BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN004N04

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAJ77501.1|  expp1 protein precursor                                303   2e-100   Solanum tuberosum [potatoes]
ref|XP_006339175.1|  PREDICTED: uncharacterized protein LOC102588286    301   1e-99    
ref|XP_009589407.1|  PREDICTED: uncharacterized protein LOC104086779    295   2e-97    Nicotiana tomentosiformis
ref|XP_009780791.1|  PREDICTED: uncharacterized protein LOC104229791    295   3e-97    Nicotiana sylvestris
ref|XP_011094218.1|  PREDICTED: uncharacterized protein LOC105173973    287   3e-94    Sesamum indicum [beniseed]
ref|XP_009608547.1|  PREDICTED: uncharacterized protein LOC104102525    287   4e-94    Nicotiana tomentosiformis
ref|XP_007028015.1|  Uncharacterized protein TCM_023045                 286   5e-94    Theobroma cacao [chocolate]
gb|KHG09254.1|  hypothetical protein F383_15505                         285   2e-93    Gossypium arboreum [tree cotton]
gb|KJB16527.1|  hypothetical protein B456_002G234200                    285   2e-93    Gossypium raimondii
ref|XP_009368382.1|  PREDICTED: uncharacterized protein LOC103957887    285   4e-93    
ref|XP_008385577.1|  PREDICTED: uncharacterized protein LOC103448116    283   9e-93    Malus domestica [apple tree]
emb|CDP10582.1|  unnamed protein product                                282   3e-92    Coffea canephora [robusta coffee]
gb|KDP36093.1|  hypothetical protein JCGZ_08737                         280   2e-91    Jatropha curcas
ref|XP_010514756.1|  PREDICTED: uncharacterized protein LOC104790674    280   4e-91    Camelina sativa [gold-of-pleasure]
ref|XP_004140172.1|  PREDICTED: uncharacterized protein LOC101221211    280   5e-91    Cucumis sativus [cucumbers]
ref|XP_010503072.1|  PREDICTED: uncharacterized protein LOC104780...    280   5e-91    Camelina sativa [gold-of-pleasure]
ref|XP_008449601.1|  PREDICTED: uncharacterized protein LOC103491438    279   8e-91    Cucumis melo [Oriental melon]
ref|XP_004249401.2|  PREDICTED: uncharacterized protein LOC101246776    278   8e-91    Solanum lycopersicum
ref|XP_010058958.1|  PREDICTED: uncharacterized protein LOC104446855    279   9e-91    Eucalyptus grandis [rose gum]
ref|XP_009121178.1|  PREDICTED: uncharacterized protein LOC103846006    279   1e-90    Brassica rapa
ref|XP_010496864.1|  PREDICTED: uncharacterized protein LOC104773893    278   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006291737.1|  hypothetical protein CARUB_v10017907mg             277   3e-90    Capsella rubella
ref|XP_003538086.1|  PREDICTED: uncharacterized protein LOC100814491    276   4e-90    Glycine max [soybeans]
ref|XP_011046438.1|  PREDICTED: uncharacterized protein LOC105141047    277   4e-90    Populus euphratica
ref|XP_011042566.1|  PREDICTED: uncharacterized protein LOC105138225    276   4e-90    Populus euphratica
ref|XP_011035616.1|  PREDICTED: uncharacterized protein LOC105133...    276   8e-90    Populus euphratica
emb|CDX87939.1|  BnaC03g54570D                                          275   1e-89    
ref|XP_011077792.1|  PREDICTED: uncharacterized protein LOC105161704    275   1e-89    Sesamum indicum [beniseed]
ref|XP_002322773.1|  hypothetical protein POPTR_0016s06840g             275   1e-89    Populus trichocarpa [western balsam poplar]
emb|CDY55301.1|  BnaA06g38910D                                          275   2e-89    Brassica napus [oilseed rape]
gb|KHN21200.1|  hypothetical protein glysoja_006679                     275   2e-89    Glycine soja [wild soybean]
ref|NP_001240927.1|  uncharacterized protein LOC100818051 precursor     275   2e-89    Glycine max [soybeans]
ref|XP_011035615.1|  PREDICTED: uncharacterized protein LOC105133...    275   3e-89    Populus euphratica
ref|XP_010535718.1|  PREDICTED: uncharacterized protein LOC104810937    274   6e-89    Tarenaya hassleriana [spider flower]
ref|NP_190001.2|  uncharacterized protein                               273   9e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KFK33866.1|  hypothetical protein AALP_AA5G070300                    273   1e-88    Arabis alpina [alpine rockcress]
ref|XP_002875644.1|  predicted protein                                  273   2e-88    Arabidopsis lyrata subsp. lyrata
gb|KHF98050.1|  hypothetical protein F383_37453                         271   4e-88    Gossypium arboreum [tree cotton]
ref|XP_006404508.1|  hypothetical protein EUTSA_v10010660mg             271   6e-88    Eutrema salsugineum [saltwater cress]
ref|XP_002309260.1|  hypothetical protein POPTR_0006s21620g             270   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_010247701.1|  PREDICTED: uncharacterized protein LOC104590673    270   2e-87    Nelumbo nucifera [Indian lotus]
ref|XP_010106982.1|  hypothetical protein L484_016911                   268   1e-86    Morus notabilis
ref|XP_004497641.1|  PREDICTED: uncharacterized protein LOC101499...    268   1e-86    Cicer arietinum [garbanzo]
ref|XP_007202487.1|  hypothetical protein PRUPE_ppa010561mg             266   5e-86    Prunus persica
ref|XP_002524077.1|  conserved hypothetical protein                     266   5e-86    Ricinus communis
ref|XP_007145779.1|  hypothetical protein PHAVU_007G267000g             266   5e-86    Phaseolus vulgaris [French bean]
ref|XP_004303412.1|  PREDICTED: uncharacterized protein LOC101306356    265   1e-85    Fragaria vesca subsp. vesca
ref|XP_006481617.1|  PREDICTED: uncharacterized protein LOC102630770    265   2e-85    Citrus sinensis [apfelsine]
ref|XP_006430044.1|  hypothetical protein CICLE_v10012616mg             264   4e-85    Citrus clementina [clementine]
ref|XP_004497642.1|  PREDICTED: uncharacterized protein LOC101499...    263   8e-85    
ref|XP_007132505.1|  hypothetical protein PHAVU_011G099900g             262   2e-84    Phaseolus vulgaris [French bean]
ref|XP_007015648.1|  Uncharacterized protein TCM_041214                 262   2e-84    Theobroma cacao [chocolate]
ref|XP_009336402.1|  PREDICTED: uncharacterized protein LOC103928990    261   5e-84    Pyrus x bretschneideri [bai li]
ref|XP_009336403.1|  PREDICTED: uncharacterized protein LOC103928991    261   7e-84    
ref|XP_008360605.1|  PREDICTED: uncharacterized protein LOC103424296    261   8e-84    
ref|XP_008367354.1|  PREDICTED: uncharacterized protein LOC103430985    260   9e-84    
ref|XP_006842158.1|  hypothetical protein AMTR_s00078p00138630          260   1e-83    Amborella trichopoda
ref|XP_010534378.1|  PREDICTED: uncharacterized protein LOC104809944    260   1e-83    Tarenaya hassleriana [spider flower]
ref|XP_009348837.1|  PREDICTED: uncharacterized protein LOC103940443    260   1e-83    Pyrus x bretschneideri [bai li]
ref|XP_003519108.1|  PREDICTED: uncharacterized protein LOC100807...    259   4e-83    Glycine max [soybeans]
ref|XP_010677555.1|  PREDICTED: uncharacterized protein LOC104893168    258   6e-83    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008361648.1|  PREDICTED: uncharacterized protein LOC103425346    258   7e-83    
emb|CAB88423.1|  putative protein                                       257   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008344952.1|  PREDICTED: uncharacterized protein LOC103407860    258   1e-82    
ref|XP_003535822.1|  PREDICTED: uncharacterized protein LOC100795...    257   2e-82    Glycine max [soybeans]
ref|XP_010263047.1|  PREDICTED: uncharacterized protein LOC104601426    257   6e-82    Nelumbo nucifera [Indian lotus]
ref|XP_002271183.1|  PREDICTED: uncharacterized protein LOC100249592    254   2e-81    Vitis vinifera
gb|EPS69588.1|  expp1 protein                                           253   3e-81    Genlisea aurea
ref|XP_010907712.1|  PREDICTED: uncharacterized protein LOC105034308    253   9e-81    Elaeis guineensis
ref|XP_008787836.1|  PREDICTED: uncharacterized protein LOC103705763    251   2e-80    Phoenix dactylifera
ref|XP_010263787.1|  PREDICTED: uncharacterized protein LOC104601...    251   7e-80    Nelumbo nucifera [Indian lotus]
gb|AEZ00912.1|  putative expp1 protein                                  251   8e-80    Elaeis guineensis
ref|XP_010263788.1|  PREDICTED: uncharacterized protein LOC104601...    251   9e-80    Nelumbo nucifera [Indian lotus]
ref|XP_010906029.1|  PREDICTED: uncharacterized protein LOC105033073    250   9e-80    Elaeis guineensis
ref|XP_010263789.1|  PREDICTED: uncharacterized protein LOC104601...    250   1e-79    Nelumbo nucifera [Indian lotus]
ref|XP_009381303.1|  PREDICTED: uncharacterized protein LOC103969490    249   2e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003590316.1|  hypothetical protein MTR_1g056390                  247   1e-78    Medicago truncatula
ref|XP_010036587.1|  PREDICTED: uncharacterized protein LOC104425564    247   1e-78    Eucalyptus grandis [rose gum]
ref|XP_004161289.1|  PREDICTED: uncharacterized LOC101209667 isof...    245   9e-78    
ref|XP_008811297.1|  PREDICTED: uncharacterized protein LOC103722495    245   9e-78    
ref|XP_004136522.1|  PREDICTED: uncharacterized protein LOC101209667    245   1e-77    Cucumis sativus [cucumbers]
ref|XP_008442938.1|  PREDICTED: uncharacterized protein LOC103486692    243   7e-77    Cucumis melo [Oriental melon]
ref|XP_002882747.1|  hypothetical protein ARALYDRAFT_478525             243   1e-76    
gb|ABK22043.1|  unknown                                                 241   3e-76    Picea sitchensis
ref|XP_010503073.1|  PREDICTED: uncharacterized protein LOC104780...    241   3e-76    
ref|XP_008241077.1|  PREDICTED: uncharacterized protein LOC103339548    241   4e-76    Prunus mume [ume]
ref|XP_010276279.1|  PREDICTED: uncharacterized protein LOC104611063    239   1e-75    
ref|NP_566401.1|  uncharacterized protein                               239   3e-75    Arabidopsis thaliana [mouse-ear cress]
emb|CBI32499.3|  unnamed protein product                                238   3e-75    Vitis vinifera
ref|XP_002281560.2|  PREDICTED: uncharacterized protein LOC100243476    238   3e-75    Vitis vinifera
ref|XP_009407725.1|  PREDICTED: uncharacterized protein LOC103990346    238   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006356594.1|  PREDICTED: uncharacterized protein LOC102601...    237   9e-75    Solanum tuberosum [potatoes]
ref|XP_010464889.1|  PREDICTED: uncharacterized protein LOC104745376    237   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_004982307.1|  PREDICTED: uncharacterized protein LOC101777564    237   2e-74    Setaria italica
ref|XP_006298425.1|  hypothetical protein CARUB_v10014494mg             236   2e-74    Capsella rubella
gb|KFK38545.1|  hypothetical protein AALP_AA3G127900                    236   3e-74    Arabis alpina [alpine rockcress]
gb|AAT75254.1|  expressed protein                                       235   1e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004248747.1|  PREDICTED: uncharacterized protein LOC101250348    234   1e-73    Solanum lycopersicum
ref|XP_004290389.1|  PREDICTED: uncharacterized protein LOC101301448    233   5e-73    Fragaria vesca subsp. vesca
ref|NP_001148355.1|  expp1 protein precursor                            233   5e-73    
ref|XP_010498123.1|  PREDICTED: uncharacterized protein LOC104775868    233   7e-73    Camelina sativa [gold-of-pleasure]
ref|NP_001148709.1|  expp1 protein precursor                            233   7e-73    
ref|NP_001140927.1|  expp1 protein precursor                            233   8e-73    Zea mays [maize]
ref|XP_010486846.1|  PREDICTED: uncharacterized protein LOC104764937    233   9e-73    Camelina sativa [gold-of-pleasure]
ref|XP_009759897.1|  PREDICTED: uncharacterized protein LOC104212369    231   2e-72    Nicotiana sylvestris
ref|XP_008667260.1|  PREDICTED: expp1 protein isoform X2                233   2e-72    
ref|XP_008667257.1|  PREDICTED: expp1 protein isoform X1                233   4e-72    
ref|XP_002464167.1|  hypothetical protein SORBIDRAFT_01g013420          231   4e-72    Sorghum bicolor [broomcorn]
gb|ACL53994.1|  unknown                                                 230   6e-72    Zea mays [maize]
gb|ABF97892.1|  expressed protein                                       230   7e-72    Oryza sativa Japonica Group [Japonica rice]
emb|CDY08494.1|  BnaA05g27300D                                          230   7e-72    Brassica napus [oilseed rape]
gb|EYU37728.1|  hypothetical protein MIMGU_mgv1a012673mg                230   1e-71    Erythranthe guttata [common monkey flower]
gb|EEC77546.1|  hypothetical protein OsI_16454                          230   1e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_009146681.1|  PREDICTED: uncharacterized protein LOC103870308    230   1e-71    Brassica rapa
emb|CAN82373.1|  hypothetical protein VITISV_027624                     229   1e-71    Vitis vinifera
ref|XP_009590990.1|  PREDICTED: uncharacterized protein LOC104088076    229   2e-71    Nicotiana tomentosiformis
ref|NP_001050775.2|  Os03g0647800                                       229   3e-71    
ref|XP_002519146.1|  conserved hypothetical protein                     228   4e-71    
ref|XP_003559352.1|  PREDICTED: uncharacterized protein LOC100825968    227   1e-70    Brachypodium distachyon [annual false brome]
ref|XP_009135184.1|  PREDICTED: uncharacterized protein LOC103859409    226   2e-70    Brassica rapa
ref|XP_006651887.1|  PREDICTED: uncharacterized protein LOC102713815    225   3e-70    
ref|XP_006651640.1|  PREDICTED: uncharacterized protein LOC102702926    224   1e-69    Oryza brachyantha
emb|CDO97124.1|  unnamed protein product                                223   2e-69    Coffea canephora [robusta coffee]
gb|EPS70295.1|  hypothetical protein M569_04465                         222   6e-69    Genlisea aurea
ref|XP_006407410.1|  hypothetical protein EUTSA_v10021362mg             223   8e-69    
ref|XP_011088314.1|  PREDICTED: uncharacterized protein LOC105169588    222   9e-69    Sesamum indicum [beniseed]
ref|XP_010690983.1|  PREDICTED: uncharacterized protein LOC104904437    222   1e-68    Beta vulgaris subsp. vulgaris [field beet]
gb|KDP38260.1|  hypothetical protein JCGZ_04903                         220   7e-68    Jatropha curcas
ref|XP_008374037.1|  PREDICTED: uncharacterized protein LOC103437345    219   8e-68    Malus domestica [apple tree]
ref|XP_010526940.1|  PREDICTED: uncharacterized protein LOC104804369    219   2e-67    Tarenaya hassleriana [spider flower]
ref|XP_010263791.1|  PREDICTED: uncharacterized protein LOC104601...    218   3e-67    Nelumbo nucifera [Indian lotus]
ref|XP_010096267.1|  hypothetical protein L484_027004                   218   4e-67    Morus notabilis
ref|XP_004981507.1|  PREDICTED: uncharacterized protein LOC101763233    218   5e-67    
ref|XP_007199436.1|  hypothetical protein PRUPE_ppa026636mg             214   6e-66    
ref|XP_008236692.1|  PREDICTED: uncharacterized protein LOC103335461    214   6e-66    Prunus mume [ume]
ref|XP_003561838.1|  PREDICTED: uncharacterized protein LOC100825689    214   8e-66    Brachypodium distachyon [annual false brome]
ref|NP_001149996.1|  expp1 protein precursor                            214   8e-66    
ref|XP_010517082.1|  PREDICTED: uncharacterized protein LOC104792590    214   1e-65    
ref|XP_010467337.1|  PREDICTED: uncharacterized protein LOC104747407    214   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_008459230.1|  PREDICTED: uncharacterized protein LOC103498418    213   2e-65    Cucumis melo [Oriental melon]
ref|XP_006299440.1|  hypothetical protein CARUB_v10015605mg             213   3e-65    
ref|XP_009136289.1|  PREDICTED: uncharacterized protein LOC103860439    213   4e-65    Brassica rapa
ref|XP_009417070.1|  PREDICTED: uncharacterized protein LOC103997543    213   6e-65    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX89683.1|  BnaC03g45970D                                          214   3e-64    
dbj|BAJ94664.1|  predicted protein                                      211   3e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90624.1|  predicted protein                                      211   3e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY02274.1|  BnaA03g38930D                                          214   3e-64    
ref|XP_010066065.1|  PREDICTED: uncharacterized protein LOC104453239    210   4e-64    Eucalyptus grandis [rose gum]
ref|XP_006409495.1|  hypothetical protein EUTSA_v10023083mg             213   6e-64    
ref|XP_004507366.1|  PREDICTED: uncharacterized protein LOC101506783    210   7e-64    Cicer arietinum [garbanzo]
ref|XP_002885990.1|  hypothetical protein ARALYDRAFT_319534             213   9e-64    
ref|XP_006384473.1|  hypothetical protein POPTR_0004s15390g             207   4e-63    
ref|XP_011005674.1|  PREDICTED: uncharacterized protein LOC105111893    207   5e-63    Populus euphratica
gb|KDO39918.1|  hypothetical protein CISIN_1g040802mg                   207   9e-63    Citrus sinensis [apfelsine]
ref|XP_006480155.1|  PREDICTED: uncharacterized protein LOC102615233    207   1e-62    Citrus sinensis [apfelsine]
ref|XP_006423087.1|  hypothetical protein CICLE_v10029171mg             206   2e-62    
ref|XP_004145350.1|  PREDICTED: uncharacterized protein LOC101213680    205   5e-62    
ref|XP_011001205.1|  PREDICTED: uncharacterized protein LOC105108558    204   7e-62    Populus euphratica
ref|XP_008643755.1|  PREDICTED: expp1 protein isoform X1                216   9e-62    
gb|AFK46494.1|  unknown                                                 204   2e-61    Lotus japonicus
ref|XP_002463772.1|  hypothetical protein SORBIDRAFT_01g005890          203   3e-61    
ref|XP_007042316.1|  CSL zinc finger domain-containing protein          202   6e-61    
gb|KJB78926.1|  hypothetical protein B456_013G040100                    199   2e-60    Gossypium raimondii
gb|ACF84480.1|  unknown                                                 200   2e-60    Zea mays [maize]
gb|KJB78925.1|  hypothetical protein B456_013G040100                    199   7e-60    Gossypium raimondii
ref|XP_001762404.1|  predicted protein                                  196   2e-58    
ref|NP_179191.1|  CSL zinc finger domain-containing protein             199   3e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131910.1|  hypothetical protein PHAVU_011G050900g             195   4e-58    Phaseolus vulgaris [French bean]
gb|KHN25326.1|  hypothetical protein glysoja_010243                     191   1e-56    Glycine soja [wild soybean]
ref|XP_003541122.2|  PREDICTED: uncharacterized protein LOC100813820    191   1e-56    Glycine max [soybeans]
ref|XP_002977899.1|  hypothetical protein SELMODRAFT_36451              191   1e-56    
ref|NP_001241490.1|  uncharacterized protein LOC100816612               191   1e-56    Glycine max [soybeans]
ref|XP_003606839.1|  hypothetical protein MTR_4g068290                  191   3e-56    
gb|AES89036.2|  CSL zinc finger protein, putative                       190   4e-56    Medicago truncatula
ref|XP_002979423.1|  hypothetical protein SELMODRAFT_58114              188   1e-55    
gb|KGN61748.1|  hypothetical protein Csa_2G237180                       184   4e-54    Cucumis sativus [cucumbers]
gb|EEC76294.1|  hypothetical protein OsI_13809                          173   6e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_010517092.1|  PREDICTED: uncharacterized protein LOC104792600    171   6e-50    
tpg|DAA50290.1|  TPA: hypothetical protein ZEAMMB73_913292              166   4e-47    
ref|XP_006838810.1|  hypothetical protein AMTR_s00002p00262020          163   6e-47    
gb|EYU18142.1|  hypothetical protein MIMGU_mgv1a011713mg                163   1e-46    Erythranthe guttata [common monkey flower]
gb|ACL54751.1|  unknown                                                 163   2e-46    Zea mays [maize]
gb|ACU17763.1|  unknown                                                 158   3e-45    Glycine max [soybeans]
gb|KCW63843.1|  hypothetical protein EUGRSUZ_G01513                     149   1e-40    Eucalyptus grandis [rose gum]
emb|CDY70957.1|  BnaC03g73480D                                          147   1e-40    Brassica napus [oilseed rape]
ref|XP_008354774.1|  PREDICTED: uncharacterized protein LOC103418422    146   2e-40    Malus domestica [apple tree]
ref|XP_002863988.1|  hypothetical protein ARALYDRAFT_495006             149   2e-40    
gb|AFW67426.1|  hypothetical protein ZEAMMB73_369494                    137   7e-37    
gb|AAU89199.1|  expressed protein                                       143   2e-36    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006292065.1|  hypothetical protein CARUB_v10018260mg             132   1e-35    
gb|AFW68146.1|  expp1 protein, mRNA isoform 1                           133   2e-35    
gb|EMT01607.1|  hypothetical protein F775_23771                         141   7e-35    
gb|EMS61424.1|  Protein IQ-DOMAIN 1                                     139   1e-34    Triticum urartu
gb|AAF23196.1|AC016795_9  unknown protein                               123   7e-32    Arabidopsis thaliana [mouse-ear cress]
gb|EMT08784.1|  hypothetical protein F775_31788                         121   1e-30    
ref|XP_006827430.1|  hypothetical protein AMTR_s00009p00088580          119   2e-30    
emb|CAN71120.1|  hypothetical protein VITISV_000390                     105   8e-25    Vitis vinifera
ref|XP_008350235.1|  PREDICTED: uncharacterized protein LOC103413547    107   5e-23    
emb|CAB62352.1|  hypothetical protein                                 99.8    7e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002975636.1|  hypothetical protein SELMODRAFT_415872             103   8e-23    
ref|XP_002973613.1|  hypothetical protein SELMODRAFT_414097             102   8e-23    
ref|NP_001051495.1|  Os03g0787100                                     98.2    3e-22    
ref|XP_002978961.1|  hypothetical protein SELMODRAFT_418771             102   4e-22    
ref|XP_006303588.1|  hypothetical protein CARUB_v100111180mg          88.2    5e-19    
ref|XP_001760696.1|  predicted protein                                85.9    6e-16    
emb|CDY54071.1|  BnaA07g36330D                                        72.4    2e-12    Brassica napus [oilseed rape]
ref|NP_190432.4|  uncharacterized protein                             67.0    7e-11    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003064312.1|  predicted protein                                61.2    6e-08    Micromonas pusilla CCMP1545
ref|XP_006584145.1|  PREDICTED: uncharacterized protein LOC102665500  58.2    9e-08    
ref|XP_002501068.1|  predicted protein                                57.4    1e-06    Micromonas commoda
ref|XP_001695376.1|  predicted protein                                52.0    9e-05    Chlamydomonas reinhardtii



