BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN004N06

Length=538
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...    228   2e-72   Petunia x hybrida [garden petunia]
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...    228   3e-72   Petunia x hybrida [garden petunia]
gb|AFK48034.1|  unknown                                                 224   6e-71   Lotus japonicus
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...    224   7e-71   Eucalyptus grandis [rose gum]
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    224   8e-71   Eucalyptus globulus [blue gum]
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...    223   2e-70   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    223   3e-70   Solanum tuberosum [potatoes]
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    222   3e-70   Solanum tuberosum [potatoes]
gb|AFK42721.1|  unknown                                                 222   5e-70   Lotus japonicus
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   7e-70   Solanum tuberosum [potatoes]
gb|AFK36660.1|  unknown                                                 221   8e-70   Lotus japonicus
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   1e-69   Solanum tuberosum [potatoes]
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    221   2e-69   Solanum tuberosum [potatoes]
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    221   2e-69   Solanum tuberosum [potatoes]
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   2e-69   
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   2e-69   Solanum tuberosum [potatoes]
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   2e-69   
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...    220   3e-69   Solanum lycopersicum
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   3e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   3e-69   Nicotiana sylvestris
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    220   3e-69   Solanum tuberosum [potatoes]
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   4e-69   Nicotiana tomentosiformis
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...    219   5e-69   Solanum tuberosum [potatoes]
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   5e-69   Nicotiana sylvestris
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...    219   6e-69   Malus sp.
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   6e-69   Nicotiana sylvestris
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   6e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   7e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   7e-69   Malus domestica [apple tree]
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   7e-69   Pyrus x bretschneideri [bai li]
gb|AAR83879.1|  Cristal-Glass1 protein                                  219   8e-69   Capsicum annuum
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   8e-69   
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   9e-69   Eucalyptus grandis [rose gum]
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    219   9e-69   Capsicum annuum
gb|AHI85721.1|  stress-induced protein 16                               218   1e-68   Capsicum annuum
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    218   1e-68   Solanum lycopersicum
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    218   1e-68   Nicotiana attenuata
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...    218   1e-68   Solanum tuberosum [potatoes]
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   2e-68   
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...    218   2e-68   Wolffia australiana
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...    218   2e-68   Pyrus pyrifolia [sha li]
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   2e-68   Pyrus x bretschneideri [bai li]
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...    218   2e-68   Capsicum annuum
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                     218   2e-68   Eucalyptus grandis [rose gum]
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    218   2e-68   Solanum tuberosum [potatoes]
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...    217   3e-68   Nelumbo nucifera [Indian lotus]
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    217   3e-68   Solanum lycopersicum
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...    217   4e-68   Nicotiana tomentosiformis
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...    217   4e-68   Stellaria longipes
gb|AFK33868.1|  unknown                                                 217   4e-68   Lotus japonicus
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit     216   6e-68   Malus domestica x Pyrus communis
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...    216   8e-68   Betula pendula [white birch]
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...    216   1e-67   Nicotiana sylvestris
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...    216   1e-67   Nicotiana sylvestris
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...    216   2e-67   Mesembryanthemum crystallinum
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...    216   2e-67   Nelumbo nucifera [Indian lotus]
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...    215   2e-67   Fragaria vesca subsp. vesca
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    215   2e-67   Ammopiptanthus mongolicus
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...    215   2e-67   Fragaria vesca subsp. vesca
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...    215   2e-67   Mesembryanthemum crystallinum
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...    215   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...    215   3e-67   Nelumbo nucifera [Indian lotus]
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...    215   3e-67   Mesembryanthemum crystallinum
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    214   4e-67   Mesembryanthemum crystallinum
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   4e-67   Blitum nuttallianum
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    214   5e-67   Panax ginseng [Asiatic ginseng]
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...    214   6e-67   Ricinus communis
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...    214   8e-67   Mesembryanthemum crystallinum
ref|WP_026003795.1|  hypothetical protein                               211   9e-67   
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...    213   1e-66   Mesembryanthemum crystallinum
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    213   1e-66   Mesembryanthemum crystallinum
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                   213   1e-66   Mesembryanthemum crystallinum
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...    213   2e-66   
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    213   2e-66   Corchorus olitorius [Nalta jute]
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    213   2e-66   Amaranthus hypochondriacus [prince's feather]
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg             212   3e-66   Prunus persica
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    212   4e-66   Eucalyptus globulus [blue gum]
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...    212   5e-66   Cucumis melo [Oriental melon]
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...    211   6e-66   Fagus crenata
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    211   6e-66   Lemna gibba
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...    211   6e-66   Prunus mume [ume]
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...    211   6e-66   Ricinus communis
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    211   6e-66   Lemna gibba
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   7e-66   Coffea arabica [arabica coffee]
gb|ABK96567.1|  unknown                                                 211   7e-66   Populus trichocarpa x Populus deltoides
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    211   7e-66   Lemna gibba
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    211   7e-66   Chenopodium album [lamb's-quarters]
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    210   9e-66   Blitum nuttallianum
pdb|3RUB|S  Chain S, Crystal Structure Of The Unactivated Form Of...    209   1e-65   Nicotiana tabacum [American tobacco]
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   2e-65   Nicotiana tomentosiformis
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...    210   2e-65   Populus trichocarpa [western balsam poplar]
ref|WP_037767734.1|  hypothetical protein                               208   2e-65   
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    210   2e-65   Fagus sylvatica
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    210   2e-65   Amaranthus hypochondriacus [prince's feather]
emb|CAH59401.1|  Rubisco SSU                                            210   2e-65   Plantago major [cart-track plant]
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain           210   2e-65   Medicago truncatula
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...    210   2e-65   
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...    210   2e-65   
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...    210   2e-65   
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...    210   3e-65   Helianthus annuus
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    210   3e-65   Spinacia oleracea
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit     210   3e-65   Spinacia oleracea
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    210   3e-65   Aralia elata
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit    209   4e-65   Cicer arietinum [garbanzo]
gb|AFK40375.1|  unknown                                                 209   4e-65   Medicago truncatula
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    209   5e-65   Lemna gibba
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    209   6e-65   Lemna gibba
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...    209   6e-65   Pisum sativum [garden pea]
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    209   6e-65   Amaranthus hypochondriacus [prince's feather]
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...    209   7e-65   Pisum sativum [garden pea]
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...    209   8e-65   Ricinus communis
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain      208   9e-65   Medicago truncatula
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...    209   9e-65   Mesembryanthemum crystallinum
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...    208   1e-64   Glycine tabacina
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...    208   1e-64   Populus euphratica
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...    208   1e-64   Citrus sinensis [apfelsine]
gb|ACJ85905.1|  unknown                                                 208   1e-64   Medicago truncatula
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain           208   1e-64   Medicago truncatula
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain           208   1e-64   Medicago truncatula
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    207   2e-64   Lemna gibba
pdb|4RUB|S  Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate ...    206   2e-64   Nicotiana tabacum [American tobacco]
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit     207   2e-64   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain           207   2e-64   Medicago truncatula
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg             207   2e-64   Citrus clementina [clementine]
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain           207   2e-64   Medicago truncatula
ref|NP_001235314.1|  uncharacterized protein LOC100500504               207   3e-64   Glycine max [soybeans]
gb|ABK95229.1|  unknown                                                 207   3e-64   Populus trichocarpa [western balsam poplar]
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...    207   3e-64   Glycine max [soybeans]
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...    207   3e-64   
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...    207   4e-64   Glycine max [soybeans]
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...    207   4e-64   
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain      206   4e-64   Medicago truncatula
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...    206   5e-64   Rumex obtusifolius
emb|CAH59404.1|  Rubisco SSU                                            206   8e-64   Plantago major [cart-track plant]
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit    206   9e-64   Cucumis sativus [cucumbers]
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...    206   1e-63   Cucumis sativus [cucumbers]
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...    205   1e-63   Oryza brachyantha
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...    206   1e-63   Medicago sativa [alfalfa]
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...    205   1e-63   Silene latifolia subsp. alba [white campion]
pdb|1AUS|S  Chain S, Activated Unliganded Spinach Rubisco               203   2e-63   Spinacia oleracea
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...    205   2e-63   Oryza brachyantha
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...    205   2e-63   Cucumis sativus [cucumbers]
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    205   2e-63   Arachis hypogaea [goober]
ref|XP_010103758.1|  hypothetical protein L484_014647                   205   3e-63   Morus notabilis
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...    204   3e-63   Oryza brachyantha
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...    204   3e-63   Oryza brachyantha
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    204   3e-63   Camellia sinensis [black tea]
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...    204   3e-63   Setaria italica
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...    204   3e-63   Glycine tomentella [wooly glycine]
pdb|4MKV|S  Chain S, Structure Of Pisum Sativum Rubisco With Aba        202   3e-63   Pisum sativum [garden pea]
gb|KDP20120.1|  hypothetical protein JCGZ_05889                         204   4e-63   Jatropha curcas
gb|ACU13285.1|  unknown                                                 204   4e-63   Glycine max [soybeans]
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...    204   4e-63   Populus euphratica
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    204   4e-63   Glycine max [soybeans]
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit     204   4e-63   Jatropha curcas
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    204   6e-63   Glycine max [soybeans]
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...    204   6e-63   Trifolium repens [creeping white clover]
gb|ABK96431.1|  unknown                                                 204   7e-63   Populus trichocarpa x Populus deltoides
ref|WP_039311749.1|  hypothetical protein                               201   9e-63   Paenibacillus sp. IHB B 3415
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...    203   9e-63   Glycine soja [wild soybean]
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...    203   1e-62   Pyrus x bretschneideri [bai li]
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                   202   1e-62   Pisum sativum [garden pea]
ref|WP_028130706.1|  hypothetical protein                               201   1e-62   Serratia marcescens
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...    203   1e-62   Coffea canephora [robusta coffee]
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    202   2e-62   synthetic construct
gb|AAK16227.1|AF044395_1  ribulose-1,5-bisphosphate carboxylase s...    201   2e-62   Flaveria ramosissima
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...    202   2e-62   Pisum sativum [garden pea]
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...    202   2e-62   
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    202   2e-62   Flaveria pringlei
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...    202   2e-62   Lactuca sativa [cultivated lettuce]
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    202   2e-62   Camellia oleifera [abura-tsubaki]
gb|ABS57004.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   2e-62   synthetic construct
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...    202   3e-62   
gb|AAG49562.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    200   3e-62   Citrus reticulata [mandarin orange]
gb|EAY97115.1|  hypothetical protein OsI_19041                          202   3e-62   Oryza sativa Indica Group [Indian rice]
prf||0902172A  carboxylase/oxygenase,RBP                                200   3e-62
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                   201   3e-62   Oryza sativa [red rice]
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg             202   4e-62   Eutrema salsugineum [saltwater cress]
ref|NP_001066559.1|  Os12g0274700                                       201   4e-62   
ref|NP_001066604.1|  Os12g0291100                                       201   4e-62   
ref|NP_001066606.1|  Os12g0291400                                       201   4e-62   
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...    202   4e-62   Hevea brasiliensis [jebe]
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    201   4e-62   Spinacia turkestanica
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   5e-62   Ageratina adenophora
gb|EMT06085.1|  hypothetical protein F775_43781                         201   6e-62   
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g             201   6e-62   Phaseolus vulgaris [French bean]
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    201   6e-62   Triticum aestivum [Canadian hard winter wheat]
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   6e-62   Gossypium hirsutum [American cotton]
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    201   6e-62   Spinacia oleracea
ref|NP_001066607.1|  Os12g0292400                                       201   6e-62   
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    201   6e-62   Spinacia oleracea
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...    201   7e-62   Brachypodium distachyon [annual false brome]
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    201   7e-62   Flaveria pringlei
gb|AGV54682.1|  ribulose bisphosphate carboxylase                       201   7e-62   Phaseolus vulgaris [French bean]
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   7e-62   Gossypium hirsutum [American cotton]
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...    201   7e-62   Lactuca sativa [cultivated lettuce]
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c         200   7e-62   Oryza sativa Indica Group [Indian rice]
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   8e-62   Gossypium tomentosum
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   8e-62   Gossypium mustelinum
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   8e-62   Gossypium hirsutum [American cotton]
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...    201   8e-62   
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...    201   8e-62   Elaeis guineensis
emb|CDP20139.1|  unnamed protein product                                200   9e-62   Coffea canephora [robusta coffee]
gb|ABR45725.1|  RBCS1                                                   201   9e-62   Actinidia deliciosa [Chinese gooseberry]
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...    201   1e-61   Phoenix dactylifera
gb|EAY82834.1|  hypothetical protein OsI_38046                          200   1e-61   Oryza sativa Indica Group [Indian rice]
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    200   1e-61   Flaveria pringlei
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...    200   1e-61   Brachypodium distachyon [annual false brome]
dbj|BAJ89884.1|  predicted protein                                      200   1e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    199   2e-61   Bromus catharticus [cebadilla]
pdb|1IR1|S  Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bi...    198   2e-61   Spinacia oleracea
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    200   2e-61   Gossypium hirsutum [American cotton]
gb|AAK16228.1|AF044396_1  ribulose-1,5-bisphosphate carboxylase s...    198   2e-61   Flaveria ramosissima
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    200   2e-61   Flaveria pringlei
emb|CAA42618.1|  ribulose bisphosphate carboxylase                      200   2e-61   Phaseolus vulgaris [French bean]
dbj|BAJ90550.1|  predicted protein                                      200   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA10497.1|  hypothetical protein                                   200   2e-61   Secale cereale
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    199   2e-61   Nicotiana tomentosiformis
gb|KCW52064.1|  hypothetical protein EUGRSUZ_J01502                     200   2e-61   Eucalyptus grandis [rose gum]
emb|CAA32702.1|  ribulose bisphosphate carboxylase                      200   2e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CAA32701.1|  ribulose bisphosphate carboxylase                      200   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B      200   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A      200   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B      200   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb|ABR45726.1|  RBCS1                                                   199   2e-61   Actinidia chinensis
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...    200   2e-61   Elaeis guineensis
