I GVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  8    ICLWLAVTASFLLTASDAKIAGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  257  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  433
            GVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA  +DNGG
Sbjct  68   GVNTAALSTALFNNGYSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQASDNGG  127

Query  434  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            WCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFTV
Sbjct  128  WCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKVGGIRFTV  173



>dbj|BAE06067.1| expansin [Sagittaria pygmaea]
Length=266

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  301
            V AR+PGVYSG  WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G
Sbjct  27   VDARVPGVYSGSEWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNQG  86

Query  302  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  478
            LSCGACFEIKC+ND + C  G PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  87   LSCGACFEIKCANDPQWCHGGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  146

Query  479  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            FLKIA YRAGIVPV +RR+PCRK GGIRFT+
Sbjct  147  FLKIAQYRAGIVPVQYRRVPCRKSGGIRFTI  177



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 148/171 (87%), Gaps = 5/171 (3%)
 Frame = +2

Query  68   MAAVR--VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  241
            MA ++  +L  A LL +L    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAVIKLAILFTAYLLFNL--ADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNL  58

Query  242  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  418
            YSQGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  
Sbjct  59   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQA  118

Query  419  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            +DNGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  119  SDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTI  169



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   269 bits (688),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  247
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  248  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  424
            QGYG N AALSTALFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +D
Sbjct  61   QGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASD  120

Query  425  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTV  571
            NGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+
Sbjct  121  NGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTI  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515