>emb|CAJ77501.1| expp1 protein precursor [Solanum tuberosum]
Length=243

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 167/188 (89%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  257
            A+S SDTNHV+SPCAD  VQ+SDGF+FGI FA+R + F+N S    VQLSPCD+RLSL+ 
Sbjct  22   AQSRSDTNHVYSPCADAKVQRSDGFSFGIAFASRTSFFVNSS----VQLSPCDKRLSLSS  77

Query  258  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             N+Q+AVFRPKVDEISLLT+NTSSFFPDS GGYMVAFAGRKYAARS PAFVANG++ V+S
Sbjct  78   ANSQIAVFRPKVDEISLLTINTSSFFPDSYGGYMVAFAGRKYAARSLPAFVANGTFTVTS  137

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRL+NLYWKRDGC+SC G+S F CLNGQDCA++TN+ +NRGGNVDCSLGIQ
Sbjct  138  FTLVHEFKKGRLENLYWKRDGCSSCSGNSNFVCLNGQDCAIRTNNCKNRGGNVDCSLGIQ  197

Query  615  LTFSGTDK  638
            LTFSGTDK
Sbjct  198  LTFSGTDK  205



>ref|XP_006339175.1| PREDICTED: uncharacterized protein LOC102588286 [Solanum tuberosum]
Length=243

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 167/188 (89%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  257
            A+S SDTNHV+SPCAD  VQ+SDGF+FGI FA+R + F+N S    VQLSPCD+RLSL+ 
Sbjct  22   AQSRSDTNHVYSPCADAKVQRSDGFSFGIAFASRTSFFVNSS----VQLSPCDKRLSLSS  77

Query  258  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             N+Q+AVFRPKVDEISLLT+NTS+FFPDS GGYMVAFAGRKYAARS PAFVANG++ V+S
Sbjct  78   ANSQIAVFRPKVDEISLLTINTSNFFPDSYGGYMVAFAGRKYAARSLPAFVANGTFTVTS  137

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRL+NLYWKRDGC+SC G+S F CLNGQDCA++TN+ +NRGGNVDCSLGIQ
Sbjct  138  FTLVHEFKKGRLENLYWKRDGCSSCSGNSNFVCLNGQDCAIRTNNCKNRGGNVDCSLGIQ  197

Query  615  LTFSGTDK  638
            LTFSGTDK
Sbjct  198  LTFSGTDK  205



>ref|XP_009589407.1| PREDICTED: uncharacterized protein LOC104086779 [Nicotiana tomentosiformis]
Length=242

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 165/188 (88%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  257
            A+S SDTNHV+SPCAD  VQKSDGF+FGI F++R + F+N S    VQLSPCD+RLSL+ 
Sbjct  21   AQSRSDTNHVYSPCADAKVQKSDGFSFGIAFSSRTSFFLNSS----VQLSPCDKRLSLSS  76

Query  258  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             N+Q+AVFRPKVDEISLLT+NT++FFPDS GGYMVAFAGRKYAARS PAFVAN ++ V+S
Sbjct  77   ANSQIAVFRPKVDEISLLTINTTNFFPDSYGGYMVAFAGRKYAARSLPAFVANNTFTVTS  136

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRL+NLYWKRDGC+SC G+S F CLN QDCA++TN+ +NRGGNVDCSLGIQ
Sbjct  137  FTLVLEFKKGRLENLYWKRDGCSSCSGNSNFVCLNDQDCAIRTNNCKNRGGNVDCSLGIQ  196

Query  615  LTFSGTDK  638
            LTFSGTDK
Sbjct  197  LTFSGTDK  204



>ref|XP_009780791.1| PREDICTED: uncharacterized protein LOC104229791 [Nicotiana sylvestris]
Length=242

 Score =   295 bits (755),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 165/188 (88%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  257
            A+S SDTNHV+SPCAD  VQKSDGF+FGI F++R + F+N S    VQLSPCD+RLSL+ 
Sbjct  21   AQSRSDTNHVYSPCADAKVQKSDGFSFGIAFSSRTSFFLNSS----VQLSPCDKRLSLSS  76

Query  258  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             N+QLAVFRP+VDEISLLT+NT++FFPDS GGYMVAFAGRKYAARS PAFVAN ++ V+S
Sbjct  77   ANSQLAVFRPRVDEISLLTINTTNFFPDSYGGYMVAFAGRKYAARSLPAFVANNTFTVTS  136

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRL+NLYWKRDGC+SC G+S F CLN QDCA++TN+ +NRGGNVDCSLGIQ
Sbjct  137  FTLVLEFKKGRLENLYWKRDGCSSCSGNSNFVCLNDQDCAIRTNNCKNRGGNVDCSLGIQ  196

Query  615  LTFSGTDK  638
            LTFSGTDK
Sbjct  197  LTFSGTDK  204



>ref|XP_011094218.1| PREDICTED: uncharacterized protein LOC105173973 [Sesamum indicum]
Length=242

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 163/187 (87%), Gaps = 6/187 (3%)
 Frame = +3

Query  84   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--  257
            +SSSDTNHVFSPC+D ++Q+SDGFTFGI FAAR A F N S    VQLSPCDRRLSL+  
Sbjct  22   DSSSDTNHVFSPCSDASIQRSDGFTFGIAFAARTAFFFNSS----VQLSPCDRRLSLSSA  77

Query  258  NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  437
            N+Q+AVFRPKVDEISLLT+NTS+FFPDSVGGYMVAFAGRKYA+RS PAFVAN +Y V+SF
Sbjct  78   NSQVAVFRPKVDEISLLTINTSNFFPDSVGGYMVAFAGRKYASRSIPAFVANSTYTVTSF  137

Query  438  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQL  617
            TLV EFKKGRLQNLYWKRDGCASC G + F CLN QDCA++TN+ +NRGG VDCSLGIQL
Sbjct  138  TLVLEFKKGRLQNLYWKRDGCASCSGKTNFVCLNNQDCAIRTNNCRNRGGTVDCSLGIQL  197

Query  618  TFSGTDK  638
             FSGTDK
Sbjct  198  AFSGTDK  204



>ref|XP_009608547.1| PREDICTED: uncharacterized protein LOC104102525 [Nicotiana tomentosiformis]
Length=246

 Score =   287 bits (734),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 162/188 (86%), Gaps = 4/188 (2%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  257
            +ES SDTNHV+ PCAD  VQ+SDGF+FGI FA RN+     + +  VQLSPCDRRLSL+ 
Sbjct  23   SESRSDTNHVYPPCADAKVQRSDGFSFGIAFAPRNSF--FINSSSSVQLSPCDRRLSLSS  80

Query  258  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             N+QLA+FRPKVDEISLLT+NTS+FFPDS GGYMVAFAGRKYAARS PAFVAN ++ ++S
Sbjct  81   ANSQLALFRPKVDEISLLTINTSNFFPDSYGGYMVAFAGRKYAARSLPAFVANSTFTITS  140

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRL+NLYWKRDGCASC G+S F CLN QDCA++TN+ +NRGG+VDCSLGIQ
Sbjct  141  FTLVLEFKKGRLENLYWKRDGCASCSGNSNFVCLNNQDCAIRTNNCKNRGGSVDCSLGIQ  200

Query  615  LTFSGTDK  638
            LTFSGTDK
Sbjct  201  LTFSGTDK  208



>ref|XP_007028015.1| Uncharacterized protein TCM_023045 [Theobroma cacao]
 gb|EOY08517.1| Uncharacterized protein TCM_023045 [Theobroma cacao]
Length=243

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 157/188 (84%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
             ESS DTNH ++PC+DT +Q SDGFTFGI FA+R + F N S    +QLSPCDRRLSL+N
Sbjct  22   VESSDDTNHAYTPCSDTKIQLSDGFTFGIAFASRQSFFFNSS----LQLSPCDRRLSLSN  77

Query  261  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
            +  ++A+FRPKVDEISLLT+NTSSF PDSVGGYMVAFAGRKYAARS PAFVAN +Y V+S
Sbjct  78   SNSRVALFRPKVDEISLLTINTSSFSPDSVGGYMVAFAGRKYAARSLPAFVANNTYTVTS  137

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRLQNLYWKRDGCA C G S F CLN QDCA+ TN+ +N GG+VDCSLGIQ
Sbjct  138  FTLVLEFKKGRLQNLYWKRDGCAQCSGKSNFVCLNKQDCAISTNNCKNHGGSVDCSLGIQ  197