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    199   2e-61   Flaveria pringlei
pdb|3AXK|S  Chain S, Structure Of Rice Rubisco In Complex With Na...    198   3e-61   Oryza sativa Japonica Group [Japonica rice]
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    199   3e-61   Gossypium tomentosum
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    199   3e-61   Nicotiana tomentosiformis
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   3e-61   Nicotiana sylvestris
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   3e-61   Nicotiana sylvestris
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    199   3e-61   Flaveria pringlei
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit     199   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...    199   4e-61   Arabidopsis lyrata subsp. lyrata
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   4e-61   Nicotiana tomentosiformis
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   4e-61   Nicotiana tomentosiformis
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   4e-61   Nicotiana tabacum [American tobacco]
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    199   4e-61   Phragmites australis
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    199   4e-61   Gossypium raimondii
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...    199   5e-61   Setaria italica
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   5e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   5e-61   Nicotiana sylvestris
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B      199   5e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KDP29409.1|  hypothetical protein JCGZ_18330                         198   5e-61   Jatropha curcas
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    198   5e-61   Aegilops speltoides
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    199   6e-61   Gossypium hirsutum [American cotton]
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   6e-61   Arabidopsis thaliana [mouse-ear cress]
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...    199   6e-61   Hordeum vulgare [barley]
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...    198   6e-61   Flaveria trinervia
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    199   6e-61   Gossypium hirsutum [American cotton]
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   6e-61   Arabidopsis suecica
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    197   6e-61   Nicotiana tomentosiformis
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    198   6e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    199   6e-61   Gossypium mustelinum
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    197   6e-61   Nicotiana sylvestris
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    197   6e-61   Panicum virgatum
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...    199   7e-61   Theobroma cacao [chocolate]
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    198   7e-61   Spinacia tetrandra
dbj|BAJ86022.1|  predicted protein                                      198   7e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    197   7e-61   Nicotiana sylvestris
emb|CAA42617.1|  ribulose bisphosphate carboxylase                      197   7e-61   Phaseolus vulgaris [French bean]
ref|WP_039311073.1|  hypothetical protein                               196   8e-61   Paenibacillus sp. IHB B 3415
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...    198   8e-61   Brachypodium distachyon [annual false brome]
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    198   8e-61   Flaveria pringlei
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...    198   8e-61   
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...    198   8e-61   Phoenix dactylifera
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    198   8e-61   Aegilops speltoides
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   9e-61   Triticum timopheevii subsp. armeniacum
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   9e-61   Aegilops speltoides
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...    198   9e-61   Triticum urartu
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    198   1e-60   Flaveria bidentis
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    198   1e-60   Gossypium hirsutum [American cotton]
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    198   1e-60   Gossypium hirsutum [American cotton]
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...    198   1e-60   Gossypium arboreum [tree cotton]
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   1e-60   Triticum aestivum [Canadian hard winter wheat]
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...    197   1e-60   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   1e-60   Aegilops speltoides
pdb|4HHH|S  Chain S, Structure Of Pisum Sativum Rubisco                 196   1e-60   
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg             198   1e-60   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...    197   1e-60   
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    197   1e-60   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   1e-60   
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg             197   1e-60   
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...    197   1e-60   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    197   1e-60   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...    197   1e-60   
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg             197   1e-60   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   1e-60   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...    197   2e-60   
dbj|BAJ90404.1|  predicted protein                                      197   2e-60   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   2e-60   
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...    197   2e-60   
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...    197   2e-60   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   2e-60   
gb|AAK16231.1|AF044399_1  ribulose-1,5-bisphosphate carboxylase s...    196   2e-60   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   2e-60   
dbj|BAJ90202.1|  predicted protein                                      197   2e-60   
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    197   2e-60   
emb|CAA10496.1|  hypothetical protein                                   197   2e-60   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    197   2e-60   
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...    197   2e-60   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...    197   3e-60   
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...    197   3e-60   
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...    197   3e-60   
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    197   3e-60   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...    196   3e-60   
gb|AAG40356.1|AF325004_1  At1g67090                                     197   3e-60   
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...    197   3e-60   
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...    197   3e-60   
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    197   4e-60   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    196   4e-60   
emb|CAA59218.1|  ribulose-bisphosphate carboxylase                      195   4e-60   
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    196   4e-60   
pdb|3AXM|S  Chain S, Structure Of Rice Rubisco In Complex With 6pg      195   4e-60   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    196   4e-60   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit     196   4e-60   
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...    196   4e-60   
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...    196   4e-60   
emb|CAG25595.1|  putative rubisco small subunit                         196   4e-60   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    196   5e-60   
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...    196   5e-60   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    196   5e-60   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    196   5e-60   
emb|CAH10356.1|  ribulose 1,5 bisphosphate carboxylase/oxygenase,...    195   5e-60   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    196   6e-60   
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    195   6e-60   
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...    196   6e-60   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    196   6e-60   
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...    196   6e-60   
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    196   6e-60   
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                  196   6e-60   
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...    196   8e-60   
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    196   8e-60   
gb|EMS67205.1|  Ribulose bisphosphate carboxylase small chain, ch...    194   8e-60   
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...    196   8e-60   
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    195   8e-60   
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...    196   8e-60   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    196   9e-60   
emb|CAA24969.1|  unnamed protein product                                194   9e-60   
gb|AAK16232.1|AF044400_1  ribulose-1,5-bisphosphate carboxylase s...    194   9e-60   
gb|EMS48023.1|  Ribulose bisphosphate carboxylase small chain, ch...    195   1e-59   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    196   1e-59   
emb|CAA31948.1|  ribulose bisphosphate carboxylase                      196   1e-59   
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...    195   1e-59   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    195   1e-59   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    195   1e-59   
emb|CDY67657.1|  BnaCnng55860D                                          195   1e-59   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    195   1e-59   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    195   1e-59   
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...    195   2e-59   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    194   2e-59   
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...    195   2e-59   
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    195   2e-59   
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    195   2e-59   
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    195   2e-59   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    194   2e-59   
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    194   2e-59   
gb|AAK16230.1|AF044398_1  ribulose-1,5-bisphosphate carboxylase s...    193   2e-59   
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...    195   2e-59   
emb|CDY52468.1|  BnaA04g27920D                                          195   2e-59   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    195   2e-59   
gb|AAP31674.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    192   2e-59   
emb|CDY01665.1|  BnaC04g30870D                                          195   2e-59   
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    194   2e-59   
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    194   2e-59   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...    194   2e-59   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    194   2e-59   
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    194   2e-59   
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg             194   3e-59   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    194   3e-59   
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    194   3e-59   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...    194   3e-59   
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    194   3e-59   
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg             194   3e-59   
pdb|1WDD|S  Chain S, Crystal Structure Of Activated Rice Rubisco ...    192   3e-59   
gb|KJB10450.1|  hypothetical protein B456_001G201800                    194   3e-59   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...    194   4e-59   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    194   4e-59   
dbj|BAJ89663.1|  predicted protein                                      192   4e-59   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    193   5e-59   
emb|CDX67402.1|  BnaA07g14420D                                          194   5e-59   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    194   5e-59   
emb|CDX99682.1|  BnaC04g34390D                                          194   5e-59   
emb|CAH10355.1|  ribulose 1,5 bisphosphate carboxylase/oxygenase,...    193   5e-59   
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    194   5e-59   
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    194   5e-59   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    193   6e-59   
gb|AAK49590.1|AF372874_1  F1O19.10/F1O19.10                             191   7e-59   
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    193   7e-59   
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...    193   7e-59   
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...    193   7e-59   
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    193   7e-59   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...    193   8e-59   
gb|ACQ90230.1|  virus-resistance protein                                196   8e-59   
sp|P00870.1|RBS1_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    191   9e-59   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...    192   9e-59   
gb|KJB43046.1|  hypothetical protein B456_007G181300                    193   1e-58   
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...    193   1e-58   
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...    193   1e-58   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...    192   1e-58   
gb|ABC17790.1|  plastid ribulose-1,5-bisphosphate carboxylase/oxy...    191   1e-58   
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg             193   1e-58   
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    193   1e-58   
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    193   1e-58   
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    193   1e-58   
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    193   1e-58   
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg             193   1e-58   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480          192   1e-58   
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        193   1e-58   
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...    193   1e-58   
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...    193   1e-58   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    192   1e-58   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...    193   1e-58   
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    194   1e-58   
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    192   1e-58   
gb|EMT21849.1|  Ribulose bisphosphate carboxylase small chain PW9...    191   1e-58   
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...    192   2e-58   
emb|CAA70416.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    192   2e-58   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    192   2e-58   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit     192   2e-58   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...    192   2e-58   
emb|CAA30393.1|  ribulose bisphosphate carboxylase                      192   2e-58   
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    192   2e-58   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...    192   2e-58   
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    191   2e-58   
sp|P00868.1|RBS1_PEA  RecName: Full=Ribulose bisphosphate carboxy...    191   2e-58   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...    192   2e-58   
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...    192   2e-58   
emb|CAA30290.1|  rubisco ssu precursor                                  192   3e-58   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                       191   3e-58   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...    191   3e-58   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit     191   3e-58   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...    191   3e-58   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    191   4e-58   
ref|XP_007151771.1|  hypothetical protein PHAVU_004G073400g             189   4e-58   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit     191   4e-58   
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...    191   5e-58   
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    191   6e-58   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    191   7e-58   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain           191   7e-58   
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    190   7e-58   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...    190   7e-58   
emb|CDY12616.1|  BnaA02g12840D                                          191   7e-58   
ref|XP_011015710.1|  PREDICTED: ribulose bisphosphate carboxylase...    190   9e-58   
emb|CAA63441.1|  Rubisco                                                188   1e-57   
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    190   1e-57   
gb|ABY66909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    190   1e-57   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...    190   1e-57   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...    190   1e-57   
ref|NP_001105294.1|  ribulose bisphosphate carboxylase small chai...    190   1e-57   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit     189   1e-57   
gb|EMS47672.1|  Ribulose bisphosphate carboxylase small chain PWS...    190   2e-57   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...    189   2e-57   
prf||0709274A  carboxylase S,RBP                                        187   2e-57
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    189   2e-57   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...    189   3e-57   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    188   3e-57   
gb|AIB55758.1|  ribulose bisphosphate carboxylase small chain, pa...    187   3e-57   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    189   4e-57   
gb|EMS44968.1|  Ribulose bisphosphate carboxylase small chain PW9...    188   4e-57   
gb|EMS44967.1|  Ribulose bisphosphate carboxylase small chain PW9...    187   5e-57   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    189   5e-57   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    189   5e-57   
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg                189   5e-57   
emb|CDY42338.1|  BnaC02g17150D                                          189   5e-57   
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg                189   6e-57   
gb|EMT21847.1|  Ribulose bisphosphate carboxylase small chain PW9...    187   6e-57   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...    188   6e-57   
gb|ABK96590.1|  unknown                                                 188   1e-56   
sp|P10053.1|RBS_PINTH  RecName: Full=Ribulose bisphosphate carbox...    187   1e-56   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit     187   1e-56   
ref|NP_001146043.1|  ribulose bisphosphate carboxylase small subu...    186   2e-56   
gb|AAA33716.1|  ribulose 1,5-bisphosphate carboxylase                   184   3e-56   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg                187   3e-56   
emb|CDY42337.1|  BnaC02g17140D                                          187   3e-56   
gb|AIF75302.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    186   4e-56   
gb|AIF75301.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    185   5e-56   
gb|AIF75300.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    185   5e-56   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    186   5e-56   
gb|AIR75143.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    184   5e-56   
sp|P16031.1|RBS_LARLA  RecName: Full=Ribulose bisphosphate carbox...    186   5e-56   
emb|CAA68419.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        185   8e-56   
gb|KEH21537.1|  ribulose bisphosphate carboxylase small chain           185   1e-55   
gb|AEX60835.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    184   3e-55   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...    184   3e-55   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...    184   3e-55   
gb|ABK25403.1|  unknown                                                 184   3e-55   
gb|ABK26083.1|  unknown                                                 183   4e-55   
gb|ACN40080.1|  unknown                                                 184   4e-55   
gb|ABK21347.1|  unknown                                                 184   4e-55   
gb|ACN39774.1|  unknown                                                 182   4e-55   
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...    183   4e-55   
gb|ABQ42090.1|  ribulose bisphosphate carboxylase small chain (Ru...    184   4e-55   
gb|ABK21690.1|  unknown                                                 184   5e-55   
gb|ACN40169.1|  unknown                                                 184   6e-55   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090          183   7e-55   
gb|AIR75144.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    182   7e-55   
gb|AFS41756.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    183   8e-55   