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  198  LAFSGTDK  205



>gb|KHG09254.1| hypothetical protein F383_15505 [Gossypium arboreum]
Length=243

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 156/188 (83%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
             ESS DTNH + PC+DT VQ SDGFTFGI FA+R + F N S    +QLSPCDRRLSL+N
Sbjct  22   VESSDDTNHAYLPCSDTKVQISDGFTFGIAFASRQSFFFNSS----LQLSPCDRRLSLSN  77

Query  261  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
            A  +LA+FRPKVDEISLLT+NTSSF PD VGGYMVAFAGRKYAARS PAFVANG+Y V+S
Sbjct  78   ANSRLALFRPKVDEISLLTINTSSFTPDVVGGYMVAFAGRKYAARSRPAFVANGTYTVTS  137

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRLQNL+WKRDGCA C G S F CLN QDCA+ TN+ +N GG+VDCS+GIQ
Sbjct  138  FTLVLEFKKGRLQNLFWKRDGCAQCSGRSNFVCLNKQDCAINTNNCKNHGGSVDCSIGIQ  197

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  198  LAFSGTDK  205



>gb|KJB16527.1| hypothetical protein B456_002G234200 [Gossypium raimondii]
Length=243

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 156/188 (83%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
             ESS DTNH + PC+DT VQ SDGFTFGI FA+R + F N S    +QLSPCDRRLSL+N
Sbjct  22   VESSDDTNHAYLPCSDTKVQISDGFTFGIAFASRQSFFFNSS----LQLSPCDRRLSLSN  77

Query  261  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
            A  +LA+FRPKVDEISLLT+NTSSF PD VGGYMVAFAGRKYAARS PAFVANG+Y V+S
Sbjct  78   ANSRLALFRPKVDEISLLTINTSSFTPDVVGGYMVAFAGRKYAARSLPAFVANGTYTVTS  137

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRLQNL+WKRDGCA C G S F CLN QDCA+ TN+ +N GG+VDCS+GIQ
Sbjct  138  FTLVLEFKKGRLQNLFWKRDGCAQCSGRSNFVCLNKQDCAINTNNCKNHGGSVDCSIGIQ  197

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  198  LAFSGTDK  205



>ref|XP_009368382.1| PREDICTED: uncharacterized protein LOC103957887 [Pyrus x bretschneideri]
Length=249

 Score =   285 bits (728),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 160/185 (86%), Gaps = 4/185 (2%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--  263
            +++TN V+SPC DT +Q+SDGFTFGI FA++N+ F+N   N+  QLSPCDRRLSL++A  
Sbjct  29   AANTNSVYSPCLDTKIQRSDGFTFGIAFASKNSFFLNG--NQSHQLSPCDRRLSLSSAKS  86

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  87   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVANSTYIVTSFTL  146

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA+K +S +NRGG+VDCSLGIQL F
Sbjct  147  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIKMSSCKNRGGSVDCSLGIQLAF  206

Query  624  SGTDK  638
            SGTDK
Sbjct  207  SGTDK  211



>ref|XP_008385577.1| PREDICTED: uncharacterized protein LOC103448116 [Malus domestica]
Length=248

 Score =   283 bits (725),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 161/185 (87%), Gaps = 4/185 (2%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            +++TN V+SPC+DT +Q+SDGFTFGI F+++N+ F+N   N+  QLSPCDRRLSL+  N+
Sbjct  29   AANTNSVYSPCSDTKIQRSDGFTFGIAFSSKNSFFLNG--NQSHQLSPCDRRLSLSSANS  86

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  87   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVANSTYIVTSFTL  146

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++GRLQNLYWKRDGCA C G+S F CLN QDCA+K +S +NRGG+VDCSLGIQL F
Sbjct  147  VLEFQRGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIKMSSCKNRGGSVDCSLGIQLAF  206

Query  624  SGTDK  638
            SGTDK
Sbjct  207  SGTDK  211



>emb|CDP10582.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 163/188 (87%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
            +ESSSDTN V+SPC+D  VQ+SDGFTF I FA+RN  F N+S    +QLSPCDRRLSL++
Sbjct  24   SESSSDTNSVYSPCSDAKVQRSDGFTFSIAFASRNNFFFNNS----LQLSPCDRRLSLSS  79

Query  261  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
            +  Q+AVFRPKVDEISLL++NTS+FFPDS GGYMVAFAGRKYAARS PAFVANGSYIV+S
Sbjct  80   SNSQVAVFRPKVDEISLLSINTSNFFPDSYGGYMVAFAGRKYAARSLPAFVANGSYIVTS  139

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTL  EFKKGRLQNLYWKRDGC SC G+S F CLN QDCA++TNS +NRGGNVDCSLGIQ
Sbjct  140  FTLALEFKKGRLQNLYWKRDGCTSCSGNSNFVCLNNQDCAIRTNSCKNRGGNVDCSLGIQ  199

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  200  LAFSGTDK  207



>gb|KDP36093.1| hypothetical protein JCGZ_08737 [Jatropha curcas]
Length=246

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 154/185 (83%), Gaps = 4/185 (2%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            S +TNHV++PCAD  VQ+SDGFTF I FA+R A F N+  N  +QLSPCD RLSL+  N+
Sbjct  26   SDNTNHVYNPCADAKVQRSDGFTFAIAFASRTAFFYNN--NGSLQLSPCDSRLSLSSQNS  83

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q++VFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPDNYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
              EFKKGRLQNLYWKRDGCA C G++ F CLN QDCA++TNS +N GG VDCSLGIQL F
Sbjct  144  ALEFKKGRLQNLYWKRDGCAKCTGTNNFVCLNNQDCAIRTNSCKNHGGTVDCSLGIQLAF  203

Query  624  SGTDK  638
            SGTDK
Sbjct  204  SGTDK  208



>ref|XP_010514756.1| PREDICTED: uncharacterized protein LOC104790674 [Camelina sativa]
Length=258

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 158/184 (86%), Gaps = 6/184 (3%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  266
            S+TNH++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+Q
Sbjct  41   SNTNHIYSPCSDTKIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLTLAAMNSQ  96

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            L++FRPKVDEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  97   LSIFRPKVDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  156

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T S + RGG VDCSLGIQL FS
Sbjct  157  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNRQDCAIRTPSCKGRGGTVDCSLGIQLAFS  216

Query  627  GTDK  638
            GTDK
Sbjct  217  GTDK  220



>ref|XP_004140172.1| PREDICTED: uncharacterized protein LOC101221211 [Cucumis sativus]
 ref|XP_004168664.1| PREDICTED: uncharacterized LOC101221211 [Cucumis sativus]
 gb|KGN48055.1| hypothetical protein Csa_6G426900 [Cucumis sativus]
Length=262

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 160/187 (86%), Gaps = 8/187 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            +++TN+V+ PCADT +Q+SDGFTFGI F++R++ F N S     QLSPCDRRLSL   N+
Sbjct  42   AANTNNVYQPCADTKIQRSDGFTFGIAFSSRDSFFANQSH----QLSPCDRRLSLASLNS  97

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRP+VD+ISLL++NTS FFPD+ GGYMVAFAGRKYAARS PAFVAN ++IV+SFTL
Sbjct  98   QLAVFRPRVDQISLLSINTSDFFPDAFGGYMVAFAGRKYAARSQPAFVANSTFIVTSFTL  157

Query  444  VFEFKKGRLQNLYWKRDGCASCKGS--SGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQL  617
            V EF+KGRLQNLYWKRDGCASC G   S + CLN QDCA++T+S +NRGGNVDCSLGIQL
Sbjct  158  VLEFQKGRLQNLYWKRDGCASCSGKSRSSYVCLNNQDCAIRTSSCRNRGGNVDCSLGIQL  217

Query  618  TFSGTDK  638
            TFSGTDK
Sbjct  218  TFSGTDK  224



>ref|XP_010503072.1| PREDICTED: uncharacterized protein LOC104780270 isoform X1 [Camelina 
sativa]
Length=258

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 158/184 (86%), Gaps = 6/184 (3%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  266
            S+TNH++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+Q
Sbjct  41   SNTNHIYSPCSDTKIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLTLAAMNSQ  96

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            L++FRPKVDEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  97   LSIFRPKVDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  156

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T S + RGG VDCSLGIQL FS
Sbjct  157  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNRQDCAIRTPSCKVRGGTVDCSLGIQLAFS  216

Query  627  GTDK  638
            GTDK
Sbjct  217  GTDK  220



>ref|XP_008449601.1| PREDICTED: uncharacterized protein LOC103491438 [Cucumis melo]
Length=250

 Score =   279 bits (713),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 160/187 (86%), Gaps = 8/187 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            +++TN+V+ PCADT +Q+SDGFTFGI F++R++ F N S     QLSPCDRRLSL   N+
Sbjct  30   AANTNNVYQPCADTKIQRSDGFTFGIAFSSRDSFFSNQSH----QLSPCDRRLSLASLNS  85

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRP+VD+ISLL++NTS FFPD+ GGYMVAFAGRKYAARS PAFVAN ++IV+SFTL
Sbjct  86   QLAVFRPRVDQISLLSINTSDFFPDAFGGYMVAFAGRKYAARSQPAFVANNTFIVTSFTL  145

Query  444  VFEFKKGRLQNLYWKRDGCASCKGS--SGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQL  617
            V EF+KGRLQNLYWKRDGCASC G   S + CLN QDCA++T+S +NRGGNVDCSLGIQL
Sbjct  146  VLEFQKGRLQNLYWKRDGCASCSGKSRSSYVCLNNQDCAIRTSSCRNRGGNVDCSLGIQL  205

Query  618  TFSGTDK  638
            TFSGTDK
Sbjct  206  TFSGTDK  212



>ref|XP_004249401.2| PREDICTED: uncharacterized protein LOC101246776 [Solanum lycopersicum]
Length=243

 Score =   278 bits (712),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 160/183 (87%), Gaps = 6/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL--  269
            DTNHV+SPCAD  VQ+SDGF+FGI F++R + F+N S    VQLSPCD+RLSL+++    
Sbjct  27   DTNHVYSPCADAKVQRSDGFSFGIAFSSRTSFFVNSS----VQLSPCDKRLSLSSSNSQL  82

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+NTS+FFPDS GGYMVAFAGRKYAARS PAFVAN ++ V+SFTLV 
Sbjct  83   AVFRPKVDEISLLTINTSNFFPDSYGGYMVAFAGRKYAARSLPAFVANSTFTVTSFTLVH  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EFKKGRL+NLYWKRDGC+SC G+S F CLNGQDCA++TN+ +NRGGNVDCSLGIQLTFSG
Sbjct  143  EFKKGRLENLYWKRDGCSSCSGNSNFVCLNGQDCAIRTNNCKNRGGNVDCSLGIQLTFSG  202

Query  630  TDK  638
            TDK
Sbjct  203  TDK  205



>ref|XP_010058958.1| PREDICTED: uncharacterized protein LOC104446855 [Eucalyptus grandis]
 gb|KCW90433.1| hypothetical protein EUGRSUZ_A02567 [Eucalyptus grandis]
Length=253

 Score =   279 bits (713),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 157/187 (84%), Gaps = 6/187 (3%)
 Frame = +3

Query  84   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA  263
            ES++DTN V+SPCADTTVQ+SDGFTFGI FA R + F N S    ++LSPCDRRLSL++A
Sbjct  33   ESAADTNRVYSPCADTTVQRSDGFTFGIAFAPRLSFFHNGS----LELSPCDRRLSLSSA  88

Query  264  --QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  437
              Q+A FRPKVDEISLLT+NTSSF P + GGYMVAFAGRKYAARS P+FVAN +Y V+SF
Sbjct  89   TSQVATFRPKVDEISLLTINTSSFSPANYGGYMVAFAGRKYAARSLPSFVANSTYTVTSF  148

Query  438  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQL  617
            TLV EFKKGRLQNLYWKRDGCASC G S F CLN QDCA+KT++ +N GG VDCSLGIQL
Sbjct  149  TLVLEFKKGRLQNLYWKRDGCASCSGKSNFVCLNNQDCAIKTSNCKNHGGAVDCSLGIQL  208

Query  618  TFSGTDK  638
             FSGTDK
Sbjct  209  AFSGTDK  215



>ref|XP_009121178.1| PREDICTED: uncharacterized protein LOC103846006 [Brassica rapa]
 ref|XP_009123290.1| PREDICTED: uncharacterized protein LOC103848053 [Brassica rapa]
Length=274

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 158/183 (86%), Gaps = 6/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            +TN+V+SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+QL
Sbjct  58   NTNNVYSPCSDTRIQRSDGFTFGIAFSSRASFFLNQT----VLLSPCDRRLTLAAMNSQL  113

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            ++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARSPPAF+AN +Y V+SFTLV 
Sbjct  114  SIFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSPPAFIANSTYTVTSFTLVM  173

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KGRLQNL+WKRDGCASCKG+S F CLN QDCA++T S + RGG VDCSLGIQL FSG
Sbjct  174  EFQKGRLQNLFWKRDGCASCKGNSNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFSG  233

Query  630  TDK  638
            TDK
Sbjct  234  TDK  236



>ref|XP_010496864.1| PREDICTED: uncharacterized protein LOC104773893 [Camelina sativa]
Length=255

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 158/184 (86%), Gaps = 6/184 (3%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  266
            S+TNH++SPC+DT +Q+SDGFTFGI F++R++ F+N +    V LSPCDRRL+L   N+Q
Sbjct  38   SNTNHIYSPCSDTRIQRSDGFTFGIAFSSRSSFFLNQT----VLLSPCDRRLTLAAMNSQ  93

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            L++FRPKVDEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  94   LSIFRPKVDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  153

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T S +  GG VDCSLGIQL FS
Sbjct  154  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNRQDCAIRTPSCKGHGGTVDCSLGIQLAFS  213

Query  627  GTDK  638
            GTDK
Sbjct  214  GTDK  217



>ref|XP_006291737.1| hypothetical protein CARUB_v10017907mg [Capsella rubella]
 gb|EOA24635.1| hypothetical protein CARUB_v10017907mg [Capsella rubella]
Length=250

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 158/184 (86%), Gaps = 6/184 (3%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  266
            ++TNH++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+Q
Sbjct  33   TNTNHIYSPCSDTRIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLTLAAMNSQ  88

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            L++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  89   LSLFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  148

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T S + RGG VDCSLGIQL FS
Sbjct  149  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFS  208

Query  627  GTDK  638
            GTDK
Sbjct  209  GTDK  212



>ref|XP_003538086.1| PREDICTED: uncharacterized protein LOC100814491 [Glycine max]
 gb|KHN30243.1| hypothetical protein glysoja_045628 [Glycine soja]
Length=240

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 158/184 (86%), Gaps = 4/184 (2%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQ  266
            ++TN+V+ PCAD  +Q+SDGFTFGI F++R++ F N  +N+ +QLSPCDRRLSL+  N+Q
Sbjct  21   TNTNNVYQPCADARIQRSDGFTFGIAFSSRDSFFYN--QNQSLQLSPCDRRLSLSFSNSQ  78

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRP+VDEISLLT+NTSSFFPDS GGYMVAFAGRKYAARSP AFVAN +Y V+SFTLV
Sbjct  79   LALFRPRVDEISLLTINTSSFFPDSYGGYMVAFAGRKYAARSPLAFVANSTYTVTSFTLV  138

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF++GRLQN YWKRDGC+SCK  S F CLN QDCA++T+S + RGG VDCSLGIQL FS
Sbjct  139  LEFQRGRLQNFYWKRDGCSSCKEKSNFICLNKQDCAIRTSSCKGRGGAVDCSLGIQLAFS  198

Query  627  GTDK  638
            GTD+
Sbjct  199  GTDR  202



>ref|XP_011046438.1| PREDICTED: uncharacterized protein LOC105141047 [Populus euphratica]
Length=246