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP+G KK+ETLSYLP L+ EQLLK++EYLLNKGWVPCLEFETE GFVYRE+HAS
Sbjct  56   QCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHAS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   228 bits (580),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP+G KK+ETLSYLP L+ EQLLK++EYLLNKGWVPCLEFETE GFVYRE+HAS
Sbjct  56   QCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHAS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score =   224 bits (571),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPL+TEQLLK+VEYLL KGWVPCLEFETEKGFVYRE H S
Sbjct  57   QCMQVWPPIGKKKFETLSYLPPLTTEQLLKEVEYLLRKGWVPCLEFETEKGFVYRENHKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+DATQV+ EL+E  KAYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPMFGCSDATQVLKELDEAVKAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KP  366
            +P
Sbjct  177  RP  178



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score =   224 bits (571),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL+  QL K+++YLL  GWVPCLEFETEKGFVYRE H S
Sbjct  57   QCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWVPCLEFETEKGFVYREHHHS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+VRI+GFDNKRQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAF  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   224 bits (571),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL+  QL K+++YLL  GWVPCLEFETEKGFVYRE H S
Sbjct  57   QCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWVPCLEFETEKGFVYREHHHS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+VRI+GFDNKRQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAF  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score =   223 bits (568),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE H S
Sbjct  56   QCMQVWPPINKKKYETLSYLPDLSQEQLLSEIEYLLKSGWVPCLEFETERGFVYREHHHS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AWVRI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   223 bits (567),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE H S
Sbjct  57   RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE H S
Sbjct  57   RCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++ECKK+YP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score =   222 bits (565),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPL+TEQLLK+VEYLL KGWVPCLEFETEKGFVYRE H S
Sbjct  58   QCMQVWPPIGKKKFETLSYLPPLTTEQLLKEVEYLLRKGWVPCLEFETEKGFVYRENHKS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+DA QV+ EL+E  +AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  118  PGYYDGRYWTMWKLPMFGCSDAAQVLKELDEAVRAYPNAFVRIIGFDNVRQVQCISFIAH  177

Query  361  KP  366
            +P
Sbjct  178  RP  179



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   221 bits (564),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP   KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE H S
Sbjct  57   RCMQVWPPINTKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++ECKK+YP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWVPCLEFETEKGFVYRE H S
Sbjct  53   NCMQVWPPIGKKKFETLSYLPPLTVEQLAKEVEYLIRKGWVPCLEFETEKGFVYRENHKS  112

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFG TDA+QV+ ELEE KKAYP A++RI+GFDNKRQVQCI FIA+
Sbjct  113  PGYYDGRYWTMWKLPMFGTTDASQVLKELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAH  172

Query  361  KPD  369
            +P+
Sbjct  173  RPE  175



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE H S
Sbjct  57   RCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD TQV+AE++ECKK+YP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDTTQVLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  56   RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  56   RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS+E L K+V+YLL K WVPCLEFE E GFVYRE H S
Sbjct  59   QCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHKS  118

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  119  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAY  178

Query  361  KP  366
            KP
Sbjct  179  KP  180



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  56   RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   220 bits (560),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE GFVYRE H S
Sbjct  56   SCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE GFVYRE H S
Sbjct  56   SCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + S
Sbjct  55   QCMQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNNS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+VRI+GFDNKRQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAY  174

Query  361  KPDD  372
            KP D
Sbjct  175  KPKD  178



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  57   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  57   RCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++ECK AYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score =   219 bits (559),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP+G KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE + S
Sbjct  56   QCMQVWPPYGKKKYETLSYLPDLSEEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score =   219 bits (559),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  57   RCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++ECK AYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score =   219 bits (558),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  57   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score =   219 bits (558),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLSTE L K+V+YLL K WVPCLEFE E GFVYRE H S
Sbjct  59   QCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRS  118

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAY
Sbjct  119  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAY  178

Query  361  KP  366
            KP
Sbjct  179  KP  180



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score =   219 bits (558),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  56   QCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score =   219 bits (558),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + S
Sbjct  56   QCMQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+VRI+GFDNKRQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAY  175

Query  361  KPD  369
            KP 
Sbjct  176  KPS  178



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   219 bits (558),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + S
Sbjct  56   QCMQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+VRI+GFDNKRQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score =   219 bits (557),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLSTE L K+V+YLL K WVPCLEFE E GFVYRE H S
Sbjct  55   QCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   219 bits (558),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS E L K+V+YLL K WVPCLEFE E GFVYRE H S
Sbjct  59   QCMQVWPPLGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPCLEFELETGFVYRENHKS  118

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  119  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAY  178

Query  361  KP  366
            KP
Sbjct  179  KP  180



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H S
Sbjct  56   QCMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE ++S
Sbjct  57   RCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score =   219 bits (557),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L K+V+YLL  GWVPCLEFE E GFVYRE H+S
Sbjct  55   QCMQVWPPIGKKKFETLSYLPPLSPESLAKEVDYLLRSGWVPCLEFELEHGFVYREHHSS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ ELEE KKAYP A++RI+GFDNKRQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDSAQVLKELEEAKKAYPTAFIRIIGFDNKRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score =   219 bits (557),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H S
Sbjct  56   QCMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H S
Sbjct  56   QCMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP  +KK+ETLSYLP LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  56   SCMQVWPPINMKKYETLSYLPDLSDEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  56   QCMQVWPPINKKKYETLSYLPDLSQEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA QV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDAAQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE ++S
Sbjct  57   RCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYREHNSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD TQV+AE++E K AYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDGTQVLAEVQEAKNAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + S
Sbjct  57   QCMQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEIKDGFVYREHNKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+VRI+GFDNKRQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE GFVYRE + S
Sbjct  56   SCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>gb|AEJ33935.1| chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Wolffia australiana]
Length=177

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP GLKKFETLSYLPPLSTE L K+VEYL+  GW+PC+EF  E GFVYRE+HAS
Sbjct  56   RCMQVWPPEGLKKFETLSYLPPLSTEALAKEVEYLIRNGWIPCIEFSKE-GFVYREYHAS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKRQVQC+ FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPDYFVRIIGFDNKRQVQCVSFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS+E L K+V+YLL K WVPCLEFE E GFVYRE H S
Sbjct  59   QCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRS  118

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAY
Sbjct  119  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAY  178

Query  361  KP  366
            KP
Sbjct  179  KP  180



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS+E L K+V+YLL K WVPCLEFE E GFVYRE H S
Sbjct  59   QCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRS  118

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAY
Sbjct  119  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAY  178

Query  361  KP  366
            KP
Sbjct  179  KP  180



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CM VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H S
Sbjct  56   ECMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL+  QL K+++YLL  GWVPCLEFETE GFVYRE H S
Sbjct  57   QCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWVPCLEFETE-GFVYREHHHS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+VRI+GFDNKRQVQCI FIA+
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAF  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   218 bits (554),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP   KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE G VYRE H S
Sbjct  57   RCMQVWPPINTKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGIVYREKHKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYW MWKLPMFGCTDATQV+AE++ECKK+YP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWNMWKLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L K+V+YLL  GW+PCLEFE E GFVYRE + S
Sbjct  58   QCMQVWPPLGKKKFETLSYLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A++RI+GFDNKRQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP  S EQLL ++EYLL  GWVPCLEFETE+GFVYRE ++S
Sbjct  57   RCMQVWPPINMKKYETLSYLPDFSDEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score =   217 bits (553),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  57   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score =   217 bits (553),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP  +KK+ETLSYLP LS+EQLL ++EYLL  GWVPCLEFETE GFVYRE  +S
Sbjct  56   RCMQVWPPINMKKYETLSYLPDLSSEQLLSEIEYLLKNGWVPCLEFETEHGFVYREHTSS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV AE++E KKAYP A +RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDATQVAAEVQEAKKAYPDAHIRIIGFDNVRQVQCISFIAY  175

Query  361  KPD  369
            KP+
Sbjct  176  KPE  178



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score =   217 bits (552),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWVPCLEFETEKGFVYRE   S
Sbjct  53   NCMQVWPPIGKKKFETLSYLPPLTVEQLAKEVEYLIRKGWVPCLEFETEKGFVYRENLKS  112

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFG TDA+QV+ ELEE KKAYP A++RI+GFDNKRQVQCI FIA+
Sbjct  113  PGYYDGRYWTMWKLPMFGTTDASQVLKELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAH  172

Query  361  KPD  369
            +P+
Sbjct  173  RPE  175



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score =   216 bits (551),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLSTE L K+V+YLL K WVPCLEFE E GFVYRE + S
Sbjct  55   QCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENNRS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score =   216 bits (551),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS+EQL K+V+YLL K  +PCLEFE E GFVYRE + S
Sbjct  58   QCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLIPCLEFELEHGFVYREHNRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC D++QV+ ELEECKKAYP A++RI+GFDNKRQVQ I FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   216 bits (550),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++V+YLL  GWVPCLEFETE GFVYRE + S
Sbjct  57   QCMQVWPPINKKKYETLSYLPDLSQEQLLREVDYLLKNGWVPCLEFETEHGFVYRENNKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   216 bits (550),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++V+YLL  GWVPCLEFETE GFVYRE + S
Sbjct  57   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVDYLLKNGWVPCLEFETEHGFVYRENNKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  176

Query  361  KPD  369
            KP+
Sbjct  177  KPE  179



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E LLK+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  60   QCMQVWPPLGKKKFETLSYLPPLSEESLLKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  119

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++RI+GFDN RQVQC+ FIAY
Sbjct  120  PGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAY  179

Query  361  KP  366
            KP
Sbjct  180  KP  181



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L K+V+YLL  GW+PCLEFE E GFVYRE + S
Sbjct  60   QCMQVWPPTGKKKFETLSYLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRS  119

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A++RI+GFDNKRQVQCI FIAY
Sbjct  120  PGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAY  179

Query  361  KP  366
            KP
Sbjct  180  KP  181



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL++E L K+V++LL   WVPCLEFE EKGFVYRE H S
Sbjct  58   QCMQVWPPVGLKKFETLSYLPPLTSESLAKEVDFLLRNKWVPCLEFELEKGFVYRENHKS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDASQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM VWPP G KKFETLSYLPPLS E L K+VEYLL KGWVPCLEFE E GFVYRE + S
Sbjct  48   QCMLVWPPLGRKKFETLSYLPPLSIESLTKEVEYLLRKGWVPCLEFELEHGFVYRENNRS  107

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+DA+QV+ ELEECKK YP A+VRI+GFDNKRQVQCI FIAY
Sbjct  108  PGYYDGRYWTMWKLPMFGCSDASQVMKELEECKKEYPTAFVRIIGFDNKRQVQCISFIAY  167

Query  361  KP  366
            KP
Sbjct  168  KP  169



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS E L K+VEYLL   WVPCLEFE E GFVYRE   S
Sbjct  56   QCMQVWPPVGLKKFETLSYLPPLSVESLAKEVEYLLRNKWVPCLEFELEHGFVYREHGNS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AELEE KK YP A++RI+GFDN RQVQC+ FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDASQVIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G+KKFETLSYLPPLS E LLK+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  57   QCMQVWPPLGMKKFETLSYLPPLSEESLLKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++RI+GFDN RQVQC+ FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPL+TE LL +V+YLLNKGW+PCLEFE + GFVYRE + S
Sbjct  59   QCMQVWPPLGKKKFETLSYLPPLTTEALLGEVQYLLNKGWIPCLEFEVKDGFVYREHNNS  118

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QVV ELEE KKAYP A+VRI+GFD  RQVQCI FIAY
Sbjct  119  PGYYDGRYWTMWKLPMFGCTDPAQVVNELEEVKKAYPQAFVRIIGFDKNRQVQCISFIAY  178

Query  361  KPD  369
            KP+
Sbjct  179  KPE  181



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KKFETLSYLPPLS E L K+V+YLL  GW+PCLEFE E GFVYRE + S
Sbjct  58   QCMQVWPPIAKKKFETLSYLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A++RI+GFDNKRQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  56   QCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   214 bits (546),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  54   QCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>gb|AIR75141.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G+KK+ETLSYLPPL+TE LL +V+YLLNKGW+PCLEFETE GFVYRE   +
Sbjct  48   QCMQVWPPIGMKKYETLSYLPPLTTESLLAEVQYLLNKGWIPCLEFETEHGFVYREHGNT  107

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  354
            PGYYDGRYWTMWKLPMFGCTD  QVV EL+ECKKAYP A++RI+GFDNKRQVQCI FI
Sbjct  108  PGYYDGRYWTMWKLPMFGCTDPAQVVNELDECKKAYPNAFIRIIGFDNKRQVQCISFI  165



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score =   214 bits (545),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKKFETLSYLP L+ EQL K+V+YLL  GWVPCLEFE E GFVYRE H S
Sbjct  57   QCMKVWPPLGLKKFETLSYLPQLTQEQLSKEVDYLLRSGWVPCLEFELEHGFVYREHHHS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A++RI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPNAYIRIIGFDNVRQVQCISFIAF  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score =   214 bits (545),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+ EQL K+V+YLL KGW+PCLEFE E GFVYRE H S
Sbjct  55   QCMQVWPPLGKKKFETLSYLPDLTDEQLAKEVDYLLRKGWIPCLEFELEHGFVYRENHRS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+D+TQV+ EL+E KKAYP +++RI+GFDN+RQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCSDSTQVLKELDEAKKAYPNSFIRIIGFDNRRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   214 bits (544),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  54   QCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+ RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFTRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|WP_026003795.1| hypothetical protein, partial [Pseudomonas luteola]
Length=120

 Score =   211 bits (538),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            MQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE GFVYRE H SPG
Sbjct  1    MQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAYKP
Sbjct  61   YYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKP  120



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  57   QCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  57   QCMQVWPPLGKKKFETLSYLPPLSEESLIKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  56   QCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAEL E KKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDPSQVVAELREAKKAYPEAFIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E+LLK++EYLL   WVPCLEFE EKGFVYR+ H S
Sbjct  57   QCMQVWPPIGKKKFETLSYLPPLSREELLKEIEYLLRMNWVPCLEFELEKGFVYRDNHKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QV+ EL+E  K YP A+VRI+GFDNKRQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDPLQVLKELDEAIKTYPNAFVRIIGFDNKRQVQCISFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL  GW+PCLEFE E GFVYRE H S
Sbjct  56   QCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSGWIPCLEFELEHGFVYREHHHS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A++RI+GFDN+RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPDAFIRIIGFDNRRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>sp|Q9XGX5.1|RBS2_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37439.1|AF150666_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=184

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS  QLL QV+YLLNKGW+PC+EFE E  FVYRE H S
Sbjct  59   QCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNKGWIPCIEFELEHPFVYRENHRS  118

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGY DGRYWTMWKLPM+GCTD  QV+ E+EE KKAYP A++RI+GFDNKRQVQC+ FIAY
Sbjct  119  PGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPTAFIRIIGFDNKRQVQCVSFIAY  178

Query  361  KPDDK  375
            KP D 
Sbjct  179  KPADS  183



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score =   212 bits (540),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP  GLKKFETLSYLPPLS E L K+V+YLL K WVPCLEFE EKGFVYRE H S
Sbjct  59   QCMKVWPTVGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPCLEFELEKGFVYRENHRS  118

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKA P +++RI+GFDN RQVQCI FIAY
Sbjct  119  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSFIRIIGFDNVRQVQCISFIAY  178

Query  361  KP  366
            KP
Sbjct  179  KP  180



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   212 bits (539),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS E+LLK++EYLL   WVPCLEFE EKGFVYR+ H S
Sbjct  57   QCMQVWPPIGKKKFETLSYLPPLSREELLKEIEYLLRMNWVPCLEFELEKGFVYRDNHKS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QV  EL+E  K YP A+VRI+GFDNKRQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDPLQVFKELDEAIKTYPNAFVRIIGFDNKRQVQCISFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score =   212 bits (539),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKKFETLSYLP +S EQL K+V+YLL KGW+PC+EF+   GFVYRE H S
Sbjct  57   QCMKVWPPLGLKKFETLSYLPDMSNEQLGKEVDYLLRKGWIPCIEFDIHSGFVYRENHRS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QVV E+EE KK YP A++R++GFDN RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDSSQVVNEIEEAKKEYPDAYIRVIGFDNVRQVQCISFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score =   211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GL+KFETLSYLPPLS E L KQ+EYL+ KGW+PCLEFE E  FVYRE + S
Sbjct  58   QCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYW MWKLPMFGCTDATQV+AEL+E  K YP + +RI+GFDNKRQVQCI FIAY
Sbjct  118  PGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAY  177

Query  361  KPDDK  375
            KP  K
Sbjct  178  KPPAK  182



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE HAS
Sbjct  56   SCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHAS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score =   211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP  GLKKFETLSYLPPLS E L K+V+YLL K WVPCLEFE EKGFVYRE H S
Sbjct  58   QCMKVWPTVGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPCLEFELEKGFVYRENHRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKA P +++RI+GFDN RQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSFIRIIGFDNVRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score =   211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPLS E L K+V+YLL  GWVPCLEFE E GFVYRE H S
Sbjct  56   HCMQVWPPVGKKKFETLSYLPPLSEESLAKEVDYLLRMGWVPCLEFELEHGFVYRENHRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGR WTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDNKRQVQCI FIAY
Sbjct  116  PGYYDGRCWTMWKLPMFGCTDSSQVLKELEEAKKAYPNSFIRIIGFDNKRQVQCISFIAY  175

Query  361  KPD  369
            KP 
Sbjct  176  KPS  178



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE HAS
Sbjct  56   SCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHAS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score =   211 bits (538),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKK+ETLSYLP L+ EQLLK+++YL+  GWVPCLEFE EKGFVYRE+H S
Sbjct  57   QCMQVWPPRGLKKYETLSYLPDLTDEQLLKEIDYLIRSGWVPCLEFELEKGFVYREYHRS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPM+GCTDATQV+ E+ EC K YP  WVRI+GFDN RQVQCI FIA 
Sbjct  117  PGYYDGRYWTMWKLPMYGCTDATQVLNEVGECLKEYPNCWVRIIGFDNVRQVQCISFIAA  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score =   211 bits (538),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLP L+TEQL +++EYLL   WVPCLEFE EKG+VYRE H S
Sbjct  57   QCMQVWPPTGLKKFETLSYLPDLTTEQLAREIEYLLRNKWVPCLEFELEKGWVYREHHQS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP ++VRI+GFDN RQVQCI FIA 
Sbjct  117  PGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSFVRIIGFDNTRQVQCISFIAS  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   211 bits (537),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE HAS
Sbjct  56   SCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHAS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>gb|AIR75142.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Chenopodium album]
Length=164

 Score =   211 bits (536),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPL+TE LL +V+YLLNKGWVPCLEFE E GFVYRE H S
Sbjct  47   QCMQVWPPVGKKKFETLSYLPPLTTESLLSEVQYLLNKGWVPCLEFELEHGFVYRENHRS  106

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  354
            PGYYDGRYWTMWKLPMFGCTD TQVV ELEE KKAYP A++RI+GFD+ RQVQCI FI
Sbjct  107  PGYYDGRYWTMWKLPMFGCTDPTQVVNELEEAKKAYPNAFIRIIGFDSFRQVQCISFI  164



>gb|AIR75140.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   210 bits (535),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQ WPP G+KK+ETLSYLPPL+TE LL +V+YLLNKGW+PCLEFETE GFVYRE   +
Sbjct  48   QCMQAWPPIGMKKYETLSYLPPLTTESLLAEVQYLLNKGWIPCLEFETEHGFVYREHGNT  107

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  354
            PGYYDGRYWTMWKLPMFGC D  QVV EL+ECKKAYP A++RI+GFDNKRQVQCI FI
Sbjct  108  PGYYDGRYWTMWKLPMFGCIDPAQVVNELDECKKAYPNAFIRIIGFDNKRQVQCISFI  165



>pdb|3RUB|S Chain S, Crystal Structure Of The Unactivated Form Of Ribulose-1,5-Bisphosphate 
Carboxylase(Slash)oxygenase From Tobacco 
Refined At 2.0-Angstroms Resolution
 pdb|1RLC|S Chain S, Crystal Structure Of The Unactivated Ribulose 1, 5-Bisphosphate 
Carboxylase(Slash)oxygenase Complexed With A Transition 
State Analog, 2-Carboxy-D-Arabinitol 1,5-Bisphosphate
 pdb|1RLD|S Chain S, Solid-State Phase Transition In The Crystal Structure 
Of Ribulose 1,5- Biphosphate Carboxylase(Slash)oxygenase
 pdb|1RLD|T Chain T, Solid-State Phase Transition In The Crystal Structure 
Of Ribulose 1,5- Biphosphate Carboxylase(Slash)oxygenase
 pdb|1EJ7|S Chain S, Crystal Structure Of Unactivated Tobacco Rubisco With 
Bound Phosphate Ions
Length=123

 Score =   209 bits (531),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            MQVWPP   KK+ETLSYLP LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + SPG
Sbjct  1    MQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP
Sbjct  61   YYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP  120

Query  367  D  369
            +
Sbjct  121  E  121



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS  QLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  57   QCMQVWPPINKKKYETLSYLPDLS--QLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY  174

Query  361  KPD  369
            KP+
Sbjct  175  KPE  177



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLP L+TEQL +++EYLL   WVPCLEFE EKG+VYRE H S
Sbjct  57   QCMQVWPPTGLKKFETLSYLPDLTTEQLAQEIEYLLRNKWVPCLEFELEKGWVYREHHQS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIA 
Sbjct  117  PGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSFIRIIGFDNTRQVQCISFIAS  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>ref|WP_037767734.1| hypothetical protein [Streptomyces olindensis]
 gb|KDN74154.1| hypothetical protein DF19_37695 [Streptomyces olindensis]
Length=123

 Score =   208 bits (529),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            M VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPG
Sbjct  1    MLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAYKP
Sbjct  61   YYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP  120

Query  367  D  369
            +
Sbjct  121  E  121



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GL+KFETLSYLPPLS E L KQ+EYL+ KGW+PCLEFE E  FVYRE + S
Sbjct  58   QCMKVWPPLGLQKFETLSYLPPLSLESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYW MWKLPMFGCTDATQV+AEL+E  K YP + +RI+GFDNKRQVQCI FIAY
Sbjct  118  PGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>sp|Q42516.1|RBS1_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37438.1|AF150665_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
 emb|CAA60636.1| ribulose 1,5-bisphosphate carboxylase-oxygenase [Amaranthus hypochondriacus]
Length=183

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS  QLL QV+YLLNKGW+PC+EFE E  FVYRE H S
Sbjct  58   QCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNKGWIPCIEFELEHPFVYRENHRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGY DGRYWTMWKLPM+GCTD  QV+ E+EE KKAYP A++RI+GFDNKRQVQC+ FIAY
Sbjct  118  PGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPSAFIRIIGFDNKRQVQCVSFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>emb|CAH59401.1| Rubisco SSU [Plantago major]
Length=177

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G KK+ETLSYLP L+ EQL K+++YLL   W+PCLEFE E GFVYRE + S
Sbjct  53   RCMQVWPPLGKKKYETLSYLPDLTVEQLAKEIDYLLRSKWIPCLEFELEHGFVYRENNRS  112

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AELEECKK YP AWVRI+GFDN RQVQCI FIA 
Sbjct  113  PGYYDGRYWTMWKLPMFGCTDASQVIAELEECKKEYPNAWVRIIGFDNVRQVQCISFIAA  172

Query  361  KP  366
            KP
Sbjct  173  KP  174



>gb|KEH21538.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KPD  369
             PD
Sbjct  177  TPD  179



>ref|XP_003637843.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KPD  369
             PD
Sbjct  177  TPD  179



>ref|XP_003600302.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KPD  369
             PD
Sbjct  177  TPD  179



>ref|XP_003636970.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KPD  369
             PD
Sbjct  177  TPD  179



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKK+ETLSYLPPL+  QL K+V+YLL K WVPCLEFE E GFVYRE   S
Sbjct  54   QCMKVWPPLGLKKYETLSYLPPLTETQLAKEVDYLLRKKWVPCLEFELEHGFVYRENARS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL ECKK YP AW+RI+GFDN RQVQCIMFIA 
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAWIRIIGFDNVRQVQCIMFIAS  173

Query  361  KPD  369
            +PD
Sbjct  174  RPD  176



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H S
Sbjct  56   QCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H S
Sbjct  56   QCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKKFETLSYLPPL+ E+L K+V+YLL  GWVPCLEFE E G+VYRE H S
Sbjct  57   QCMKVWPPLGLKKFETLSYLPPLTNEELAKEVDYLLRSGWVPCLEFELEHGWVYRENHRS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A++RI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDSSQVLNEVEECKKEYPNAFIRIIGFDNVRQVQCISFIAF  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>emb|CAA10290.1| ribulose 1,5-bisphosphate carboxylase small subunit [Cicer arietinum]
Length=181

 Score =   209 bits (533),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQLLK+VEYLL KGWVPCLEFE EKGFVYRE + S
Sbjct  57   HCMQVWPPIGKKKFETLSYLPPLTEEQLLKEVEYLLRKGWVPCLEFELEKGFVYREHNNS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCT+A QV+ EL+E  KAYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGCTEAVQVLKELQEVVKAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KPDD  372
             P +
Sbjct  177  TPKE  180



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL+K+VEYL+ KGWVPCLEFE EKGFVYRE H+S
Sbjct  56   NCMQVWPPIGKKKFETLSYLPPLTEEQLVKEVEYLIRKGWVPCLEFELEKGFVYRENHSS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP +++RI+GFDN RQVQCI FIA+
Sbjct  116  PGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESFIRIIGFDNVRQVQCISFIAH  175

Query  361  KP  366
             P
Sbjct  176  TP  177



>sp|P19310.1|RBS4_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40B, 
chloroplastic; Short=RuBisCO small subunit SSU40B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35103.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   209 bits (532),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE HAS
Sbjct  56   SCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHAS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>sp|P19309.1|RBS3_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40A, 
chloroplastic; Short=RuBisCO small subunit SSU40A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35102.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE HAS
Sbjct  56   SCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHAS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>sp|P07689.1|RBS3_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3A, 
chloroplastic; Short=RuBisCO small subunit 3A; Flags: Precursor 
[Pisum sativum]
 emb|CAA27864.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236A carboxylase,ribulose bisphosphate
Length=180