 Score =   277 bits (708),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 153/185 (83%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            S +TNHV+SPCADTTVQ SDGFTF I F++RNA F N +    +QLSPCD RLSL   N+
Sbjct  28   SDNTNHVYSPCADTTVQVSDGFTFSIAFSSRNAFFFNST----LQLSPCDSRLSLTSQNS  83

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q++VFRPKVDEISLLT+NTSSF P   GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPGDYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+S +  GG+VDCSLGIQL F
Sbjct  144  VLEFKKGRLQNLYWKRDGCAKCSGNSKFVCLNNQDCAIRTSSCKKNGGSVDCSLGIQLAF  203

Query  624  SGTDK  638
            SGTDK
Sbjct  204  SGTDK  208



>ref|XP_011042566.1| PREDICTED: uncharacterized protein LOC105138225 [Populus euphratica]
 ref|XP_011042567.1| PREDICTED: uncharacterized protein LOC105138225 [Populus euphratica]
 ref|XP_011042568.1| PREDICTED: uncharacterized protein LOC105138225 [Populus euphratica]
Length=244

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 153/185 (83%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            S DTN VFSPC DTTVQ+SDGFTF I F++R + F N S     QLSPCDRRL+L   N+
Sbjct  26   SEDTNKVFSPCLDTTVQESDGFTFAIAFSSRTSFFFNSSH----QLSPCDRRLALTGQNS  81

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q++VFRPKVDEISLLT+NTSSF+P++ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  82   QISVFRPKVDEISLLTINTSSFYPENYGGYMVAFAGRKYAARSLPAFVANNTYTVTSFTL  141

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T   ++ GG+VDCSLGIQL F
Sbjct  142  VLEFKKGRLQNLYWKRDGCAKCSGNSNFVCLNNQDCAIRTALCKSNGGSVDCSLGIQLAF  201

Query  624  SGTDK  638
            SGTDK
Sbjct  202  SGTDK  206



>ref|XP_011035616.1| PREDICTED: uncharacterized protein LOC105133355 isoform X2 [Populus 
euphratica]
Length=246

 Score =   276 bits (706),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 153/185 (83%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            S +TNHV+SPCADTTVQ SDGFTF I F++R A F N +    +QLSPCD RLSL   N+
Sbjct  28   SDNTNHVYSPCADTTVQVSDGFTFSIAFSSRTAFFFNST----LQLSPCDSRLSLTSQNS  83

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q++VFRPKVDEISLLT+NTSSF P + GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPQNYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+S +  GG+VDCSLGIQL F
Sbjct  144  VLEFKKGRLQNLYWKRDGCAKCSGNSKFVCLNNQDCAIRTSSCKKNGGSVDCSLGIQLAF  203

Query  624  SGTDK  638
            SGTDK
Sbjct  204  SGTDK  208



>emb|CDX87939.1| BnaC03g54570D [Brassica napus]
Length=243

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 157/182 (86%), Gaps = 6/182 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            +TN+V+SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+QL
Sbjct  27   NTNNVYSPCSDTRIQRSDGFTFGIAFSSRASFFLNQT----VLLSPCDRRLTLAAMNSQL  82

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            ++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARSPPAF+AN +Y V+SFTLV 
Sbjct  83   SIFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSPPAFIANSTYTVTSFTLVM  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KGRLQNL+WKRDGCASCKG+S F CLN QDCA++T S + RGG VDCSLGIQL FSG
Sbjct  143  EFQKGRLQNLFWKRDGCASCKGNSNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFSG  202

Query  630  TD  635
            TD
Sbjct  203  TD  204



>ref|XP_011077792.1| PREDICTED: uncharacterized protein LOC105161704 [Sesamum indicum]
Length=243

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 6/184 (3%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQ  266
            SD+N V+SPCAD ++Q+SDGFTFGI FAAR A F N+S    VQLSPCD RLSL+  N+Q
Sbjct  26   SDSNDVYSPCADASIQRSDGFTFGIAFAARTAFFFNNS----VQLSPCDHRLSLSSANSQ  81

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            +AVFRPKVDEISLLT+NTS+FFPDSVGGYMVAFAGR+YAARS PAFVAN +Y ++SFTLV
Sbjct  82   VAVFRPKVDEISLLTINTSNFFPDSVGGYMVAFAGRRYAARSIPAFVANNTYTITSFTLV  141

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EFKKGRLQNLYWKRDGCASC G S F CLN QDCA++TN+ +NRGG+VDCS+GIQL FS
Sbjct  142  HEFKKGRLQNLYWKRDGCASCSGKSNFVCLNNQDCAIRTNNCKNRGGSVDCSIGIQLAFS  201

Query  627  GTDK  638
            GTDK
Sbjct  202  GTDK  205



>ref|XP_002322773.1| hypothetical protein POPTR_0016s06840g [Populus trichocarpa]
 gb|EEF04534.1| hypothetical protein POPTR_0016s06840g [Populus trichocarpa]
Length=244

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 154/185 (83%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            S DTN VFSPC DTTVQ SDGFTF I F++R + F N S    +QLSPCDRRL+L   N+
Sbjct  26   SEDTNKVFSPCLDTTVQVSDGFTFAIAFSSRTSFFFNSS----LQLSPCDRRLALTGQNS  81

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q++VFRPKVDEISLLT+NTSSF+P++ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  82   QISVFRPKVDEISLLTINTSSFYPENYGGYMVAFAGRKYAARSLPAFVANNTYSVTSFTL  141

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+  ++ GG+VDCSLGIQL F
Sbjct  142  VLEFKKGRLQNLYWKRDGCAKCSGNSNFVCLNNQDCAIRTSLCKSNGGSVDCSLGIQLAF  201

Query  624  SGTDK  638
            SGTDK
Sbjct  202  SGTDK  206



>emb|CDY55301.1| BnaA06g38910D [Brassica napus]
Length=239

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 158/183 (86%), Gaps = 6/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            +TN+V+SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+QL
Sbjct  23   NTNNVYSPCSDTRIQRSDGFTFGIAFSSRASFFLNQT----VLLSPCDRRLTLAAMNSQL  78

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            ++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARSPPAF+AN ++ V+SFTLV 
Sbjct  79   SLFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSPPAFIANSTFTVTSFTLVM  138

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KGRLQNL+WKRDGCASCKG+S F CLN QDCA++T S + RGG VDCSLGIQL FSG
Sbjct  139  EFQKGRLQNLFWKRDGCASCKGNSNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFSG  198

Query  630  TDK  638
            TDK
Sbjct  199  TDK  201



>gb|KHN21200.1| hypothetical protein glysoja_006679 [Glycine soja]
Length=233

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 157/184 (85%), Gaps = 4/184 (2%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQ  266
            ++TN V+ PC+D  +Q+SDGFTFGI F++R++ F N  +N+ +QLSPCDRRLSL+  NAQ
Sbjct  14   TNTNSVYHPCSDARIQRSDGFTFGIAFSSRDSFFYN--QNQSLQLSPCDRRLSLSSSNAQ  71

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRP+VDEISLLT+NTSSFFPD+ GGYMVAFAG+KYAARSP AFVAN +Y V+SFTLV
Sbjct  72   LALFRPRVDEISLLTINTSSFFPDNYGGYMVAFAGKKYAARSPLAFVANSTYTVTSFTLV  131

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF++GRL NLYWKRDGC+SCKG S   CLN QDCA++T+S + RGG VDCSLGIQL FS
Sbjct  132  LEFQRGRLHNLYWKRDGCSSCKGKSNLVCLNKQDCAIRTSSCKGRGGAVDCSLGIQLAFS  191

Query  627  GTDK  638
            GTD+
Sbjct  192  GTDR  195



>ref|NP_001240927.1| uncharacterized protein LOC100818051 precursor [Glycine max]
 gb|ACU22975.1| unknown [Glycine max]
Length=242

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 157/184 (85%), Gaps = 4/184 (2%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQ  266
            ++TN V+ PC+D  +Q+SDGFTFGI F++R++ F N  +N+ +QLSPCDRRLSL+  NAQ
Sbjct  23   TNTNSVYHPCSDARIQRSDGFTFGIAFSSRDSFFYN--QNQSLQLSPCDRRLSLSSSNAQ  80

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRP+VDEISLLT+NTSSFFPD+ GGYMVAFAG+KYAARSP AFVAN +Y V+SFTLV
Sbjct  81   LALFRPRVDEISLLTINTSSFFPDNYGGYMVAFAGKKYAARSPLAFVANSTYTVTSFTLV  140

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF++GRL NLYWKRDGC+SCKG S   CLN QDCA++T+S + RGG VDCSLGIQL FS
Sbjct  141  LEFQRGRLHNLYWKRDGCSSCKGKSNLVCLNKQDCAIRTSSCKGRGGAVDCSLGIQLAFS  200

Query  627  GTDK  638
            GTD+
Sbjct  201  GTDR  204



>ref|XP_011035615.1| PREDICTED: uncharacterized protein LOC105133355 isoform X1 [Populus 
euphratica]
Length=246

 Score =   275 bits (702),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            S +TNHV+SPCADTTVQ SDGFTF I F++R A F N +    +QLSPCD RLSL   N+
Sbjct  28   SDNTNHVYSPCADTTVQVSDGFTFSIAFSSRTAFFFNST----LQLSPCDSRLSLTSQNS  83

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q++VFRPKVDEISLLT+NTSSF P   GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPGDYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+S +  GG+VDCSLGIQL F
Sbjct  144  VLEFKKGRLQNLYWKRDGCAKCSGNSKFVCLNNQDCAIRTSSCKKNGGSVDCSLGIQLAF  203

Query  624  SGTDK  638
            SGTDK
Sbjct  204  SGTDK  208



>ref|XP_010535718.1| PREDICTED: uncharacterized protein LOC104810937 [Tarenaya hassleriana]
Length=250

 Score =   274 bits (701),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 155/183 (85%), Gaps = 6/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  269
            +TN V+SPC+D  +Q+SDGF+FGI F++R + F+N++    V LSPCDRRL L+  NAQ 
Sbjct  34   NTNGVYSPCSDARIQRSDGFSFGIAFSSRQSFFLNET----VLLSPCDRRLGLSAMNAQF  89

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            A+FRPKVDEISLL+VNTS FFPD+ GGYMVAFAGRKYAARSPPAFVAN +YIV+SFTLVF
Sbjct  90   ALFRPKVDEISLLSVNTSDFFPDNYGGYMVAFAGRKYAARSPPAFVANSTYIVTSFTLVF  149

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KGRL NLYWKRDGC+SCKG+  F CLN QDCA++T S + RGG VDCSLGIQL FSG
Sbjct  150  EFQKGRLNNLYWKRDGCSSCKGNPSFVCLNNQDCAIRTPSCKGRGGPVDCSLGIQLAFSG  209

Query  630  TDK  638
            TDK
Sbjct  210  TDK  212



>ref|NP_190001.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38812.1| unknown protein [Arabidopsis thaliana]
 gb|AAN12895.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77869.1| uncharacterized protein AT3G44150 [Arabidopsis thaliana]
Length=246

 Score =   273 bits (699),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 156/185 (84%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            S +TN ++SPC+DT +Q+SDGFTFGI F++R + FIN +    V LSPCDRRLSL   N+
Sbjct  28   SGNTNTIYSPCSDTRIQRSDGFTFGIAFSSRPSFFINQT----VLLSPCDRRLSLAAMNS  83

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q +VFRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTL
Sbjct  84   QFSVFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTL  143

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T S + RGG VDCSLGIQL F
Sbjct  144  VMEFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGAVDCSLGIQLAF  203

Query  624  SGTDK  638
            SGTDK
Sbjct  204  SGTDK  208



>gb|KFK33866.1| hypothetical protein AALP_AA5G070300 [Arabis alpina]
Length=243

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 156/188 (83%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  257
            A +  +TN+V+SPC+DT +Q+SDGFTFGI F++R + F+N +    + LSPCD RLSL  
Sbjct  22   ALTGGNTNNVYSPCSDTKIQRSDGFTFGIAFSSRPSFFLNQT----LLLSPCDHRLSLAA  77

Query  258  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             N+Q ++FRPK+DEISLL++NTSSFFPDS GGYMVAFAGRKYAARSPPAF+AN +YIV+S
Sbjct  78   INSQFSLFRPKIDEISLLSINTSSFFPDSYGGYMVAFAGRKYAARSPPAFIANSTYIVTS  137

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EF+KGRLQN +WKRDGCASCKG+  F CLN QDCA+ T S + RGG VDCSLGIQ
Sbjct  138  FTLVMEFQKGRLQNFFWKRDGCASCKGNPNFVCLNKQDCAISTPSCKGRGGTVDCSLGIQ  197

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  198  LAFSGTDK  205



>ref|XP_002875644.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51903.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 157/183 (86%), Gaps = 6/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            +TN+++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRLSL   N+Q 
Sbjct  36   NTNNIYSPCSDTRIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLSLAAMNSQF  91

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            ++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV 
Sbjct  92   SLFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLVM  151

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T S + RGG+VDCSLGIQL FSG
Sbjct  152  EFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGSVDCSLGIQLAFSG  211

Query  630  TDK  638
            TDK
Sbjct  212  TDK  214



>gb|KHF98050.1| hypothetical protein F383_37453 [Gossypium arboreum]
Length=239

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 154/188 (82%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
             ESS D N+ ++PC+DTTVQ SDGFTFGI F +R + F + S     QLSPCDRRLSL+N
Sbjct  18   VESSDDMNNAYTPCSDTTVQLSDGFTFGIAFGSRQSFFFDSS----FQLSPCDRRLSLSN  73

Query  261  AQ--LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
            +   +A+FRPKVDEISLLT+N SSF PDSVGGYMVAF+GRKYAARS PAFVAN SY V+S
Sbjct  74   SNSPVALFRPKVDEISLLTINVSSFSPDSVGGYMVAFSGRKYAARSLPAFVANSSYTVTS  133

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EFKKGRLQNL+WKRDGCA C G+S F CLN Q+CA+ T+S +N GG+VDCSLGIQ
Sbjct  134  FTLVLEFKKGRLQNLFWKRDGCAQCSGNSNFVCLNKQNCAINTSSCKNHGGSVDCSLGIQ  193

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  194  LAFSGTDK  201



>ref|XP_006404508.1| hypothetical protein EUTSA_v10010660mg [Eutrema salsugineum]
 gb|ESQ45961.1| hypothetical protein EUTSA_v10010660mg [Eutrema salsugineum]
Length=251

 Score =   271 bits (694),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 153/179 (85%), Gaps = 7/179 (4%)
 Frame = +3

Query  108  VFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQLAVFR  281
            V+SPC+DT +Q+SDGFTFGI F++R + F+N +      LSPCDRRLSL   N+QL+VFR
Sbjct  40   VYSPCSDTRIQRSDGFTFGIAFSSRPSFFLNQTV-----LSPCDRRLSLAAMNSQLSVFR  94

Query  282  PKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKK  461
            PK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARSPPAF+AN ++ V+SFTLV EF+K
Sbjct  95   PKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSPPAFIANTTFTVTSFTLVMEFQK  154

Query  462  GRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTDK  638
            GRLQNLYWKRDGCASCKG+S F CLN QDCA++T S + RGG VDCSLGIQL FSGTDK
Sbjct  155  GRLQNLYWKRDGCASCKGNSNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFSGTDK  213



>ref|XP_002309260.1| hypothetical protein POPTR_0006s21620g [Populus trichocarpa]
 gb|EEE92783.1| hypothetical protein POPTR_0006s21620g [Populus trichocarpa]
Length=246

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 150/185 (81%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            S +TNHV+SPCADTTVQ SDGFTF I F++  A F N +    +QLSPCD RLSL   N+
Sbjct  28   SDNTNHVYSPCADTTVQVSDGFTFSIAFSSSKAFFFNST----LQLSPCDSRLSLTSQNS  83

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q++VFRPKVDEISLLT+NTSSF P   GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPGDFGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+S    GG+VDCSLGIQL F
Sbjct  144  VLEFKKGRLQNLYWKRDGCAKCSGNSKFVCLNNQDCAIRTSSCIKNGGSVDCSLGIQLAF  203