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL KGWVPCLEFE EKGFVYRE + S
Sbjct  56   KCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPCLEFELEKGFVYREHNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  116  PGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAH  175

Query  361  KPDD  372
             P+ 
Sbjct  176  TPES  179



>sp|Q9XGX4.1|RBS3_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37440.1|AF150667_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=180

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLPPLS  QLL QV+YLLN GW+PC+EFE E  FVYRE H S
Sbjct  56   QCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNNGWIPCIEFELEHPFVYRENHRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGY DGRYWTMWKLPM+GCTD  QV+ E+EE KKAYP A++RI+GFDNKRQVQC+ FIA+
Sbjct  116  PGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPSAFIRIIGFDNKRQVQCVSFIAF  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>sp|P00869.1|RBS2_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3C, 
chloroplastic; Short=RuBisCO small subunit 3C; AltName: Full=PSS15; 
Flags: Precursor [Pisum sativum]
 emb|CAA27865.1| ribulose 1.5-bisphosphate carboxylase (RBC) [Pisum sativum]
 emb|CAA25390.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236B carboxylase,ribulose bisphosphate
Length=180

 Score =   209 bits (531),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL KGWVPCLEFE EKGFVYRE + S
Sbjct  56   KCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPCLEFELEKGFVYREHNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  116  PGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAH  175

Query  361  KPDD  372
             P+ 
Sbjct  176  TPES  179



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score =   209 bits (531),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+ EQL K+VEYLL KGWVPCLEFE E GFVYRE   S
Sbjct  58   QCMQVWPPLGKKKFETLSYLPDLTREQLAKEVEYLLRKGWVPCLEFELEHGFVYRENARS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+DA QV+ EL+E  KAYP ++VRI+GFDN RQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCSDAVQVLKELDEAIKAYPNSFVRIIGFDNVRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score =   208 bits (530),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWVPCLEFE EKGFVYRE H+S
Sbjct  56   NCMQVWPPIGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWVPCLEFELEKGFVYRENHSS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP +++RI+GFDN RQVQCI FIA+
Sbjct  116  PGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESFIRIIGFDNVRQVQCISFIAH  175

Query  361  KP  366
             P
Sbjct  176  TP  177



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score =   209 bits (531),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM VWPP G+KKFETLSYLPPLS E LLK+V+YLLN GWVPCLEFE   GFVYRE   +
Sbjct  57   QCM-VWPPLGMKKFETLSYLPPLSEESLLKEVQYLLNNGWVPCLEFEPTHGFVYREHGNT  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++RI+GFDN RQVQC+ FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>sp|Q42823.1|RBS_GLYTA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tabacina]
 gb|AAA82071.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tabacina]
Length=178

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWP  G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE H S
Sbjct  54   QCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHHRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP A++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNAFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLP L+TEQL K+++YLL   WVPCLEFE EKG+VYRE H S
Sbjct  57   QCMQVWPPTGLKKFETLSYLPDLTTEQLAKEIDYLLRMKWVPCLEFELEKGWVYREHHRS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCT A+QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIA 
Sbjct  117  PGYYDGRYWTMWKLPMFGCTQASQVLIELEEAKKAYPNSFIRIIGFDNVRQVQCISFIAS  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>ref|XP_006482254.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=182

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKKFETLSYLPPLS E LLK++ YLL  GW+PCLEFE EKG+VYRE H+S
Sbjct  58   QCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPM+GCTDATQV+ E+ E +K YP ++VRI+GFDNKRQVQCI F+A 
Sbjct  118  PGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAA  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>gb|ACJ85905.1| unknown [Medicago truncatula]
 gb|AFK33847.1| unknown [Medicago truncatula]
 gb|KEH21532.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KPD  369
             P+
Sbjct  177  TPE  179



>gb|KEH21536.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KPD  369
             P+
Sbjct  177  TPE  179



>gb|KEH21531.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KPD  369
             P+
Sbjct  177  TPE  179



>sp|P00872.2|RBS1_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU1, 
chloroplastic; Short=RuBisCO small subunit SSU1; Flags: 
Precursor [Lemna gibba]
 emb|CAA35104.1| unnamed protein product [Lemna gibba]
Length=173

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE +AS
Sbjct  52   SCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENNAS  110

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAY
Sbjct  111  PGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAY  170

Query  361  KP  366
            KP
Sbjct  171  KP  172



>pdb|4RUB|S Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|T Chain T, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|U Chain U, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|V Chain V, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
Length=123

 Score =   206 bits (523),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            MQVWPP   KK+ETLSYLP LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + SPG
Sbjct  1    MQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW+RI+GFDN RQVQCI FIAYKP
Sbjct  61   YYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP  120

Query  367  D  369
            +
Sbjct  121  E  121



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKK+ETLSYLPPL+  QL K+VEYLL   WVPCLEFE E GF YRE + S
Sbjct  55   QCMKVWPPLGLKKYETLSYLPPLTETQLAKEVEYLLRNKWVPCLEFELEHGFPYRENNRS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC DA+QV+ EL ECKK YP +WVRI+GFDN RQVQCI FIA+
Sbjct  115  PGYYDGRYWTMWKLPMFGCNDASQVLKELNECKKEYPQSWVRIIGFDNVRQVQCISFIAH  174

Query  361  KPD  369
            KPD
Sbjct  175  KPD  177



>gb|KEH21530.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAH  176

Query  361  KP  366
             P
Sbjct  177  TP  178



>ref|XP_006430779.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
 gb|ESR44019.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
Length=182

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKKFETLSYLPPLS E LLK++ YL+  GW+PCLEFE EKG+VYRE H S
Sbjct  58   QCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLIRSGWIPCLEFELEKGWVYREHHRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPM+GCTDATQV+ E+ E +K YP ++VRI+GFDNKRQVQCI FIA 
Sbjct  118  PGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAA  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>gb|KEH21539.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+S
Sbjct  57   NCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+GFD  RQVQCI FIA+
Sbjct  117  PGYYDGRYWTMWKLPLFGATDASQVLKELDEVVDAYPNAFVRIIGFDKVRQVQCISFIAH  176

Query  361  KPD  369
             PD
Sbjct  177  TPD  179



>ref|NP_001235314.1| uncharacterized protein LOC100500504 [Glycine max]
 gb|ACU15604.1| unknown [Glycine max]
 gb|KHN47663.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE + S
Sbjct  54   QCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLP L+ E+L K+++YLL   WVPCLEFE EKG+VYRE H+S
Sbjct  58   QCMQVWPPTGLKKFETLSYLPDLTEEELAKEIDYLLRSKWVPCLEFELEKGWVYREHHSS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIA 
Sbjct  118  PGYYDGRYWTMWKLPMFGCTEASQVLLELEEAKKAYPNAFIRIIGFDNTRQVQCISFIAA  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>gb|AAG24884.1|AF303941_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS3 [Glycine 
max]
Length=178

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE + S
Sbjct  54   QCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLP L+ E+L K+++YLL   WVPCLEFE EKG+VYRE H+S
Sbjct  58   QCMQVWPPTGLKKFETLSYLPDLTEEELAKEIDYLLRSKWVPCLEFELEKGWVYREHHSS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIA 
Sbjct  118  PGYYDGRYWTMWKLPMFGCTEASQVLLELEEAKKAYPNAFIRIIGFDNTRQVQCISFIAA  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|NP_001241137.1| ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Glycine max]
 gb|AAG24882.1|AF303939_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS1 [Glycine 
max]
 gb|AAA81328.1| ribulose-1,5-bisphosphate carboxylase small subunit [Glycine 
max]
 gb|KHN07517.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
 gb|KHN07519.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   207 bits (526),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE + S
Sbjct  54   QCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|NP_001235266.1| ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
 gb|AAG24883.1|AF303940_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
Length=178

 Score =   207 bits (526),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE + S
Sbjct  54   QCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|XP_003618735.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|AES74953.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=177

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ +QL K+VEYL+ KGWVPCLEFE EKGFVYRE H+S
Sbjct  53   NCMQVWPPIGKKKFETLSYLPPLTEDQLAKEVEYLIRKGWVPCLEFELEKGFVYRENHSS  112

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP +++RI+GFDN RQVQCI FIA+
Sbjct  113  PGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESFIRIIGFDNVRQVQCISFIAH  172

Query  361  KP  366
             P
Sbjct  173  TP  174



>emb|CAD21856.1| putative ribulose 1,5 biphosphate carboxylase small subunit percursor 
[Rumex obtusifolius]
Length=181

 Score =   206 bits (525),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G  KFETLSYLPPLS   LL Q+ YLL  GWVPCLEF+   G VYRE H S
Sbjct  53   RCMQVWPPEGKIKFETLSYLPPLSEADLLAQINYLLINGWVPCLEFDVGPGAVYREHHHS  112

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQVVAELEE KKAYP A+VRI+GFDN RQVQC+ FIAY
Sbjct  113  PGYYDGRYWTMWKLPMFGCTDATQVVAELEEAKKAYPHAFVRIIGFDNVRQVQCVSFIAY  172

Query  361  KP  366
            KP
Sbjct  173  KP  174



>emb|CAH59404.1| Rubisco SSU [Plantago major]
Length=174

 Score =   206 bits (524),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G KK+ETLSYLP L+ EQL K+++YLL   W+PCLEFE E GFVYRE   S
Sbjct  50   RCMQVWPPTGKKKYETLSYLPDLTVEQLAKEIDYLLRSKWIPCLEFELEHGFVYRENARS  109

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+AELEECKK YP AWVRI+GFDN RQVQCI FIA 
Sbjct  110  PGYYDGRYWTMWKLPMFGCTDASQVIAELEECKKEYPNAWVRIIGFDNVRQVQCISFIAS  169

Query  361  KP  366
            KP
Sbjct  170  KP  171



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score =   206 bits (524),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H S
Sbjct  58   QCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++R++GFDN RQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H S
Sbjct  58   QCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++R++GFDN RQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|XP_006663954.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLS E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   KCMQVWPIEGIKKFETLSYLPPLSVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+VRI+GFDN RQVQCI FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>sp|O65194.1|RBS_MEDSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Medicago sativa]
 gb|AAC13293.1| ribulose-1,5-bisphosphate carboxylase small subunit [Medicago 
sativa]
Length=180

 Score =   206 bits (523),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGW+PCLEFE EKGFVYRE H S
Sbjct  56   NCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLEFELEKGFVYRENHRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMW+LP+FG TD++QV+ EL +CK  YP +++RI+GFDN RQVQCI FIA+
Sbjct  116  PGYYDGRYWTMWRLPLFGATDSSQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISFIAH  175

Query  361  KPDD  372
             P +
Sbjct  176  TPKN  179



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP  LKKFETLSYLP LS E LLK++ YLL KGWVPCLEFE     VYRE + S
Sbjct  55   NCMQVWPPRNLKKFETLSYLPTLSEESLLKEINYLLIKGWVPCLEFEVGPAHVYRENNKS  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV AE+ ECK AYP A VRI+GFDNKRQVQCI FIAY
Sbjct  115  PGYYDGRYWTMWKLPMFGCTDASQVAAEVVECKNAYPDAHVRIIGFDNKRQVQCISFIAY  174

Query  361  KPD  369
            KP+
Sbjct  175  KPE  177



>pdb|1AUS|S Chain S, Activated Unliganded Spinach Rubisco
 pdb|8RUC|I Chain I, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|J Chain J, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|K Chain K, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|L Chain L, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|1RBO|S Chain S, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|C Chain C, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|F Chain F, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|I Chain I, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RCO|S Chain S, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|C Chain C, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|F Chain F, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|I Chain I, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|M Chain M, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|P Chain P, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1AA1|S Chain S, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|C Chain C, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|F Chain F, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|I Chain I, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1RCX|S Chain S, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|C Chain C, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|F Chain F, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|I Chain I, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|M Chain M, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|P Chain P, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|T Chain T, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|W Chain W, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RXO|S Chain S, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|C Chain C, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|F Chain F, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|I Chain I, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RCO|T Chain T, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|W Chain W, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1UPM|C Chain C, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|F Chain F, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|I Chain I, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|M Chain M, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|P Chain P, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|S Chain S, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|T Chain T, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|W Chain W, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPP|I Chain I, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|J Chain J, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|K Chain K, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|L Chain L, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1AUS|T Chain T, Activated Unliganded Spinach Rubisco
 pdb|1AUS|U Chain U, Activated Unliganded Spinach Rubisco
 pdb|1AUS|V Chain V, Activated Unliganded Spinach Rubisco
Length=123

 Score =   203 bits (517),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            MQVWP   LKK+ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPG
Sbjct  1    MQVWPILNLKKYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ R+VQCI FIAYKP
Sbjct  61   YYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNREVQCISFIAYKP  120



>ref|XP_006663961.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=182

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLS E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   KCMQVWPIEGIKKFETLSYLPPLSVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+VRI+GFDN RQVQCI FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H S
Sbjct  58   QCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PG+YDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++R++GFDN RQVQCI FIAY
Sbjct  118  PGFYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>gb|AGV08375.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Arachis hypogaea]
Length=182