Query  624  SGTDK  638
            SGTDK
Sbjct  204  SGTDK  208



>ref|XP_010247701.1| PREDICTED: uncharacterized protein LOC104590673 [Nelumbo nucifera]
Length=240

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 156/186 (84%), Gaps = 8/186 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--  263
            +SDTN  F PC+DT +Q+SDGFTFGI FA+R++ F N S+    QLSPCDRRL L+++  
Sbjct  22   ASDTNRAFQPCSDTKIQRSDGFTFGIAFASRSSFFYNSSQ----QLSPCDRRLGLSSSSS  77

Query  264  QLAVFRPKVDEISLLTVNTSS-FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            QLAVFRPKVDEISLLT+NT+S FFP++ G YMVAFAGRKYAARSPPAFVAN +Y+V+SFT
Sbjct  78   QLAVFRPKVDEISLLTINTTSNFFPENYG-YMVAFAGRKYAARSPPAFVANSTYMVTSFT  136

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF+KGRLQNLYWKRDGCASC G S F CLN QDCA+ TNS + RGG+ DCSLGIQL 
Sbjct  137  LVLEFQKGRLQNLYWKRDGCASCSGKSNFVCLNKQDCAIGTNSCKGRGGSADCSLGIQLA  196

Query  621  FSGTDK  638
            FSGTDK
Sbjct  197  FSGTDK  202



>ref|XP_010106982.1| hypothetical protein L484_016911 [Morus notabilis]
 gb|EXC12980.1| hypothetical protein L484_016911 [Morus notabilis]
Length=246

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 155/185 (84%), Gaps = 8/185 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN V+SPC+D+ V+ SDGFTFGI FA+R+ +F N +K+   QLSPCD RL L  +NAQ+
Sbjct  28   DTNRVYSPCSDSKVEISDGFTFGITFASRD-SFFNGNKS---QLSPCDSRLGLRNSNAQI  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+NTSSFFP++ GGYMVAFAGRKYAARSP AFVAN +Y VSSFTLV 
Sbjct  84   AVFRPKVDEISLLTINTSSFFPENYGGYMVAFAGRKYAARSPLAFVANNTYTVSSFTLVL  143

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNR--GGNVDCSLGIQLTF  623
            EFKKGRLQNL+WKRDGCA C+  S F CLN QDCA+KT+S +N   GG+VDCSLGIQL F
Sbjct  144  EFKKGRLQNLFWKRDGCAKCQSGSSFVCLNKQDCAIKTSSCKNHASGGSVDCSLGIQLAF  203

Query  624  SGTDK  638
            SGTDK
Sbjct  204  SGTDK  208



>ref|XP_004497641.1| PREDICTED: uncharacterized protein LOC101499989 isoform X1 [Cicer 
arietinum]
Length=243

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 152/183 (83%), Gaps = 5/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QL  269
            DTN+VFSPC DT VQ+SDGFTFGI FA ++  F N+  N  VQLSPCD RLSL+N+  Q+
Sbjct  26   DTNNVFSPCTDTRVQRSDGFTFGIAFAPKDKFFYNN--NNSVQLSPCDTRLSLSNSNSQI  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            ++FRPKVDEISLLTVN+SSF  DS G YMVAFAGRKYAARSPPAFVANGSY V+SFTLV 
Sbjct  84   SLFRPKVDEISLLTVNSSSFVADSYG-YMVAFAGRKYAARSPPAFVANGSYTVTSFTLVL  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EFKKGRLQNLYWKRDGCA C  ++   CLN QDCA++T+S ++ GG VDCSLGIQL FSG
Sbjct  143  EFKKGRLQNLYWKRDGCAKCPKNTKAVCLNNQDCALQTSSCKSHGGPVDCSLGIQLAFSG  202

Query  630  TDK  638
            TDK
Sbjct  203  TDK  205



>ref|XP_007202487.1| hypothetical protein PRUPE_ppa010561mg [Prunus persica]
 gb|EMJ03686.1| hypothetical protein PRUPE_ppa010561mg [Prunus persica]
Length=245

 Score =   266 bits (681),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 152/184 (83%), Gaps = 7/184 (4%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQ  266
            S+ NHV+SPCADT V++SDGFTFGI FA+R++ F    +N  VQLSPCD RLSL+N  +Q
Sbjct  29   SNNNHVYSPCADTKVERSDGFTFGIAFASRDSFF----RNGSVQLSPCDSRLSLSNGNSQ  84

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            ++VFRPKVDEISLL+VN+SSF  DS G YMVAFAGRKYAARS PAFVAN +Y V+SFTLV
Sbjct  85   ISVFRPKVDEISLLSVNSSSFTADSYG-YMVAFAGRKYAARSIPAFVANATYTVTSFTLV  143

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF KGRLQNLYWKRDGC+ C GS+G  CLN QDCA KT+S +  GG+VDCSLGIQL FS
Sbjct  144  LEFNKGRLQNLYWKRDGCSKCSGSTGLVCLNNQDCAFKTSSCKTHGGSVDCSLGIQLAFS  203

Query  627  GTDK  638
            GTDK
Sbjct  204  GTDK  207



>ref|XP_002524077.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38287.1| conserved hypothetical protein [Ricinus communis]
Length=243

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 161/207 (78%), Gaps = 4/207 (2%)
 Frame = +3

Query  24   MARPSAilsllifptlfllAESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFIND  203
            MA  +AI+ +++     +L   S D NHV+SPC DT VQ+ DGFTF I FAARNA F N+
Sbjct  1    MAATTAIILVVVALASSVLIVESGDNNHVYSPCGDTKVQREDGFTFAIAFAARNAFFYNN  60

Query  204  SKNKDVQLSPCDRRLSLNNAQLA--VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRK  377
              N  +QLSPCD RLSL++      VFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRK
Sbjct  61   --NNSLQLSPCDSRLSLSSQSSQISVFRPKVDEISLLTINTSSFSPDNYGGYMVAFAGRK  118

Query  378  YAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAM  557
            YAARS PAFVAN +Y V+SFTLV EFKKGRLQNLYWKRDGC+ C GS+ F CLN QDCA+
Sbjct  119  YAARSLPAFVANTTYTVTSFTLVLEFKKGRLQNLYWKRDGCSKCSGSNNFVCLNNQDCAI  178

Query  558  KTNSXQNRGGNVDCSLGIQLTFSGTDK  638
            +T+S +N GG VDCSLGIQL FSGTDK
Sbjct  179  RTSSCKNHGGTVDCSLGIQLAFSGTDK  205



>ref|XP_007145779.1| hypothetical protein PHAVU_007G267000g [Phaseolus vulgaris]
 gb|ESW17773.1| hypothetical protein PHAVU_007G267000g [Phaseolus vulgaris]
Length=243

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 152/183 (83%), Gaps = 5/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QL  269
            D N VFSPC DT VQ+SDGFTFGIVFA ++  F+N+  N  VQLSPCD RLSL+N+  Q+
Sbjct  26   DNNRVFSPCTDTQVQRSDGFTFGIVFAPKDKFFLNN--NSSVQLSPCDTRLSLSNSNYQI  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            +VFRPKVDEISLLTVN+SSF  D+ G YMVAFAGRKYAARSPPAFVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLTVNSSSFTADTYG-YMVAFAGRKYAARSPPAFVANGTYTVTSFTLVL  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EFKKGRLQNLYWKRDGCA C  +S   CLN QDCA++T+S ++ GG VDCS+GIQL FSG
Sbjct  143  EFKKGRLQNLYWKRDGCAKCSSNSKAVCLNNQDCALQTSSCKSHGGTVDCSIGIQLAFSG  202

Query  630  TDK  638
            TDK
Sbjct  203  TDK  205



>ref|XP_004303412.1| PREDICTED: uncharacterized protein LOC101306356 [Fragaria vesca 
subsp. vesca]
Length=245

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 149/183 (81%), Gaps = 3/183 (2%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  269
            D N V+SPC+DT V +SDGF+FGI FA+++  F+ +  N   QLSPCD RLSL+  N+Q+
Sbjct  26   DNNRVYSPCSDTKVARSDGFSFGIAFASKDV-FLRNGANSTSQLSPCDTRLSLSSANSQI  84

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLL+VN+SSF PD+ GGYMVAFAG KYAARS  AFVAN +Y V+SFTLV 
Sbjct  85   AVFRPKVDEISLLSVNSSSFAPDNYGGYMVAFAGHKYAARSTAAFVANSTYTVTSFTLVL  144

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNLYWKRDGCA C G+S F CLN QDCA+KTNS ++ GG VDCSLGIQL FSG
Sbjct  145  EFTKGRLQNLYWKRDGCAKCSGNSSFVCLNNQDCAIKTNSCKSHGGTVDCSLGIQLAFSG  204

Query  630  TDK  638
            TDK
Sbjct  205  TDK  207



>ref|XP_006481617.1| PREDICTED: uncharacterized protein LOC102630770 [Citrus sinensis]
Length=239

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--  263
            SSD NH++SPC DT V++SDGFTF I FA+R++ F+N+S+    QLSPCDRRLSL+++  
Sbjct  21   SSDNNHMYSPCGDTKVERSDGFTFAIAFASRSSFFLNNSQ----QLSPCDRRLSLSSSTS  76

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q+AVFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  77   QIAVFRPKVDEISLLTINTSSFSPDNYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  136

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
              EFKKGRLQNLYWKRDGC+ C G+S F CLN QDCA+++ S +N GG+VDCSLGIQL F
Sbjct  137  ALEFKKGRLQNLYWKRDGCSKCSGNSNFVCLNNQDCAIRSTSCKNHGGSVDCSLGIQLAF  196

Query  624  SGTDK  638
            SGTDK
Sbjct  197  SGTDK  201



>ref|XP_006430044.1| hypothetical protein CICLE_v10012616mg [Citrus clementina]
 gb|ESR43284.1| hypothetical protein CICLE_v10012616mg [Citrus clementina]
 gb|KDO70650.1| hypothetical protein CISIN_1g026374mg [Citrus sinensis]
Length=239

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--  263
            SSD NH++SPC DT V++SDGFTF I FA+R++ F+N+S+    QLSPCDRRLSL+++  
Sbjct  21   SSDNNHMYSPCGDTKVERSDGFTFAIAFASRSSFFLNNSQ----QLSPCDRRLSLSSSTS  76

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q+AVFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  77   QIAVFRPKVDEISLLTINTSSFSPDNYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  136

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
              EFKKGRLQNLYWKRDGC+ C G+S F CLN QDCA+++ S +N GG+VDCSLGIQL F
Sbjct  137  ALEFKKGRLQNLYWKRDGCSKCSGNSNFVCLNNQDCAIRSTSCKNHGGSVDCSLGIQLAF  196

Query  624  SGTDK  638
            SGTDK
Sbjct  197  SGTDK  201



>ref|XP_004497642.1| PREDICTED: uncharacterized protein LOC101499989 isoform X2 [Cicer 
arietinum]
Length=241

 Score =   263 bits (672),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 152/183 (83%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QL  269
            DTN+VFSPC DT VQ+SDGFTFGI FA ++  F N+  N  VQLSPCD RLSL+N+  Q+
Sbjct  26   DTNNVFSPCTDTRVQRSDGFTFGIAFAPKDKFFYNN--NNSVQLSPCDTRLSLSNSNSQI  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            ++FRPKVDEISLLTVN+SSF  DS G YMVAFAGRKYAARSPPAFVANGSY V+SFTLV 
Sbjct  84   SLFRPKVDEISLLTVNSSSF--DSYG-YMVAFAGRKYAARSPPAFVANGSYTVTSFTLVL  140

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EFKKGRLQNLYWKRDGCA C  ++   CLN QDCA++T+S ++ GG VDCSLGIQL FSG
Sbjct  141  EFKKGRLQNLYWKRDGCAKCPKNTKAVCLNNQDCALQTSSCKSHGGPVDCSLGIQLAFSG  200

Query  630  TDK  638
            TDK
Sbjct  201  TDK  203



>ref|XP_007132505.1| hypothetical protein PHAVU_011G099900g [Phaseolus vulgaris]
 gb|ESW04499.1| hypothetical protein PHAVU_011G099900g [Phaseolus vulgaris]
Length=239

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 156/185 (84%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  269
            +++TN V+ PCAD+ +Q+SDGFTFGI F++R++ F N S    +QLSPCD RLSL+++  
Sbjct  21   ATNTNSVYQPCADSKIQRSDGFTFGIAFSSRDSFFFNQS----LQLSPCDHRLSLSSSNS  76

Query  270  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
             +  FRPKVDEISLLT+NTSSFFPD+ GGYMVAFAGRKYAARSP AFVAN +Y V+SFTL
Sbjct  77   QLALFRPKVDEISLLTINTSSFFPDTYGGYMVAFAGRKYAARSPLAFVANSTYTVTSFTL  136

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KGRLQNLYWKRDGC+SCKG+S F CLN QDCA++T+S + RGG VDCSLGIQL F
Sbjct  137  VLEFQKGRLQNLYWKRDGCSSCKGNSNFVCLNKQDCAIRTSSCKGRGGAVDCSLGIQLAF  196

Query  624  SGTDK  638
            SGTDK
Sbjct  197  SGTDK  201



>ref|XP_007015648.1| Uncharacterized protein TCM_041214 [Theobroma cacao]
 gb|EOY33267.1| Uncharacterized protein TCM_041214 [Theobroma cacao]
Length=247

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 154/187 (82%), Gaps = 6/187 (3%)
 Frame = +3

Query  84   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA  263
            ++S++T  V+ PC+DT VQ SD FTFGI F++R++   N S     QLSPCDRRLSL++ 
Sbjct  27   KASTNTKGVYQPCSDTKVQISDEFTFGIAFSSRDSFLFNQSH----QLSPCDRRLSLSSL  82

Query  264  QL--AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  437
                AVFRPK+DEISLLT+NTSSFFPDS GGYMVAFAGRKYAARS PAFVAN +Y V+SF
Sbjct  83   NSQLAVFRPKLDEISLLTINTSSFFPDSYGGYMVAFAGRKYAARSIPAFVANSTYTVTSF  142

Query  438  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQL  617
            TLV EFKKGRLQNL+WKRDGCASC G+S F CLN QDCA+KT+  +NRGG+VDCSLGIQL
Sbjct  143  TLVLEFKKGRLQNLFWKRDGCASCAGNSNFVCLNKQDCAIKTSDCKNRGGSVDCSLGIQL  202

Query  618  TFSGTDK  638
             FSGTDK
Sbjct  203  AFSGTDK  209



>ref|XP_009336402.1| PREDICTED: uncharacterized protein LOC103928990 [Pyrus x bretschneideri]
Length=230

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 156/185 (84%), Gaps = 4/185 (2%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  269
            +S+TN V++PCADT +Q+SDGFTFGI F+++ +  +N   N+  QLSPCDRRLSL+++  
Sbjct  10   ASNTNSVYNPCADTKIQRSDGFTFGIAFSSKTSFTLNG--NQSHQLSPCDRRLSLSSSNS  67

Query  270  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
             +  FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  68   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVANSTYIVTSFTL  127

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA++T+  +NRGG+VDCSLGIQL F
Sbjct  128  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIETSGCKNRGGSVDCSLGIQLAF  187

Query  624  SGTDK  638
            SGTDK
Sbjct  188  SGTDK  192



>ref|XP_009336403.1| PREDICTED: uncharacterized protein LOC103928991 [Pyrus x bretschneideri]
Length=249

 Score =   261 bits (667),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 156/185 (84%), Gaps = 4/185 (2%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  269
            +S+TN V++PCADT +Q+SDGFTFGI F+++ +  +N   N+  QLSPCDRRLSL+++  
Sbjct  29   ASNTNSVYNPCADTKIQRSDGFTFGIAFSSKTSFTLNG--NQSHQLSPCDRRLSLSSSNS  86

Query  270  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
             +  FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  87   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVANSTYIVTSFTL  146