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+ EQL K+V+YLL KGWVPCLEFE   GF YRE H S
Sbjct  58   QCMQVWPPVGKKKFETLSYLPDLTDEQLRKEVDYLLRKGWVPCLEFEVGYGFPYRENHRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL+E K AYP A+VRI+GFDN RQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDSGQVIKELQEAKAAYPKAFVRIIGFDNVRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score =   205 bits (521),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G  KFETLSYLP L+ EQLLK+++YLL   W+PCLEFE  K  +YRE + S
Sbjct  58   QCMQVWPPRGKLKFETLSYLPDLTDEQLLKEIDYLLRSNWIPCLEFEVGKAHIYRENNRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP A VRI+GFDN RQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDATQVLAEVQETKKAYPDAHVRIIGFDNNRQVQCISFIAY  177

Query  361  KPDDK  375
            KP  K
Sbjct  178  KPPAK  182



>ref|XP_006664952.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLS E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   KCMQVWPIEGIKKFETLSYLPPLSVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+VRI+GFDN RQVQCI FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>ref|XP_006663955.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLS E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   KCMQVWPIEGIKKFETLSYLPPLSVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+VRI+GFDN RQVQCI FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKKFETLSYLPPL+  QL K+V+YL+  GW+PCLEF  + GFVYRE + S
Sbjct  52   QCMKVWPPLGLKKFETLSYLPPLTQAQLGKEVDYLIRLGWIPCLEFSVQGGFVYREHNKS  111

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP +++RI+GFDNKRQVQCI FI Y
Sbjct  112  PGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPQSFIRIIGFDNKRQVQCISFICY  171

Query  361  KP  366
            KP
Sbjct  172  KP  173



>ref|XP_004962611.1| PREDICTED: ribulose bisphosphate carboxylase small chain A, chloroplastic-like 
[Setaria italica]
Length=173

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G KKFETLSYLPPLST+ LLKQ++YL+ K W+PCLEF ++ GFVYRE + S
Sbjct  44   RCMQVWP-IGGKKFETLSYLPPLSTDDLLKQIDYLIRKNWIPCLEF-SKVGFVYRENNRS  101

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCT+ATQV AELEECKKAYP A++RILGFDN RQVQCIMFIAY
Sbjct  102  PGYYDGRYWTMWKLPMFGCTEATQVYAELEECKKAYPDAYIRILGFDNVRQVQCIMFIAY  161

Query  361  KP  366
            KP
Sbjct  162  KP  163



>sp|Q42822.1|RBS_GLYTO RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tomentella]
 gb|AAA82070.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tomentella]
Length=178

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWP  G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE H S
Sbjct  54   QCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYRENHRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPVFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>pdb|4MKV|S Chain S, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|T Chain T, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|U Chain U, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|V Chain V, Structure Of Pisum Sativum Rubisco With Aba
Length=123

 Score =   202 bits (515),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            MQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL KGWVPCLEFE +KGFVYRE + SPG
Sbjct  1    MQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPCLEFELKKGFVYREHNKSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFG TDA+QV+ EL+E KKAYP A+VRI+GFDN RQVQCI FIA+ P
Sbjct  61   YYDGRYWTMWKLPMFGTTDASQVLKELDEVKKAYPRAFVRIIGFDNVRQVQCISFIAHTP  120



>gb|KDP20120.1| hypothetical protein JCGZ_05889 [Jatropha curcas]
Length=181

 Score =   204 bits (520),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP  GLKKFETLSYLPPL+ EQL K+VEYLL  GWVPCLEFE E GFVYRE + S
Sbjct  57   QCMKVWPTQGLKKFETLSYLPPLTREQLAKEVEYLLRSGWVPCLEFELEHGFVYRENNRS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA QV+ EL+E  KA+P  +VRI+GFD+ RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDAVQVLNELDEAIKAHPNGFVRIIGFDSYRQVQCISFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>gb|ACU13285.1| unknown [Glycine max]
Length=178

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVW P G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE + S
Sbjct  54   QCMQVWAPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLP L+  +L K+++YLL   WVPCLEFE EKG+VYRE H S
Sbjct  57   QCMQVWPPTGLKKFETLSYLPDLTEAELAKEIDYLLRSKWVPCLEFELEKGWVYRENHRS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCT+A+QV+ EL+E KKAYP A++RI+GFDN RQVQCI FIA 
Sbjct  117  PGYYDGRYWTMWKLPMFGCTEASQVLVELQEAKKAYPNAFIRIIGFDNVRQVQCISFIAA  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>sp|P00865.1|RBS1_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Glycine max]
 emb|CAA23736.1| rubpcase [Glycine max]
Length=178

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE + S
Sbjct  54   QCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  PXYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>gb|ADB85091.1| ribulose 1,5-bisphosphate carboxylase small subunit [Jatropha 
curcas]
Length=181

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP  GLKKFETLSYLPPL+ EQL K+VEYLL  GWVPCLEFE E GFVYRE + S
Sbjct  57   QCMKVWPTQGLKKFETLSYLPPLTREQLAKEVEYLLRSGWVPCLEFELEHGFVYRENNRS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA QV+ EL+E  KA+P  +VRI+GFD+ RQVQCI FIAY
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDAVQVLNELDEAIKAHPNGFVRIIGFDSYRQVQCISFIAY  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>sp|P12468.1|RBS4_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Glycine max]
 gb|AAA34008.1| ribulose 1,5-bisphosphate carboxylase [Glycine max]
 prf||1306410A ribulose bisphosphate carboxylase S
Length=178

 Score =   204 bits (518),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE + S
Sbjct  54   QCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
             GYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  LGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>sp|P17673.1|RBS_TRIRP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Trifolium repens]
 emb|CAA36542.1| ribulose bisphosphate carboxylase [Trifolium repens]
Length=178

 Score =   204 bits (518),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLPPL+ EQLLK+VEYLL KGWVPC+EFE EKGFV+R++++S
Sbjct  54   NCMQVWPPVGKKKFETLSYLPPLTDEQLLKEVEYLLRKGWVPCVEFELEKGFVHRQYNSS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMW+LP+FG TDA QV+ E+ ECK  YP A++RI+GFDN RQVQCI FIA 
Sbjct  114  PGYYDGRYWTMWRLPLFGTTDAAQVLKEVAECKAEYPEAFIRIIGFDNVRQVQCISFIAS  173

Query  361  KP  366
             P
Sbjct  174  TP  175



>gb|ABK96431.1| unknown [Populus trichocarpa x Populus deltoides]
Length=182

 Score =   204 bits (518),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLP L+ E+L K+++YLL   WVPCLEFE EKG+V+RE H+S
Sbjct  58   QCMQVWPPTGLKKFETLSYLPDLTEEELAKEIDYLLRSKWVPCLEFELEKGWVHREHHSS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCT+A+QV+ EL E KKAYP A++RI+GFDN RQVQCI FIA 
Sbjct  118  PGYYDGRYWTMWKLPMFGCTEASQVLVELGEAKKAYPNAFIRIIGFDNTRQVQCISFIAA  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|WP_039311749.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91125.1| hypothetical protein QW71_36450 [Paenibacillus sp. IHB B 3415]
Length=123

 Score =   201 bits (512),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            M+VWPP   KK+ETLSYLPPLS  QL K+V+YL+ KGW+PCLEFETE GFVYRE H SPG
Sbjct  1    MKVWPPINKKKYETLSYLPPLSKPQLGKEVDYLIRKGWIPCLEFETEHGFVYREHHNSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTD++QV+ EL+EC K YP A+VRI+GFDNKRQVQCI FIA+KP
Sbjct  61   YYDGRYWTMWKLPMFGCTDSSQVLKELDECTKEYPKAFVRIIGFDNKRQVQCISFIAHKP  120



>gb|AAA82069.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Glycine soja]
Length=178

 Score =   203 bits (517),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+PCLEFE E GFVYRE + S
Sbjct  54   QCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGR WTMWKLPMFGCTDA+QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRCWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|XP_009356790.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Pyrus x bretschneideri]
Length=182

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS E L K+V+YLL K WVP LEFE E+ FVYRE ++S
Sbjct  58   QCMQVWPPTGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPTLEFELERPFVYREHNSS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD++QV+ ELEE K AYP +++RI+GFDN RQ QCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPLFGCTDSSQVLKELEEAKTAYPNSFIRIIGFDNVRQTQCISFIAY  177

Query  361  KP  366
            +P
Sbjct  178  QP  179



>gb|AAA33685.2| ribulose 1,5 bisphosphate carboxylase, partial [Pisum sativum]
Length=139

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL K WVPCLEFE EKGFVYRE + S
Sbjct  15   KCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKPWVPCLEFELEKGFVYREHNKS  74

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  75   PGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAH  134

Query  361  KPDD  372
             P+ 
Sbjct  135  TPES  138



>ref|WP_028130706.1| hypothetical protein [Serratia marcescens]
Length=123

 Score =   201 bits (511),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            MQVWPP GLKKFETLSYLP L+TEQL K++EYLL   WVPCLEFE EKG+VYRE H SPG
Sbjct  1    MQVWPPTGLKKFETLSYLPDLTTEQLAKEIEYLLRSKWVPCLEFELEKGWVYREHHRSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIA KP
Sbjct  61   YYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSFIRIIGFDNVRQVQCISFIASKP  120



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G  K ET SYLP L+ EQLLK+++YL+  GW+PCLEFE EKG VYRE+H S
Sbjct  57   QCMQVWPPTGKLKNETFSYLPDLTDEQLLKEIDYLIRNGWIPCLEFELEKGHVYREYHRS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+ EC K YP  WVRI+GFDN RQVQCI FIA 
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDATQVLKEVRECLKEYPNCWVRIIGFDNVRQVQCISFIAA  176

Query  361  KP  366
            KP
Sbjct  177  KP  178



>dbj|BAK23964.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[synthetic construct]
Length=170

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   KCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>gb|AAK16227.1|AF044395_1 ribulose-1,5-bisphosphate carboxylase small subunit R1 [Flaveria 
ramosissima]
Length=131

 Score =   201 bits (511),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP G KK+ETLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE H S
Sbjct  7    QCMKVWPPLGKKKYETLSYLPNLTETQLAKEVDYLLRNKWVPCLEFELEHGFVYRENHRS  66

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ EL ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  67   PGYYDGRYWTMWKLPMFGCTDSSQVMKELGECKKEYPQAWIRIIGFDNVRQVQCISFIAS  126

Query  361  KPD  369
            KPD
Sbjct  127  KPD  129



>gb|AAA33686.1| ribulose 1,5-bisphosphate carboxylase small subunit propeptide, 
partial [Pisum sativum]
Length=156

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL KGWVPCLEFE EKGFVYRE + S
Sbjct  32   KCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPCLEFELEKGFVYREHNKS  91

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFG TDA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+
Sbjct  92   PRYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAH  151

Query  361  KPDD  372
             P+ 
Sbjct  152  TPES  155



>ref|XP_008339672.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS E L K+V+YLL K WVP LEFE E+ FVYRE ++S
Sbjct  58   QCMQVWPPIGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPTLEFELERPFVYREHNSS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD++QV+ E+EE K AYP +++RI+GFDN RQ QCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPLFGCTDSSQVLKEVEEAKTAYPNSFIRIIGFDNVRQTQCISFIAY  177

Query  361  KP  366
            +P
Sbjct  178  QP  179



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP G KK+ETLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE   S
Sbjct  54   QCMKVWPPLGKKKYETLSYLPNLTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIAS  173

Query  361  KPD  369
            KPD
Sbjct  174  KPD  176



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKK+ETLSYLPPLS E L K+++YL+   W+PCLEFE E GFVYRE H S
Sbjct  56   QCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ E+ ECKK YP A++R++GFDN RQVQCI FI  
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVA  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|AIB04188.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia oleifera]
Length=176

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKKFETLSYLPPL+  QL K+V+YL+  GW+PCLEF    GFVYRE + S
Sbjct  52   QCMKVWPPLGLKKFETLSYLPPLTQVQLGKEVDYLIRLGWIPCLEFSVVGGFVYREHNKS  111

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A++RI+GFDNKRQVQCI FIA 
Sbjct  112  PGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPQAFIRIIGFDNKRQVQCISFIAC  171

Query  361  KP  366
            KP
Sbjct  172  KP  173



>gb|ABS57004.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[synthetic construct]
Length=129

 Score =   201 bits (510),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            M+VWPP GLKK+ETLSYLPPL+  QL K+V+YLL K WVPCLEFE E GFVYRE   SPG
Sbjct  1    MKVWPPLGLKKYETLSYLPPLTETQLAKEVDYLLRKKWVPCLEFELEHGFVYRENARSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTD+ QV+ EL ECKK YP AW+RI+GFDN RQVQCIMFIA +P
Sbjct  61   YYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAWIRIIGFDNVRQVQCIMFIASRP  120

Query  367  D  369
            D
Sbjct  121  D  121



>ref|XP_008352922.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   202 bits (514),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPLS E L K+V+YLL K WVP LEFE E+ FVYRE ++S
Sbjct  58   QCMQVWPPIGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPTLEFELERPFVYREHNSS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD++QV+ E EE K AYP +++RI+GFDN RQ QCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPLFGCTDSSQVLKEXEEAKTAYPNSFIRIIGFDNVRQTQCISFIAY  177

Query  361  KP  366
            +P
Sbjct  178  QP  179



>gb|AAG49562.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Citrus reticulata]
Length=118

 Score =   200 bits (508),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  4    CMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASP  183
            CMQVWPP GLKKFETLSYLPPLS E LLK++ YLL  GW+PCLEFE EKG+VYRE H+SP
Sbjct  1    CMQVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSP  60

Query  184  GYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIA  357
            GYYDGRYWTMWKLPM+GCTDATQV+ E+ E +K YP ++VRI+GFDNKRQVQCI FIA
Sbjct  61   GYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIA  118



>gb|EAY97115.1| hypothetical protein OsI_19041 [Oryza sativa Indica Group]
Length=175

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHKS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>prf||0902172A carboxylase/oxygenase,RBP
Length=123

 Score =   200 bits (508),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            MQVWPP   KK+ETLSYLP LS EQLL + +YLL  GWVPCLEFETE GFVYRE + SPG
Sbjct  1    MQVWPPINKKKYETLSYLPDLSQEQLLLEPDYLLKDGWVPCLEFETEHGFVYRENNKSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW+RI+GFDN RQVQCI FIAYKP
Sbjct  61   YYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAWIRIIGFDNVRQVQCISFIAYKP  120

Query  367  D  369
            +
Sbjct  121  E  121



>gb|AAA84592.1| ribulose 1,5-bisphosphate carboxylase [Oryza sativa]
Length=169

 Score =   201 bits (512),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  40   RCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHKS  98

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  99   PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  158

Query  361  KP  366
            KP
Sbjct  159  KP  160



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score =   202 bits (513),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLP LS   L K+V+YLL   W+PC+EFE E GFVYRE + S
Sbjct  58   HCMQVWPPVGKKKFETLSYLPDLSEVSLAKEVDYLLRNKWIPCVEFELEHGFVYREHNKS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD++QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  118  PGYYDGRYWTMWKLPLFGCTDSSQVLKEVEECKKEYPNAFIRIIGFDNSRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>ref|NP_001066559.1| Os12g0274700 [Oryza sativa Japonica Group]
 sp|Q0INY7.1|RBS1_ORYSJ RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=Ribulose bisphosphate carboxylase small 
chain C; Short=RuBisCO small subunit; Short=RuBisCO small subunit 
C; Flags: Precursor [Oryza sativa Japonica Group]
 sp|A2Y205.2|RBS1_ORYSI RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=Ribulose bisphosphate carboxylase small 
chain C; Short=RuBisCO small subunit; Short=RuBisCO small subunit 
C; Flags: Precursor [Oryza sativa Indica Group]
 dbj|BAA00538.1| small subunit of ribulose-1,5-bisphosphate carboxylase [Oryza 
sativa Japonica Group]
 gb|AAB70544.1| ribulose 1,5-bisphosphate carboxylase small subunit [Oryza sativa 
Indica Group]
 gb|ABA97056.1| Ribulose bisphosphate carboxylase small chain C, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29578.1| Os12g0274700 [Oryza sativa Japonica Group]
 gb|ABR25908.1| chloroplast ribulose bisphosphate carboxylase small chain precursor 
[Oryza sativa Indica Group]
 dbj|BAG88038.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99587.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62884.1| hypothetical protein OsJ_17688 [Oryza sativa Japonica Group]
 prf||1508256A ribulose bisphosphate carboxylase S
Length=175

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>ref|NP_001066604.1| Os12g0291100 [Oryza sativa Japonica Group]
 sp|P18566.2|RBS2_ORYSJ RecName: Full=Ribulose bisphosphate carboxylase small chain A, 
chloroplastic; Short=RuBisCO small subunit A; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAR19268.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Oryza sativa Japonica Group]
 gb|ABA97169.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG21974.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG21975.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29623.1| Os12g0291100 [Oryza sativa Japonica Group]
 gb|ABR25686.1| ribulose bisphosphate carboxylase small chain c [Oryza sativa 
Indica Group]
 gb|EEC69124.1| hypothetical protein OsI_38042 [Oryza sativa Indica Group]
 gb|EEE53069.1| hypothetical protein OsJ_35811 [Oryza sativa Japonica Group]
 gb|AEP20544.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Oryza sativa Japonica Group]
Length=175

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   KCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>ref|NP_001066606.1| Os12g0291400 [Oryza sativa Japonica Group]
 gb|ABA97173.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG21973.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29625.1| Os12g0291400 [Oryza sativa Japonica Group]
 gb|EAZ20214.1| hypothetical protein OsJ_35814 [Oryza sativa Japonica Group]
 dbj|BAG94202.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   SCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>sp|P29684.1|RBS_HEVBR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Hevea brasiliensis]
 gb|AAA33361.1| ribulose-1,5-bisphosphate carboxylase small subunit [Hevea brasiliensis]
Length=183

 Score =   202 bits (513),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G K +ETLSYLPPL+ EQL K+VEYLL KGWVPCLEFE E G VYRE+H S
Sbjct  58   QCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLLRKGWVPCLEFELEHGTVYREYHRS  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA QV+ EL+E  KAYP  + RI+GFDN RQVQCI F+AY
Sbjct  118  PGYYDGRYWTMWKLPMFGCTDAVQVLQELDEMIKAYPDCYGRIIGFDNVRQVQCISFLAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>gb|AIR75139.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia turkestanica]
Length=165

 Score =   201 bits (511),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H S
Sbjct  48   QCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNS  107

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  354
            PGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  108  PGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>gb|ACO35888.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ageratina adenophora]
Length=178

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKK+ETLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE   S
Sbjct  54   QCMKVWPPLGLKKYETLSYLPTLTETQLAKEVDYLLRNKWVPCLEFELEHGFVYREHARS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGR+WTMWKLPMFGCTD+ QV+ E+ ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  114  PGYYDGRHWTMWKLPMFGCTDSAQVLKEVGECKKEYPQAWIRIIGFDNVRQVQCISFIAS  173

Query  361  KPD  369
            KPD
Sbjct  174  KPD  176



>gb|EMT06085.1| hypothetical protein F775_43781 [Aegilops tauschii]
Length=175

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLSTE LLKQV+YL+   WVPCLEF ++ GF++RE +AS
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEF-SKVGFIFREHNAS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+EE KK YP A+VRI+GFDN RQVQC+ FIA+
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVINEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAF  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>ref|XP_007151650.1| hypothetical protein PHAVU_004G064800g [Phaseolus vulgaris]
 ref|XP_007151651.1| hypothetical protein PHAVU_004G064900g [Phaseolus vulgaris]
 gb|ESW23644.1| hypothetical protein PHAVU_004G064800g [Phaseolus vulgaris]
 gb|ESW23645.1| hypothetical protein PHAVU_004G064900g [Phaseolus vulgaris]
Length=180

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QC+QVWP  G KKFETLSYLPPL+ EQL K+V+YLL KGWVPCLEFE E GFVYRE + S
Sbjct  56   QCIQVWPTVGKKKFETLSYLPPLTKEQLAKEVDYLLRKGWVPCLEFELEHGFVYREHNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ EL E + A+P  ++RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGFIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>dbj|BAB19812.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Triticum aestivum]
Length=175

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLSTE LLKQV+YL+   WVPCLEF ++ GF++RE +AS
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEF-SKVGFIFREHNAS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+EE KK YP A+VRI+GFDN RQVQC+ FIA+
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVINEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAF  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>gb|AFS41733.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
Length=179

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + 
Sbjct  55   QCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSL  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  115  PTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPNAFIRIIGFDNVRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>gb|AIR75136.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
 gb|AIR75137.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   201 bits (510),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H S
Sbjct  48   QCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNS  107

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  354
            PGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  108  PGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>ref|NP_001066607.1| Os12g0292400 [Oryza sativa Japonica Group]
 gb|ABA97179.1| Ribulose bisphosphate carboxylase small chain C, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 gb|ABA97180.1| Ribulose bisphosphate carboxylase small chain C, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29626.1| Os12g0292400 [Oryza sativa Japonica Group]
 gb|EAZ20216.1| hypothetical protein OsJ_35820 [Oryza sativa Japonica Group]
 gb|ABR25478.1| ribulose bisphosphate carboxylase small chain c [Oryza sativa 
Indica Group]
 dbj|BAG90832.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91855.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>gb|AIL82451.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   201 bits (510),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H S
Sbjct  48   QCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNS  107

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  354
            PGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  108  PGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>ref|XP_003576920.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Brachypodium distachyon]
Length=175

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLS E LLKQ+EYL+   WVPCLEF ++ GFV+RE ++S
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLSVESLLKQIEYLIRSKWVPCLEF-SKVGFVFREHNSS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KK YP A+VRI+GFDN RQVQCI FIA+
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEVKKEYPDAYVRIIGFDNTRQVQCISFIAF  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   201 bits (510),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP G K++ETLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE   S
Sbjct  49   QCMKVWPPLGKKRYETLSYLPNLTESQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARS  108

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  109  PGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIAS  168

Query  361  KPD  369
            KPD
Sbjct  169  KPD  171



>gb|AGV54682.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
Length=180

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QC+QVWP  G KKFETLSYLPPL+ EQL K+V+YLL KGWVPCLEFE E GFVYRE + S
Sbjct  56   QCIQVWPTVGKKKFETLSYLPPLTQEQLAKEVDYLLRKGWVPCLEFELEHGFVYREHNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ EL E + A+P  ++RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGFIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|AEX60842.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41722.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41723.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41730.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41731.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41737.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41745.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41752.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41759.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG00063.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
 gb|KHG20485.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=179

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + 
Sbjct  55   QCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSL  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  115  PTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>gb|AAF19793.1|AF162210_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Lactuca sativa]
Length=181

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP GLKK+ETLSYLPPLS E L K+++YL+   WVPCLEFE E GFVYRE H S
Sbjct  56   QCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWVPCLEFELEHGFVYREHHHS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ E+ ECKK YP A++R++GFD+ RQVQCI FI  
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDSVRQVQCISFIVS  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|ABR25969.1| ribulose bisphosphate carboxylase small chain c [Oryza sativa 
Indica Group]
Length=157

 Score =   200 bits (509),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  28   KCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  86

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  87   PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  146

Query  361  KP  366
            KP
Sbjct  147  KP  148



>gb|AFS41748.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=179

 Score =   201 bits (511),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + 
Sbjct  55   QCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSL  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  115  PTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPNAFIRIIGFDNVRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>gb|AFS41753.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   201 bits (511),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + 
Sbjct  55   QCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSL  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  115  PTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>gb|AEX60839.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41738.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41746.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41758.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   201 bits (510),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + 
Sbjct  55   QCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSL  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAY
Sbjct  115  PTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>gb|EMT25898.1| Ribulose bisphosphate carboxylase small chain PWS4.3, chloroplastic 
[Aegilops tauschii]
Length=170

 Score =   201 bits (510),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLSTE LLKQV+YL+   WVPCLEF ++ GF++RE +AS
Sbjct  41   RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEF-SKVGFIFREHNAS  99

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+EE KK YP A+VRI+GFDN RQVQC+ FIA+
Sbjct  100  PGYYDGRYWTMWKLPMFGCTDATQVINEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAF  159

Query  361  KP  366
            KP
Sbjct  160  KP  161



>ref|XP_010916368.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   201 bits (511),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP  GLKKFETLSYLPPLS E LLKQ+EYLL  GW+PCLEF  + GFV R+ + S
Sbjct  57   QCMKVWPIEGLKKFETLSYLPPLSIEALLKQIEYLLRSGWIPCLEF-CKVGFVSRDNNRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC DATQV  ELEECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCNDATQVAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>emb|CDP20139.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   200 bits (508),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G  K ET SYLP L+ EQLLK+++YL+  GW+PCLEFE EKG VYRE+H S
Sbjct  34   QCMQVWPPTGKLKNETFSYLPDLTDEQLLKEIDYLIRNGWIPCLEFELEKGHVYREYHRS  93

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+ EC K YP  WVRI+GFDN RQVQCI FIA 
Sbjct  94   PGYYDGRYWTMWKLPMFGCTDATQVLKEVRECLKEYPNCWVRIIGFDNVRQVQCISFIAA  153

Query  361  KP  366
            KP
Sbjct  154  KP  155



>gb|ABR45725.1| RBCS1 [Actinidia deliciosa]
Length=176

 Score =   201 bits (510),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G +KFETLSYLPPL  + LLKQ++YL+  GW+PC+EF   +GFVYRE H S
Sbjct  50   KCMQVWPPLGKRKFETLSYLPPLPVDALLKQIDYLIRSGWIPCIEFTVGEGFVYREHHHS  109

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPM+GCTD+TQV+AE+E  KK YP +++RI+GFDNKRQVQC+ FI +
Sbjct  110  PGYYDGRYWTMWKLPMYGCTDSTQVLAEVEANKKEYPNSYIRIIGFDNKRQVQCVSFIVH  169

Query  361  KP  366
             P
Sbjct  170  TP  171



>ref|XP_008797838.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=182

 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWP  G+KKFETLSYLPPL  E LLKQ+EYLL   WVPCLEF  + GFVYRE H S
Sbjct  57   QCMKVWPIEGVKKFETLSYLPPLPIEALLKQIEYLLRSRWVPCLEF-CKVGFVYRENHRS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC DATQV  ELEECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCNDATQVAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>gb|EAY82834.1| hypothetical protein OsI_38046 [Oryza sativa Indica Group]
Length=175

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQ I FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP G K++ETLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE   S
Sbjct  49   QCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARS  108

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  109  PGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIAS  168

Query  361  KPD  369
            KPD
Sbjct  169  KPD  171



>ref|XP_003577109.1| PREDICTED: ribulose bisphosphate carboxylase small chain PWS4.3, 
chloroplastic [Brachypodium distachyon]
Length=174