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA++T+  +NRGG+VDCSLGIQL F
Sbjct  147  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIETSGCKNRGGSVDCSLGIQLAF  206

Query  624  SGTDK  638
            SGTDK
Sbjct  207  SGTDK  211



>ref|XP_008360605.1| PREDICTED: uncharacterized protein LOC103424296 [Malus domestica]
Length=243

 Score =   261 bits (666),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 150/183 (82%), Gaps = 6/183 (3%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQL  269
            SD N V+SPCADT V++SDGFTFGI FA++ +      +N  VQLSPCD RLSL+ NAQ+
Sbjct  28   SDXNPVYSPCADTKVERSDGFTFGIAFASKESF----QRNGTVQLSPCDSRLSLSSNAQI  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            +VFRPKVDEISLL+VN+SSF PD+ G +MVAFAGRKYAARS P FVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLSVNSSSFNPDTYG-FMVAFAGRKYAARSLPTFVANGTYTVTSFTLVL  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNLYWK+DGC+ C GSS F CLN Q CA KT+S +N GG+VDCSLGIQL FSG
Sbjct  143  EFNKGRLQNLYWKKDGCSKCSGSSDFVCLNNQHCAFKTSSCKNHGGSVDCSLGIQLAFSG  202

Query  630  TDK  638
            TDK
Sbjct  203  TDK  205



>ref|XP_008367354.1| PREDICTED: uncharacterized protein LOC103430985 [Malus domestica]
Length=243

 Score =   260 bits (665),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 150/183 (82%), Gaps = 6/183 (3%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQL  269
            SD N V+SPCADT V++SDGFTFGI FA++ +      +N  VQLSPCD RLSL+ NAQ+
Sbjct  28   SDXNPVYSPCADTKVERSDGFTFGIAFASKESF----QRNGTVQLSPCDSRLSLSSNAQI  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            +VFRPKVDEISLL+VN+SSF PD+ G +MVAFAGRKYAARS P FVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLSVNSSSFNPDTYG-FMVAFAGRKYAARSLPTFVANGTYTVTSFTLVL  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNLYWK+DGC+ C GSS F CLN Q CA KT+S +N GG+VDCSLGIQL FSG
Sbjct  143  EFNKGRLQNLYWKKDGCSKCSGSSDFVCLNNQHCAFKTSSCKNHGGSVDCSLGIQLAFSG  202

Query  630  TDK  638
            TDK
Sbjct  203  TDK  205



>ref|XP_006842158.1| hypothetical protein AMTR_s00078p00138630 [Amborella trichopoda]
 gb|ERN03833.1| hypothetical protein AMTR_s00078p00138630 [Amborella trichopoda]
Length=242

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 149/185 (81%), Gaps = 6/185 (3%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            + D N+VF PC D  +QKSDGFTFGI F+ R + F+ND+     QLSPCDRRLSL+  NA
Sbjct  25   ADDNNNVFQPCEDAKIQKSDGFTFGIAFSLRPSFFVNDT----TQLSPCDRRLSLSTSNA  80

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVD+ISLLT+NT++F P++ GGYMVAFAG++YAARS P FVAN ++IV+SFTL
Sbjct  81   QLAIFRPKVDQISLLTINTTTFTPEAFGGYMVAFAGQRYAARSTPTFVANSTFIVTSFTL  140

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KG LQNLYWKRDGCASCK +  FTCLN QDCA+  +S    GG+VDCSLGIQ  F
Sbjct  141  VLEFEKGTLQNLYWKRDGCASCKRNPNFTCLNSQDCAINQSSCMGHGGSVDCSLGIQTAF  200

Query  624  SGTDK  638
            SGTDK
Sbjct  201  SGTDK  205



>ref|XP_010534378.1| PREDICTED: uncharacterized protein LOC104809944 [Tarenaya hassleriana]
Length=242

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 157/207 (76%), Gaps = 5/207 (2%)
 Frame = +3

Query  24   MARPSAilsllifptlfllAESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFIND  203
            MAR   +  +L        AE+S D N V+SPC+D+ V   DGF+FG+ FAA+ + F   
Sbjct  1    MARSVILCLILAAVLTSSPAEASGDDNRVYSPCSDSRVAVGDGFSFGLAFAAKESFF---  57

Query  204  SKNKDVQLSPCDRRLSLNNA--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRK  377
            + N+ VQ SPCDRRLSL+N+  Q+AVFRPKVDEI+LLT+NTSSF PDS GG+MVAFAG K
Sbjct  58   NSNRSVQFSPCDRRLSLSNSGSQVAVFRPKVDEITLLTINTSSFRPDSTGGFMVAFAGSK  117

Query  378  YAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAM  557
            YAARS P FVA+ + IV+SFTLV EF+KGRLQNLYWKRDGCA C G + F C N Q+CA+
Sbjct  118  YAARSVPVFVADNNLIVTSFTLVLEFQKGRLQNLYWKRDGCAKCAGDAKFVCFNKQECAI  177

Query  558  KTNSXQNRGGNVDCSLGIQLTFSGTDK  638
            +T + +NRGG VDCSLGIQL FSGTDK
Sbjct  178  RTQNCKNRGGQVDCSLGIQLAFSGTDK  204



>ref|XP_009348837.1| PREDICTED: uncharacterized protein LOC103940443 [Pyrus x bretschneideri]
Length=243

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 149/183 (81%), Gaps = 6/183 (3%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQL  269
            SD N V+SPCADT V++SDGFTFGI FA++ +       N  VQLSPCD RLSL+ NAQ+
Sbjct  28   SDNNPVYSPCADTKVERSDGFTFGIAFASKESF----QPNGTVQLSPCDSRLSLSSNAQI  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            +VFRPKVDEISLL+VN+SSF PD+ G YMVAFAGRKYAARS P FVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLSVNSSSFNPDTYG-YMVAFAGRKYAARSLPTFVANGTYTVTSFTLVL  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF +GRLQNLYWK+DGC+ C GSS F CLN Q CA KT+S +N GG+VDCSLGIQL FSG
Sbjct  143  EFNRGRLQNLYWKKDGCSKCSGSSDFVCLNNQHCAFKTSSCKNHGGSVDCSLGIQLAFSG  202

Query  630  TDK  638
            TDK
Sbjct  203  TDK  205



>ref|XP_003519108.1| PREDICTED: uncharacterized protein LOC100807300 isoform 1 [Glycine 
max]
Length=243

 Score =   259 bits (661),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 5/181 (3%)
 Frame = +3

Query  102  NHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QLAV  275
            N VF+PC+DT VQ+SDGFTFGI FA ++  F N+  N  VQLSPCD RLSL+NA  Q++V
Sbjct  28   NRVFAPCSDTRVQRSDGFTFGIAFAPKDKFFYNN--NNSVQLSPCDTRLSLSNANSQISV  85

Query  276  FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEF  455
            FRPKVDEISLLTVN+SSF  DS G YMVAFAG +YAARSPPAFVANG+Y V+SFTLV EF
Sbjct  86   FRPKVDEISLLTVNSSSFVADSYG-YMVAFAGHRYAARSPPAFVANGTYTVTSFTLVLEF  144

Query  456  KKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTD  635
            K+GRLQNLYWKRDGCA C  +S   CLN QDCA++T++ ++ GG VDCS+GIQL FSGTD
Sbjct  145  KRGRLQNLYWKRDGCAKCSSNSKAVCLNNQDCALQTSTCKSHGGTVDCSIGIQLAFSGTD  204

Query  636  K  638
            +
Sbjct  205  R  205



>ref|XP_010677555.1| PREDICTED: uncharacterized protein LOC104893168 [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score =   258 bits (660),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  269
            D NH +SPC DT +QKSDGF+FGI F++R + F   + N  +QLSPCDRRLSL+  N+Q+
Sbjct  24   DNNHAYSPCRDTKIQKSDGFSFGIAFSSRLSFF--STNNPSIQLSPCDRRLSLSSTNSQV  81

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            A+FRPKVDEISLLT+NTSSF PDS GG+MVAFAG KYAARS P FVAN ++IV+SFTL+ 
Sbjct  82   ALFRPKVDEISLLTINTSSFSPDSAGGFMVAFAGSKYAARSLPTFVANSTHIVTSFTLIL  141

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            +FK+GRLQNL+WKRDGCASC+G S F C+N   C ++ +  +NRGGN+DCSLGIQ+ FSG
Sbjct  142  DFKQGRLQNLFWKRDGCASCEGKSKFVCMNNLYCGVRMSDCKNRGGNMDCSLGIQVAFSG  201

Query  630  TDK  638
            TDK
Sbjct  202  TDK  204



>ref|XP_008361648.1| PREDICTED: uncharacterized protein LOC103425346 [Malus domestica]
Length=242

 Score =   258 bits (659),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 154/185 (83%), Gaps = 4/185 (2%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  269
            +S+TN V++PC DT +Q+SDGFTFGI F+++ +  +N   N+  QLSPCDRRLSL+++  
Sbjct  22   ASNTNSVYNPCTDTKIQRSDGFTFGIAFSSKTSFSLNG--NQSHQLSPCDRRLSLSSSNS  79

Query  270  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
             +  FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFV N +YIV+SFTL
Sbjct  80   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVGNSTYIVTSFTL  139

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA+KT+  +NRGG+VDCSLGIQL F
Sbjct  140  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIKTSGCKNRGGSVDCSLGIQLAF  199

Query  624  SGTDK  638
            SGTDK
Sbjct  200  SGTDK  204



>emb|CAB88423.1| putative protein [Arabidopsis thaliana]
Length=240

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 150/185 (81%), Gaps = 12/185 (6%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            S +TN ++SPC+DT +Q+SDGFTFGI F++R + FIN +    V LSPCDRRLSL   N+
Sbjct  28   SGNTNTIYSPCSDTRIQRSDGFTFGIAFSSRPSFFINQT----VLLSPCDRRLSLAAMNS  83

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q +VFRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV     
Sbjct  84   QFSVFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIV-----  138

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
              EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T S + RGG VDCSLGIQL F
Sbjct  139  -MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGAVDCSLGIQLAF  197

Query  624  SGTDK  638
            SGTDK
Sbjct  198  SGTDK  202



>ref|XP_008344952.1| PREDICTED: uncharacterized protein LOC103407860 [Malus domestica]
Length=249

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 154/185 (83%), Gaps = 4/185 (2%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  269
            +S+TN V++PC DT +Q+SDGFTFGI F+++ +  +N   N+  QLSPCDRRLSL+++  
Sbjct  29   ASNTNSVYNPCTDTKIQRSDGFTFGIAFSSKTSFSLNG--NQSHQLSPCDRRLSLSSSNS  86

Query  270  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
             +  FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFV N +YIV+SFTL
Sbjct  87   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVGNSTYIVTSFTL  146

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA+KT+  +NRGG+VDCSLGIQL F
Sbjct  147  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIKTSGCKNRGGSVDCSLGIQLAF  206

Query  624  SGTDK  638
            SGTDK
Sbjct  207  SGTDK  211



>ref|XP_003535822.1| PREDICTED: uncharacterized protein LOC100795287 isoform 1 [Glycine 
max]
Length=243

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 149/183 (81%), Gaps = 5/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  269
            D N VF+PC DT VQ+SDGFTFGI FA ++  F N+  N  VQLSPCD RLSL+  N+Q+
Sbjct  26   DDNRVFAPCTDTRVQRSDGFTFGIAFAPKDKFFYNN--NNSVQLSPCDTRLSLSSANSQI  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            +VFRPKVDEISLLTVN+SSF  DS G YMVAFAG +YAARSPPAFVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLTVNSSSFVADSYG-YMVAFAGHRYAARSPPAFVANGTYTVTSFTLVL  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EFK+GRLQNLYWKRDGC+ C  +S   CLN QDCA++T++ ++ GG VDCS+GIQL FSG
Sbjct  143  EFKRGRLQNLYWKRDGCSKCSSNSKAVCLNNQDCALQTSTCKSHGGTVDCSIGIQLAFSG  202

Query  630  TDK  638
            TD+
Sbjct  203  TDR  205



>ref|XP_010263047.1| PREDICTED: uncharacterized protein LOC104601426 [Nelumbo nucifera]
Length=269

 Score =   257 bits (656),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 155/185 (84%), Gaps = 8/185 (4%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQLA  272
            SDTN  F PC+DT +Q+SDGFTFGI FA RN+   N+S+N    LSPCDRRLSL+++  +
Sbjct  52   SDTNRAFQPCSDTKIQRSDGFTFGIAFAPRNSFLYNNSQN----LSPCDRRLSLSSSGSS  107

Query  273  V--FRPKVDEISLLTVNTSS-FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            +  FRPKVDEISLLT+NT+S FFPDS  GYMVAFAGRKYAARSPPAFVAN +YIV+SFTL
Sbjct  108  LALFRPKVDEISLLTINTTSNFFPDS-SGYMVAFAGRKYAARSPPAFVANSTYIVTSFTL  166

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KGRLQN YWKRDGCASC G+S F CLN QDCA++T+S ++R G+VDCSLGIQL F
Sbjct  167  VLEFQKGRLQNFYWKRDGCASCSGNSKFVCLNKQDCAIRTSSCKSRRGSVDCSLGIQLAF  226

Query  624  SGTDK  638
            SGTDK
Sbjct  227  SGTDK  231



>ref|XP_002271183.1| PREDICTED: uncharacterized protein LOC100249592 [Vitis vinifera]
 emb|CBI39123.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 150/188 (80%), Gaps = 10/188 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            S D N VFSPCADTTVQKSDGFTFGI FA+R+    N++      LSPCDRRL+L+  N+
Sbjct  22   SGDNNRVFSPCADTTVQKSDGFTFGIAFASRDKFSYNNT-----LLSPCDRRLALSSQNS  76

Query  264  QLAVFRPKVDEISLLTVNT-SSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            Q+A FRPKVDEISLL++NT SSFFP + GGYMVAFAGRKYAARS  AFV+N +Y V+SFT
Sbjct  77   QIAAFRPKVDEISLLSINTTSSFFPANYGGYMVAFAGRKYAARSSLAFVSNSTYTVTSFT  136

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTN--SXQNRGGNVDCSLGIQ  614
            LV EFKKGRLQNLYWKRDGC++C G + F CLN QDCA+KT     Q +G +VDCSLGIQ
Sbjct  137  LVLEFKKGRLQNLYWKRDGCSACSGDNKFVCLNNQDCAIKTTDCKGQGQGASVDCSLGIQ  196

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  197  LAFSGTDK  204



>gb|EPS69588.1| expp1 protein, partial [Genlisea aurea]
Length=219

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 151/185 (82%), Gaps = 8/185 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN+VFSPC+D  VQ+SDGFTFGI FAAR A       N  +QLSPCD RLSL   N+QL
Sbjct  1    DTNNVFSPCSDAVVQRSDGFTFGIAFAARTAF----FFNATLQLSPCDHRLSLPSGNSQL  56

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPK+DEISLLTVNTSSF PDSVGGYMVAFAGR+YAARS PAFVAN +Y V+SFTLV 
Sbjct  57   AVFRPKIDEISLLTVNTSSFQPDSVGGYMVAFAGRRYAARSNPAFVANSTYTVTSFTLVL  116

Query  450  EFKKGRLQNLYWKRDGCASC--KGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            +F KGRLQN YWKRDGC++C   G S F CLN QDCA++TN  ++RGG+VDCS+GIQL F
Sbjct  117  DFDKGRLQNSYWKRDGCSACPSSGKSNFVCLNNQDCAIRTNDCKSRGGSVDCSIGIQLAF  176

Query  624  SGTDK  638
            SGTDK
Sbjct  177  SGTDK  181



>ref|XP_010907712.1| PREDICTED: uncharacterized protein LOC105034308 [Elaeis guineensis]
Length=246

 Score =   253 bits (646),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 147/186 (79%), Gaps = 10/186 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---NAQ  266
            D N VF PCAD  +Q+ DGFTFGI F+ R + F N +     QLSPCDRRLSL    NAQ
Sbjct  28   DNNRVFQPCADAKIQRGDGFTFGIAFSTRESFFFNQT-----QLSPCDRRLSLASGANAQ  82