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWP  G+KKFETLSYLPPLS E LLKQ+EYL+   WVPCLEF ++ GFV+RE ++S
Sbjct  45   SCMQVWPIEGIKKFETLSYLPPLSVESLLKQIEYLIRSKWVPCLEF-SKVGFVFREHNSS  103

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KK YP A+VRI+GFDN RQVQCI FIA+
Sbjct  104  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEVKKEYPDAYVRIIGFDNTRQVQCISFIAF  163

Query  361  KP  366
            KP
Sbjct  164  KP  165



>dbj|BAJ89884.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90046.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86062.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00853.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLSTE LLKQV+YL+   WVPCLEF ++ GF++RE +AS
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEF-SKVGFIFREHNAS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+EE KK YP A+VRI+GFDN RQVQC+ FIA+
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAF  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>dbj|BAA35179.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Bromus catharticus]
Length=164

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLSTE LLKQ++YL+   WVPCLEF ++ GFV+RE +AS
Sbjct  40   RCMQVWPIEGIKKFETLSYLPPLSTEALLKQIDYLIRSKWVPCLEF-SKVGFVFREHNAS  98

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDA+QV+ ELEE KK YP A+VRI+GFDN RQVQC+ FIA+
Sbjct  99   PGYYDGRYWTMWKLPMFGCTDASQVIKELEEVKKEYPDAYVRIIGFDNLRQVQCVSFIAF  158

Query  361  KP  366
            KP
Sbjct  159  KP  160



>pdb|1IR1|S Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|T Chain T, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|U Chain U, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|V Chain V, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
Length=123

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  10   QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGY  189
            +VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGY
Sbjct  2    KVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGY  61

Query  190  YDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FIAYKP
Sbjct  62   YDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP  120



>gb|AEX60841.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41728.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41735.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41743.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41750.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41757.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+PCLEFE E+GFV+R++ + 
Sbjct  58   QCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSL  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  118  PTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAY  177

Query  361  KPD  369
            KP+
Sbjct  178  KPE  180



>gb|AAK16228.1|AF044396_1 ribulose-1,5-bisphosphate carboxylase small subunit R2 [Flaveria 
ramosissima]
Length=131

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP G KK+ETLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE   S
Sbjct  7    QCMKVWPPLGKKKYETLSYLPDLTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARS  66

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  67   PGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIAS  126

Query  361  KPD  369
            KPD
Sbjct  127  KPD  129



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP G K++ETLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE   S
Sbjct  49   QCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARS  108

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  109  PGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIAS  168

Query  361  KPD  369
            KPD
Sbjct  169  KPD  171



>emb|CAA42618.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
 emb|CAA40339.1| small subunit of ribulose 1,5-bisphosphate carboxylase/oxygenase 
[Phaseolus vulgaris]
Length=180

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QC+QVWP  G KKFETLSYLPPL+ +QL K+V+YLL KGWVPCLEFE E GFVYRE + S
Sbjct  56   QCIQVWPTVGKKKFETLSYLPPLTKQQLAKEVDYLLRKGWVPCLEFELEHGFVYREHNKS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD++QV+ EL E + A+P  ++RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGFIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>dbj|BAJ90550.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=176

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLSTE LLKQV+YL+   WVPCLEF ++ GF++RE +AS
Sbjct  47   RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEF-SKVGFIFREHNAS  105

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+EE KK YP A+VRI+GFDN RQVQC+ FIA+
Sbjct  106  PGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAF  165

Query  361  KP  366
            KP
Sbjct  166  KP  167



>emb|CAA10497.1| hypothetical protein [Secale cereale]
Length=175

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+TE LLKQV+YL+   WVPCLEF ++ GF++RE +AS
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLTTEALLKQVDYLIRSKWVPCLEF-SKVGFIFREHNAS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+EE KK YP A+VRI+GFDN RQVQC+ FIA+
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVINEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAF  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>gb|AIF75367.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75368.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  41   QCMQVWPPINKKKYETLSYLPDLSVEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQV  336
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|KCW52064.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=192

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP GLKKFETLSYLPPL+  QL K+++YLL  GWVPCLEFETEKGFVYRE H S
Sbjct  57   QCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWVPCLEFETEKGFVYREHHHS  116

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNK  327
            PGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+VRI+GFDN 
Sbjct  117  PGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAFVRIIGFDNN  165



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +
Sbjct  54   SCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNT  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +
Sbjct  54   SCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNT  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +
Sbjct  54   SCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNT  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLP L+  +L K+V+YL+   W+PC+EFE E GFVYRE   S
Sbjct  54   NCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +
Sbjct  54   SCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNT  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>gb|ABR45726.1| RBCS1 [Actinidia chinensis]
Length=176

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWPP G KKFETLSYLPPL  E LLKQ++YL+  GW+PC+EF   +GFVYRE H S
Sbjct  50   KCMQVWPPLGKKKFETLSYLPPLPEEALLKQIDYLIRMGWIPCIEFSVGEGFVYREHHHS  109

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPM+GCTD+TQV AE+E  KK YP +++RI+GFDNKRQVQC+ FI +
Sbjct  110  PGYYDGRYWTMWKLPMYGCTDSTQVRAEVEANKKEYPDSFIRIIGFDNKRQVQCVSFIVH  169

Query  361  KP  366
             P
Sbjct  170  TP  171



>ref|XP_010926041.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G KKFETLSYLPPLS E LLKQ+EYLL  GW+PCLEF  + GFVYRE H S
Sbjct  57   RCMQVWPIEGKKKFETLSYLPPLSIEALLKQIEYLLRSGWIPCLEF-CKVGFVYRENHQS  115

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGC DA QV  EL+ECKK YP  ++RI+GFDN RQVQCI FIAY
Sbjct  116  PGYYDGRYWTMWKLPMFGCNDAAQVAKELDECKKEYPDVFIRIIGFDNVRQVQCISFIAY  175

Query  361  KP  366
            KP
Sbjct  176  KP  177



>sp|Q39744.1|RBS2_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67846.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP G K++ETLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE   S
Sbjct  54   QCMKVWPPLGKKRYETLSYLPNLTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  114  PGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIAS  173

Query  361  KPD  369
            KP+
Sbjct  174  KPE  176



>pdb|3AXK|S Chain S, Structure Of Rice Rubisco In Complex With Nadp(h)
 pdb|3AXK|T Chain T, Structure Of Rice Rubisco In Complex With Nadp(h)
Length=129

 Score =   198 bits (503),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = +1

Query  7    MQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPG  186
            MQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H SPG
Sbjct  2    MQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRSPG  60

Query  187  YYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  366
            YYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQCI FIAYKP
Sbjct  61   YYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAYKP  120



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+PCLEFE E+GFV+R++ + 
Sbjct  58   QCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSL  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  118  PTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAY  177

Query  361  KP  366
            KP
Sbjct  178  KP  179



>gb|AIF75359.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75360.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   199 bits (505),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  41   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQV  336
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75351.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75352.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   198 bits (504),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  41   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQV  336
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75353.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75354.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   198 bits (504),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  41   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQV  336
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>sp|Q39748.1|RBS6_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67850.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   199 bits (506),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCM+VWPP G KK+ TLSYLP L+  QL K+V+YLL   WVPCLEFE E GFVYRE   S
Sbjct  49   QCMKVWPPLGKKKYXTLSYLPNLTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARS  108

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA 
Sbjct  109  PGYYDGRYWTMWKLPMFGCTDSVQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIAS  168

Query  361  KPD  369
            KPD
Sbjct  169  KPD  171



>gb|AAC14064.1| ribulose 1,5-bisphosphate carboxylase small subunit [Oryza sativa 
Japonica Group]
Length=175

 Score =   199 bits (506),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+ E LLKQ+EYLL   WVPCLEF ++ GFVYRE H S
Sbjct  46   RCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEF-SKVGFVYRENHRS  104

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKA P A+VRI+GFDN RQVQ I FIAY
Sbjct  105  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKANPDAFVRIIGFDNVRQVQLISFIAY  164

Query  361  KP  366
            KP
Sbjct  165  KP  166



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score =   199 bits (506),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLP L+  +L K+V+YLL   W+PC+EFE E GFVYRE   S
Sbjct  54   NCMQVWPPVGKKKFETLSYLPDLTDSELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNS  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPEAFIRIIGFDNSRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>gb|AIF75364.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75366.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  41   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQV  336
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75361.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75362.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  41   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQV  336
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75363.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  41   QCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQV  336
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPRAWIRIIGFDNVRQV  152



>gb|AHC28978.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Phragmites australis]
 gb|AHC28979.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Phragmites australis]
Length=171

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPL+TE LLKQ+EYL+   W+PCLEF ++ GFVYRE   S
Sbjct  42   KCMQVWPIEGIKKFETLSYLPPLTTEDLLKQIEYLIRSKWIPCLEF-SKVGFVYRENGRS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+VRI+GFDN RQVQCI FIAY
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAY  160

Query  361  KP  366
            KP
Sbjct  161  KP  162



>gb|AFS41724.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB10449.1| hypothetical protein B456_001G201800 [Gossypium raimondii]
Length=182

 Score =   199 bits (506),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+PCLEFE E+GFV+R++   
Sbjct  58   QCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSNL  117

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  118  PTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAY  177

Query  361  KPD  369
            KP+
Sbjct  178  KPE  180



>ref|XP_004962301.1| PREDICTED: ribulose bisphosphate carboxylase small chain A, chloroplastic-like 
[Setaria italica]
Length=168

 Score =   199 bits (505),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G KKFETLSYLPPLST+QLLKQVEYL+   W+PCLEF ++ GFV+RE   S
Sbjct  44   RCMQVWPAEGNKKFETLSYLPPLSTDQLLKQVEYLIRNNWIPCLEF-SKVGFVFRENSRS  102

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCT+ATQV AELEECKKAYP  ++R++GFDN RQVQC++FIAY
Sbjct  103  PCYYDGRYWTMWKLPMFGCTEATQVYAELEECKKAYPDCYIRVIGFDNLRQVQCVLFIAY  162

Query  361  KP  366
            KP
Sbjct  163  KP  164



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   198 bits (504),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CMQVWPP G KKFETLSYLP L+  +L K+V+YL+   W+PC+EFE E GFVYRE   S
Sbjct  42   NCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNS  101

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  102  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAY  161

Query  361  KP  366
            KP
Sbjct  162  KP  163



>gb|AIF75346.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75347.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
 gb|AIF75348.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   198 bits (503),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP   KK+ETLSYLP LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + S
Sbjct  41   QCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKS  100

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQV  336
            PGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  101  PGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score =   199 bits (506),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +
Sbjct  54   SCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNT  113

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAY
Sbjct  114  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAY  173

Query  361  KP  366
            KP
Sbjct  174  KP  175



>gb|KDP29409.1| hypothetical protein JCGZ_18330 [Jatropha curcas]
Length=153

 Score =   198 bits (503),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G K FETLSYLPPLS +QL K+V YLL    VPCLEFE E GFVYRE H S
Sbjct  35   QCMQVWPPVGKKFFETLSYLPPLSQDQLAKEVHYLLRMDRVPCLEFELEHGFVYRENHRS  94

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIA  357
            PGYYDGRYWTMWKLPMFGCTD+ QV+ ELEE K AYP +++RI+GFDNKRQVQCI FIA
Sbjct  95   PGYYDGRYWTMWKLPMFGCTDSAQVLKELEEAKTAYPNSFIRIIGFDNKRQVQCISFIA  153



>dbj|BAA35165.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Aegilops speltoides]
Length=165

 Score =   198 bits (504),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLSTE LLKQV+YL+   WVPCLEF ++ GFV+RE ++S
Sbjct  41   RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEF-SKVGFVFREHNSS  99

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV++E+EE KK YP A+VR++GFDN RQVQC+ FIA+
Sbjct  100  PGYYDGRYWTMWKLPMFGCTDATQVLSEVEEVKKEYPDAYVRVIGFDNLRQVQCVSFIAF  159

Query  361  KP  366
            +P
Sbjct  160  RP  161



>gb|AFS41732.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41740.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41761.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   199 bits (505),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            QCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + 
Sbjct  55   QCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSL  114

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAY
Sbjct  115  PTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAY  174

Query  361  KP  366
            KP
Sbjct  175  KP  176



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score =   198 bits (504),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
             CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +
Sbjct  42   SCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNT  101

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAY
Sbjct  102  PGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAY  161

Query  361  KP  366
            KP
Sbjct  162  KP  163



>sp|Q40004.1|RBS_HORVU RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Hordeum vulgare]
 gb|AAA87039.1| ribulose-1,5-bisphosphate carboxylase small subunit [Hordeum 
vulgare subsp. vulgare]
Length=174

 Score =   199 bits (505),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    QCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHAS  180
            +CMQVWP  G+KKFETLSYLPPLSTE LLKQV+YL+   WVPCLEF ++ GF++RE +AS
Sbjct  45   RCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEF-SKVGFIFREHNAS  103

Query  181  PGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAY  360
            PGYYDGRYWTMWKLPMFGCTDATQV+ E+EE KK YP A+VRI+GFDN RQVQC+ FIA+
Sbjct  104  PGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAF  163

Query  361  KP  366
            KP
Sbjct  164  KP  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800