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRPKVDEISLLTVNT+S+   + GG+MVAFAGRKYAARS PAFV+N SY V+SFTLV
Sbjct  83   LALFRPKVDEISLLTVNTTSYPAVTNGGFMVAFAGRKYAARSLPAFVSNSSYTVTSFTLV  142

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQ--NRGGNVDCSLGIQLT  620
             EF+KG LQNLYWKRDGCASC G S F CLN Q+CA+KT++ +  N+GG+VDCS+GIQL 
Sbjct  143  LEFQKGTLQNLYWKRDGCASCSGKSNFVCLNKQECAIKTSNCKSANQGGSVDCSIGIQLA  202

Query  621  FSGTDK  638
            FSGTDK
Sbjct  203  FSGTDK  208



>ref|XP_008787836.1| PREDICTED: uncharacterized protein LOC103705763, partial [Phoenix 
dactylifera]
Length=234

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 146/186 (78%), Gaps = 10/186 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL---NNAQ  266
            D N VF PCAD  +QK DGFTFGI F+ R + F N +     QLSPCDRRLSL    NAQ
Sbjct  16   DNNRVFQPCADAKIQKGDGFTFGIAFSTRESFFFNQT-----QLSPCDRRLSLASGGNAQ  70

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRPKVDEISLLTVNT+S+   + GG+MVAFAGRKYAARS P FV+N SY V+SFTLV
Sbjct  71   LALFRPKVDEISLLTVNTTSYPAVTNGGFMVAFAGRKYAARSLPTFVSNSSYTVTSFTLV  130

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQ--NRGGNVDCSLGIQLT  620
             EF+KG LQNLYWKRDGCASC G S F CLN Q+CA+KT++ +  N+GG+VDCS+GIQL 
Sbjct  131  LEFQKGTLQNLYWKRDGCASCSGKSDFVCLNKQECAIKTSNCKSANQGGSVDCSIGIQLA  190

Query  621  FSGTDK  638
            FSGTDK
Sbjct  191  FSGTDK  196



>ref|XP_010263787.1| PREDICTED: uncharacterized protein LOC104601968 isoform X1 [Nelumbo 
nucifera]
Length=251

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 142/183 (78%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            DTN ++ PC+D  + KSDGFT G+ F+++ + F      + +QLSPCDRRLSL+   AQL
Sbjct  36   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFFF-----EKIQLSPCDRRLSLSTKIAQL  90

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+N S F PD  GGYMVAFAGRKYAARS P FVAN SYI++SFTLV 
Sbjct  91   AVFRPKVDEISLLTINGSKFSPDMYGGYMVAFAGRKYAARSQPTFVANSSYIITSFTLVL  150

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+DGCA+C G S F CLN QDCA + ++ Q+ GG  DCSLGIQL FSG
Sbjct  151  EFQKGTLQNLHWKKDGCATCAGKSSFICLNLQDCATRISNCQSHGGPFDCSLGIQLAFSG  210

Query  630  TDK  638
            TDK
Sbjct  211  TDK  213



>gb|AEZ00912.1| putative expp1 protein [Elaeis guineensis]
Length=248

 Score =   251 bits (640),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 147/186 (79%), Gaps = 10/186 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---NAQ  266
            D N VF PCADT +Q+ DGFTFGI F+ R++ F N +     QLSPCD RL+L    NAQ
Sbjct  30   DNNRVFQPCADTKIQRGDGFTFGIAFSTRDSFFFNQT-----QLSPCDSRLALASNANAQ  84

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRPKVDEISLLTVNT+ +   + GG+MVAFAGRKYAARS PAFV N SYIV+SFTLV
Sbjct  85   LALFRPKVDEISLLTVNTTVYPAVTNGGFMVAFAGRKYAARSLPAFVGNSSYIVTSFTLV  144

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQ--NRGGNVDCSLGIQLT  620
             EF+KGRLQNLYWKRDGCASC G S F CLN  +CA+KT+S +  N+GG+VDCS+GIQL 
Sbjct  145  LEFQKGRLQNLYWKRDGCASCSGKSNFVCLNKLECAIKTSSCKNANQGGSVDCSIGIQLA  204

Query  621  FSGTDK  638
            FSGTD+
Sbjct  205  FSGTDE  210



>ref|XP_010263788.1| PREDICTED: uncharacterized protein LOC104601968 isoform X2 [Nelumbo 
nucifera]
Length=249

 Score =   251 bits (640),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 142/183 (78%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            DTN ++ PC+D  + KSDGFT G+ F+++ + F      + +QLSPCDRRLSL+   AQL
Sbjct  34   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFFF-----EKIQLSPCDRRLSLSTKIAQL  88

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+N S F PD  GGYMVAFAGRKYAARS P FVAN SYI++SFTLV 
Sbjct  89   AVFRPKVDEISLLTINGSKFSPDMYGGYMVAFAGRKYAARSQPTFVANSSYIITSFTLVL  148

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+DGCA+C G S F CLN QDCA + ++ Q+ GG  DCSLGIQL FSG
Sbjct  149  EFQKGTLQNLHWKKDGCATCAGKSSFICLNLQDCATRISNCQSHGGPFDCSLGIQLAFSG  208

Query  630  TDK  638
            TDK
Sbjct  209  TDK  211



>ref|XP_010906029.1| PREDICTED: uncharacterized protein LOC105033073 [Elaeis guineensis]
Length=248

 Score =   250 bits (639),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 147/186 (79%), Gaps = 10/186 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---NAQ  266
            D N VF PCADT +Q+ DGFTFGI F+ R++ F N +     QLSPCD RL+L    NAQ
Sbjct  30   DNNRVFQPCADTKIQRGDGFTFGIAFSTRDSFFFNQT-----QLSPCDSRLALASNANAQ  84

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRPKVDEISLLTVNT+ +   + GG+MVAFAGRKYAARS PAFV N SYIV+SFTLV
Sbjct  85   LALFRPKVDEISLLTVNTTVYPAVTNGGFMVAFAGRKYAARSLPAFVGNSSYIVTSFTLV  144

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQ--NRGGNVDCSLGIQLT  620
             EF+KGRLQNLYWKRDGCASC G S F CLN  +CA+KT+S +  N+GG+VDCS+GIQL 
Sbjct  145  LEFQKGRLQNLYWKRDGCASCSGKSNFVCLNKLECAIKTSSCKNANQGGSVDCSIGIQLA  204

Query  621  FSGTDK  638
            FSGTD+
Sbjct  205  FSGTDE  210



>ref|XP_010263789.1| PREDICTED: uncharacterized protein LOC104601968 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010263790.1| PREDICTED: uncharacterized protein LOC104601968 isoform X3 [Nelumbo 
nucifera]
Length=238

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 142/183 (78%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            DTN ++ PC+D  + KSDGFT G+ F+++ + F      + +QLSPCDRRLSL+   AQL
Sbjct  23   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFFF-----EKIQLSPCDRRLSLSTKIAQL  77

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+N S F PD  GGYMVAFAGRKYAARS P FVAN SYI++SFTLV 
Sbjct  78   AVFRPKVDEISLLTINGSKFSPDMYGGYMVAFAGRKYAARSQPTFVANSSYIITSFTLVL  137

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+DGCA+C G S F CLN QDCA + ++ Q+ GG  DCSLGIQL FSG
Sbjct  138  EFQKGTLQNLHWKKDGCATCAGKSSFICLNLQDCATRISNCQSHGGPFDCSLGIQLAFSG  197

Query  630  TDK  638
            TDK
Sbjct  198  TDK  200



>ref|XP_009381303.1| PREDICTED: uncharacterized protein LOC103969490 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 143/183 (78%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            D N VF+PCAD  +Q+ DGF FGI F++  + F N      V+LSPCD RLSL  N AQL
Sbjct  23   DQNGVFTPCADAKIQRWDGFAFGIAFSSYESFFSNG-----VKLSPCDTRLSLSSNGAQL  77

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+NTS+    + GGYMVAFAG+KYAARS PAF+ N +Y+V+SFTLV 
Sbjct  78   AVFRPKVDEISLLTINTSNNPSVTSGGYMVAFAGKKYAARSLPAFIGNSTYVVTSFTLVL  137

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KG LQNLYWKRDGCASCKG S F CLN QDCA+KT+S + +GG VDCS+GIQL FSG
Sbjct  138  EFHKGTLQNLYWKRDGCASCKGKSSFVCLNNQDCAIKTSSCKTQGGAVDCSIGIQLAFSG  197

Query  630  TDK  638
            TDK
Sbjct  198  TDK  200



>ref|XP_003590316.1| hypothetical protein MTR_1g056390 [Medicago truncatula]
 gb|ACJ84303.1| unknown [Medicago truncatula]
 gb|AES60567.1| CSL zinc finger protein [Medicago truncatula]
 gb|AFK33399.1| unknown [Medicago truncatula]
 gb|AFK39356.1| unknown [Medicago truncatula]
Length=240

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 148/183 (81%), Gaps = 5/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QL  269
            DTN VFSPC DT VQ+SDGFT G  FA+++  F N+  N  +QLSPCD RLSL+N+  Q+
Sbjct  23   DTNKVFSPCTDTRVQRSDGFTLGFAFASKDKFFYNN--NNSIQLSPCDSRLSLSNSNSQI  80

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            ++FRPKVDEISLLTVN+SSF  DS G YMVAFAGRKYAARSPPAF+ANGSY V+SFTLV 
Sbjct  81   SLFRPKVDEISLLTVNSSSFVADSYG-YMVAFAGRKYAARSPPAFIANGSYTVTSFTLVL  139

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EFKKGRLQNL+WKRDGC+ C  +S   CLNGQDCA+ T+S +   G VDCSLGIQL FSG
Sbjct  140  EFKKGRLQNLFWKRDGCSKCPKNSKAVCLNGQDCALPTSSCKTHSGTVDCSLGIQLAFSG  199

Query  630  TDK  638
            TDK
Sbjct  200  TDK  202



>ref|XP_010036587.1| PREDICTED: uncharacterized protein LOC104425564 [Eucalyptus grandis]
 gb|KCW48197.1| hypothetical protein EUGRSUZ_K01919 [Eucalyptus grandis]
Length=247

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 157/188 (84%), Gaps = 6/188 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
            A  SSDTN  +S CADTTVQ+SDGF+F I FAAR A F N ++    QLSPCD RLSL++
Sbjct  26   AVRSSDTNGAYSTCADTTVQRSDGFSFAIAFAARTAFFFNSTQ----QLSPCDSRLSLSS  81

Query  261  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
            +  Q+AVFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRKYAARS PAFVAN +Y V+S
Sbjct  82   SGSQIAVFRPKVDEISLLTINTSSFSPDTSGGYMVAFAGRKYAARSLPAFVANSTYTVTS  141

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EF+KGRLQNLYWKRDGC+SC G+S F CLN QDCA+KT+  +NRGG+VDCSLGIQ
Sbjct  142  FTLVLEFQKGRLQNLYWKRDGCSSCSGNSNFVCLNNQDCALKTSDCKNRGGSVDCSLGIQ  201

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  202  LAFSGTDK  209



>ref|XP_004161289.1| PREDICTED: uncharacterized LOC101209667 isoform 1 [Cucumis sativus]
 ref|XP_004161290.1| PREDICTED: uncharacterized LOC101209667 isoform 2 [Cucumis sativus]
Length=245

 Score =   245 bits (626),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 141/188 (75%), Gaps = 9/188 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQ-  266
            +SD N VFSPC DTTV+ SDGFT G  FA     F N    K +QLSPCD RL L N   
Sbjct  24   ASDNNRVFSPCTDTTVENSDGFTLGFAFATEQKFFFN----KTLQLSPCDSRLGLTNGNS  79

Query  267  -LAVFRPKVDEISLLTVNTS---SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             ++VFRPKVDEISLLT+NTS   S F  S  GYMVAFAGRKYAARSPP FVA+  +IV+S
Sbjct  80   LISVFRPKVDEISLLTINTSRSVSSFDPSSNGYMVAFAGRKYAARSPPIFVADQQHIVTS  139

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EF+KGRLQNL+WKRDGCA C  +S F C++ QDCA++TNS +N GG+VDCSL IQ
Sbjct  140  FTLVLEFEKGRLQNLFWKRDGCARCSNNSTFVCIHNQDCAIRTNSCKNNGGSVDCSLAIQ  199

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  200  LAFSGTDK  207



>ref|XP_008811297.1| PREDICTED: uncharacterized protein LOC103722495 [Phoenix dactylifera]
Length=237

 Score =   245 bits (625),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 144/180 (80%), Gaps = 10/180 (6%)
 Frame = +3

Query  114  SPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---NAQLAVFRP  284
            SPCADT +Q+ DGFTFGI F+ R++ F N      +QLSPCDRRLSL    N+QLA+FRP
Sbjct  25   SPCADTKIQRGDGFTFGIAFSTRDSFFFNQ-----IQLSPCDRRLSLASSANSQLALFRP  79

Query  285  KVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKG  464
            KVDEISLLT+NT+++   + GG+MVAFAGRKYAARS PAF+ N SY V+SFTLV EF KG
Sbjct  80   KVDEISLLTINTTTYPAVTNGGFMVAFAGRKYAARSLPAFIGNSSYTVTSFTLVLEFHKG  139

Query  465  RLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQ--NRGGNVDCSLGIQLTFSGTDK  638
             LQNLYWKRDGCASC G S F CLN Q+CA+KT++ +  N+GG+VDCS+GIQL FSGTDK
Sbjct  140  TLQNLYWKRDGCASCSGKSNFVCLNKQECAIKTSNCKNANQGGSVDCSIGIQLAFSGTDK  199



>ref|XP_004136522.1| PREDICTED: uncharacterized protein LOC101209667 [Cucumis sativus]
 gb|KGN59226.1| hypothetical protein Csa_3G782730 [Cucumis sativus]
Length=245

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 141/188 (75%), Gaps = 9/188 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQ-  266
            +SD N VFSPC DTTV+ SDGFT G  FA     F N    K +QLSPCD RL L N   
Sbjct  24   ASDNNRVFSPCTDTTVENSDGFTLGFAFATEQKFFFN----KTLQLSPCDSRLGLTNGNS  79

Query  267  -LAVFRPKVDEISLLTVNTS---SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             ++VFRPKVDEISLLT+NTS   S F  S  GYMVAFAGRKYAARSPP FVA+  +IV+S
Sbjct  80   LISVFRPKVDEISLLTINTSRSVSSFDPSSNGYMVAFAGRKYAARSPPIFVADQQHIVTS  139

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EF+KGRLQNL+WKRDGCA C  +S F C++ QDCA++TNS +N GG+VDCSL IQ
Sbjct  140  FTLVLEFEKGRLQNLFWKRDGCARCSNNSTFVCIHNQDCAIRTNSCKNNGGSVDCSLAIQ  199

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  200  LAFSGTDK  207



>ref|XP_008442938.1| PREDICTED: uncharacterized protein LOC103486692 [Cucumis melo]
Length=245

 Score =   243 bits (620),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 140/186 (75%), Gaps = 9/186 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQ--L  269
            D N VFSPC DTTV+ SDGFT G  FA +   F N    K +QLSPCD RL L N    +
Sbjct  26   DNNRVFSPCTDTTVETSDGFTLGFAFATQQKFFFN----KTLQLSPCDSRLGLTNGNSLI  81

Query  270  AVFRPKVDEISLLTVNTS---SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            +VFRPKVDEISLLTVNTS   S F  S  GYMVAFAGRKYAARSPP FVA+  +IV+SFT
Sbjct  82   SVFRPKVDEISLLTVNTSRSVSSFDPSSNGYMVAFAGRKYAARSPPIFVADQQHIVTSFT  141

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF+KGRLQNL+WKRDGCA C  ++ F C++ QDCA++TNS +N GG+VDCSL IQL 
Sbjct  142  LVLEFEKGRLQNLFWKRDGCAQCSNNNTFVCIHNQDCAIRTNSCKNNGGSVDCSLAIQLA  201

Query  621  FSGTDK  638
            FSGTDK
Sbjct  202  FSGTDK  207



>ref|XP_002882747.1| hypothetical protein ARALYDRAFT_478525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59006.1| hypothetical protein ARALYDRAFT_478525 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 149/186 (80%), Gaps = 6/186 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDR-RLSLN-NAQL  269
            D N V+SPC+D+TV   DGFTFGI FAAR+ +F + +++  VQ SPCDR RLSLN N+++
Sbjct  24   DNNQVYSPCSDSTVAIGDGFTFGIAFAARD-SFFSTNRSDHVQYSPCDRHRLSLNGNSEV  82

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSIPIMVADSNHIVTSFT  142

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF+KGRL+ ++WK+DGC+ C G S F CLN ++CA+KT S +N+GG VDCSLGIQL 
Sbjct  143  LVLEFQKGRLEEMFWKKDGCSKCSGDSKFVCLNKEECAIKTQSCKNQGGQVDCSLGIQLA  202

Query  621  FSGTDK  638
            FSGTDK
Sbjct  203  FSGTDK  208



>gb|ABK22043.1| unknown [Picea sitchensis]
Length=241

 Score =   241 bits (616),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 142/183 (78%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQLAV  275
            DTN VF+PC+DT VQKSDGFTFG+ FAAR++ + N      V+ SPCD RL L+ + LAV
Sbjct  26   DTNSVFNPCSDTLVQKSDGFTFGVTFAARDSFYSNT-----VEYSPCDSRLGLSASHLAV  80

Query  276  FRPKVDEISLLTVNTS--SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            FRPKVDEI+LLT+NT+  SF P+  GGYMVAFAG  +AARS P FVAN + I++SFTLV 
Sbjct  81   FRPKVDEITLLTINTTAGSFSPEQDGGYMVAFAGHNHAARSTPTFVANQTLIITSFTLVL  140

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            +F KGRLQNL+WK DGC SC+G S F C  GQ CA+K +  +N+GG+VDCSLGIQL FSG
Sbjct  141  DFNKGRLQNLFWKTDGCNSCQGKSSFVCYRGQSCAIKLSDCKNKGGSVDCSLGIQLAFSG  200

Query  630  TDK  638
            TDK
Sbjct  201  TDK  203



>ref|XP_010503073.1| PREDICTED: uncharacterized protein LOC104780270 isoform X2 [Camelina 
sativa]
Length=242

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 142/184 (77%), Gaps = 22/184 (12%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  266
            S+TNH++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+Q
Sbjct  41   SNTNHIYSPCSDTKIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLTLAAMNSQ  96

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            L++FRPK                D+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  97   LSIFRPK----------------DNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  140

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T S + RGG VDCSLGIQL FS
Sbjct  141  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNRQDCAIRTPSCKVRGGTVDCSLGIQLAFS  200

Query  627  GTDK  638
            GTDK
Sbjct  201  GTDK  204



>ref|XP_008241077.1| PREDICTED: uncharacterized protein LOC103339548 [Prunus mume]
Length=244

 Score =   241 bits (615),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 143/184 (78%), Gaps = 8/184 (4%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQ  266
            S+ NHV+SPCADT V++SDGFTFGI FA+R++ F    +N  VQLSPCD RLSL+N  +Q
Sbjct  29   SNNNHVYSPCADTKVERSDGFTFGIAFASRDSFF----RNGSVQLSPCDSRLSLSNGNSQ  84

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            ++VFRPKVDEISLL+VN+SSF  DS G YMVAF          PAFVAN +Y V+SFTLV
Sbjct  85   ISVFRPKVDEISLLSVNSSSFTADSYG-YMVAFXXXX-XXXXXPAFVANATYTVTSFTLV  142

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF KGRLQNLYWKRDGC+ C GS+G  CLN QDCA +T+S +  GG+VDCSLGIQL FS
Sbjct  143  LEFNKGRLQNLYWKRDGCSKCSGSTGLVCLNNQDCAFRTSSCKTHGGSVDCSLGIQLAFS  202

Query  627  GTDK  638
            GTDK
Sbjct  203  GTDK  206



>ref|XP_010276279.1| PREDICTED: uncharacterized protein LOC104611063 [Nelumbo nucifera]
Length=235

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 143/193 (74%), Gaps = 17/193 (9%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            DTN ++ PC+D  + KSDGFT G+ F+++ +        + +QLSPCDRRLSL++  AQL
Sbjct  10   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFLF-----EQIQLSPCDRRLSLSSKIAQL  64

Query  270  AVFRPKVDEISLLTVNTSSF----------FPDSVGGYMVAFAGRKYAARSPPAFVANGS  419
            AVFRPKVDEISLLT+N S+F          F D  GGYMVAFAG+KYAARS P FVAN +
Sbjct  65   AVFRPKVDEISLLTINGSNFSLVLLQLVFTFRDMYGGYMVAFAGQKYAARSQPTFVANST  124

Query  420  YIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDC  599
            YI++SFTLV EF+KG LQNLYWK+DGCA C G S F CLN QDCA+  +S Q+ GG  DC
Sbjct  125  YIITSFTLVLEFQKGTLQNLYWKKDGCAPCAGKSSFICLNLQDCAIGISSCQSHGGPFDC  184

Query  600  SLGIQLTFSGTDK  638
            SLGIQLTFSGT+K
Sbjct  185  SLGIQLTFSGTNK  197



>ref|NP_566401.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK76686.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85130.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75100.1| uncharacterized protein AT3G11800 [Arabidopsis thaliana]
Length=246

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 149/186 (80%), Gaps = 6/186 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  269
            D N V+SPC+D+TV   DGFTFGI FAA++ +F + +++K VQ SPCD R LSLN N+++
Sbjct  24   DNNQVYSPCSDSTVAIGDGFTFGIAFAAKD-SFFSTNRSKSVQYSPCDHRHLSLNGNSEV  82

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSLPIMVADSNHIVTSFT  142

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF+KGRL+N++WK+DGC+ C G S F CLN ++CA+K  + +N+GG VDCSLGIQL 
Sbjct  143  LVLEFQKGRLENMFWKKDGCSKCSGDSKFVCLNKEECAIKPQNCKNQGGQVDCSLGIQLA  202

Query  621  FSGTDK  638
            FSGTDK
Sbjct  203  FSGTDK  208



>emb|CBI32499.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 144/183 (79%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  269
            DTN VF PC+D  V++ DGFTFG+ F+ +++ F N +     QLSPCDRRLSL+  N+QL
Sbjct  25   DTNDVFDPCSDAKVKRFDGFTFGLAFSTKDSFFFNQT-----QLSPCDRRLSLSSTNSQL  79

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLTVN+++F P S GGYMVAFAGRKYAARS P  VA+G + ++SFTLV 
Sbjct  80   AVFRPKVDEISLLTVNSTNFNPISNGGYMVAFAGRKYAARSTPVLVADGQHTITSFTLVL  139

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EFKKG LQ+ YWK+ GC+ C  SS F CLN QDCA+K++  +N+GG++DC++ IQL FSG
Sbjct  140  EFKKGTLQSFYWKKFGCSKCSKSSAFVCLNEQDCAVKSSHCKNQGGSIDCNISIQLIFSG  199

Query  630  TDK  638
            TDK
Sbjct  200  TDK  202



>ref|XP_002281560.2| PREDICTED: uncharacterized protein LOC100243476 [Vitis vinifera]
Length=241

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 144/183 (79%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  269
            DTN VF PC+D  V++ DGFTFG+ F+ +++ F N +     QLSPCDRRLSL+  N+QL
Sbjct  26   DTNDVFDPCSDAKVKRFDGFTFGLAFSTKDSFFFNQT-----QLSPCDRRLSLSSTNSQL  80

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLTVN+++F P S GGYMVAFAGRKYAARS P  VA+G + ++SFTLV 
Sbjct  81   AVFRPKVDEISLLTVNSTNFNPISNGGYMVAFAGRKYAARSTPVLVADGQHTITSFTLVL  140

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EFKKG LQ+ YWK+ GC+ C  SS F CLN QDCA+K++  +N+GG++DC++ IQL FSG
Sbjct  141  EFKKGTLQSFYWKKFGCSKCSKSSAFVCLNEQDCAVKSSHCKNQGGSIDCNISIQLIFSG  200

Query  630  TDK  638
            TDK
Sbjct  201  TDK  203



>ref|XP_009407725.1| PREDICTED: uncharacterized protein LOC103990346 [Musa acuminata 
subsp. malaccensis]
Length=228

 Score =   238 bits (607),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 144/182 (79%), Gaps = 6/182 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQLA  272
            D N VF+PC D  +Q+ DGFTFGI F+  ++ F     +  VQLSPCD RLSL+N AQLA
Sbjct  20   DQNDVFTPCDDAKIQRWDGFTFGIAFSNHDSFF-----SDRVQLSPCDSRLSLSNVAQLA  74

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            VFRPKVDEISLLTV+TS+    + GGYMVAFAGRKYAARS P FV++ + IV+SFTLV E
Sbjct  75   VFRPKVDEISLLTVDTSANPAVTSGGYMVAFAGRKYAARSVPVFVSDNTNIVTSFTLVLE  134

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F+KG LQNL+WKRDGCASC G S F CLN Q CA+KT+S +++GG+VDC++GIQL FSGT
Sbjct  135  FQKGTLQNLHWKRDGCASCSGKSSFVCLNNQVCAIKTSSCKHQGGSVDCNIGIQLAFSGT  194

Query  633  DK  638
            DK
Sbjct  195  DK  196



>ref|XP_006356594.1| PREDICTED: uncharacterized protein LOC102601073 isoform X1 [Solanum 
tuberosum]
 ref|XP_006356595.1| PREDICTED: uncharacterized protein LOC102601073 isoform X2 [Solanum 
tuberosum]
Length=240

 Score =   237 bits (605),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 143/183 (78%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN VF PC+DT VQ+ DGFTFG+VF+++ + F N+S     QLSPCDRRLSL  N+A+L
Sbjct  26   DTNSVFDPCSDTRVQRWDGFTFGLVFSSKESFFFNES-----QLSPCDRRLSLTGNSAEL  80

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+N S+F P   GGYMVAFAGRKYAARS PAFVA+ ++ V+SFTLV 
Sbjct  81   AVFRPKVDEISLLTINISNFNPSKSGGYMVAFAGRKYAARSLPAFVADSTHTVTSFTLVL  140

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+ GC SCKG S F CLN  DCA+  N     GG++DC++ IQL FSG
Sbjct  141  EFQKGTLQNLFWKKFGCDSCKGDS-FVCLNKTDCAVPNNKCNGNGGSIDCNVSIQLAFSG  199

Query  630  TDK  638
            TDK
Sbjct  200  TDK  202



>ref|XP_010464889.1| PREDICTED: uncharacterized protein LOC104745376 [Camelina sativa]
Length=246

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 146/186 (78%), Gaps = 6/186 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  269
            D N V+SPC+D+TV   DGFTFGI FA+++ TF   S N  VQ SPCDRR LSLN N+++
Sbjct  24   DDNGVYSPCSDSTVGIGDGFTFGIAFASKD-TFFGGSTNHTVQYSPCDRRRLSLNGNSEI  82

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSNNFRPDASKGYMVAFAGSKYAARSVPIMVADSNHIVTSFT  142

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF+KGRL+N++WK+DGC+ C G + F CLNG  CA+K+ + +N+GG  DCSLGIQL 
Sbjct  143  LVLEFQKGRLENMFWKKDGCSKCSGDTKFVCLNGDQCAIKSQNCKNQGGQADCSLGIQLA  202

Query  621  FSGTDK  638
            FSGTDK
Sbjct  203  FSGTDK  208



>ref|XP_004982307.1| PREDICTED: uncharacterized protein LOC101777564 [Setaria italica]
Length=246

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 146/186 (78%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNA  263
            ++ DTN V+ PC+D  +Q+ DGF+FG+VFA  NA F     + + QLSPCDRRL+L ++A
Sbjct  29   AAGDTNGVYEPCSDAWIQRGDGFSFGVVFAGYNAFF-----SGNTQLSPCDRRLNLASSA  83

Query  264  QLAVFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            QLAVFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S+ VSSFT
Sbjct  84   QLAVFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSAPIFVSNTSFTVSSFT  143

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EFKKGRLQNL+WK+DGC +C G S F CL  Q CA++T S + + G VDCS+GIQL 
Sbjct  144  LVLEFKKGRLQNLHWKKDGCGACTGKSNFVCLGKQTCAIRTQSCKTQ-GPVDCSIGIQLA  202

Query  621  FSGTDK  638
            FSGTD+
Sbjct  203  FSGTDR  208



>ref|XP_006298425.1| hypothetical protein CARUB_v10014494mg [Capsella rubella]
 gb|EOA31323.1| hypothetical protein CARUB_v10014494mg [Capsella rubella]
Length=244

 Score =   236 bits (603),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 146/186 (78%), Gaps = 8/186 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  269
            D N V+SPC+D+TV   DGFTFGI FAA+++ F     N+ VQ SPCDRR LSLN N+++
Sbjct  24   DDNRVYSPCSDSTVGIGDGFTFGIAFAAKDSFF---GTNRSVQYSPCDRRRLSLNGNSEV  80

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  81   AVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSVPIMVADSNHIVTSFT  140

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF+KGRL+N++WK+DGC+ C G + F CLN   CA+KT + +N+GG VDCSLGIQL 
Sbjct  141  LVLEFQKGRLENMFWKKDGCSKCSGDTKFVCLNKDQCAIKTQNCKNQGGQVDCSLGIQLA  200

Query  621  FSGTDK  638
            FSGTDK
Sbjct  201  FSGTDK  206



>gb|KFK38545.1| hypothetical protein AALP_AA3G127900 [Arabis alpina]
Length=250

 Score =   236 bits (603),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 147/189 (78%), Gaps = 8/189 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATF--INDSKNKDVQLSPCD-RRLSLN-NA  263
            D N V+SPC+D+TV   DGFTFGI FAAR++ F   N+     VQ SPCD RRLSLN N+
Sbjct  24   DENRVYSPCSDSTVAIGDGFTFGIAFAARDSFFGTTNNRSVPPVQYSPCDHRRLSLNGNS  83

Query  264  QLAVFRPKVDEISLLTVNTSS----FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVS  431
            +LAVFRPKVDEI+LLT+NTSS    F PD+   +MVAFAG KYAARS P  VA+ ++IV+
Sbjct  84   ELAVFRPKVDEITLLTINTSSGSSSFRPDASKSHMVAFAGAKYAARSVPIMVADSNHIVT  143

Query  432  SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGI  611
            SFTLV EFKKGRL+NL+WK+DGC+ C G + F CLN ++CA+K+ + +N+GG VDCSLGI
Sbjct  144  SFTLVLEFKKGRLENLFWKKDGCSKCSGDAKFVCLNKEECAIKSQNCKNQGGQVDCSLGI  203

Query  612  QLTFSGTDK  638
            QL FSGTDK
Sbjct  204  QLAFSGTDK  212



>gb|AAT75254.1| expressed protein [Oryza sativa Japonica Group]
 gb|EEE60063.1| hypothetical protein OsJ_12869 [Oryza sativa Japonica Group]
Length=253

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 141/186 (76%), Gaps = 11/186 (6%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN V+ PCAD  VQ+ DGFTFG+ FAAR   F     +  VQLSPCD RLSL    A+L
Sbjct  36   DTNGVYEPCADAAVQRGDGFTFGVAFAARGDFF-----SGGVQLSPCDGRLSLASKGAKL  90

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRP+VDEISLLTVNTS+   F P + GGYMVAFAGRKYAARSPP FV+N SY V+SFT
Sbjct  91   AVFRPEVDEISLLTVNTSAAGGFDPATSGGYMVAFAGRKYAARSPPVFVSNSSYTVTSFT  150

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LVFEF KG LQNLYWK +GC++C G   FTC++ Q+CA+ T +   +GG+VDCS GIQL 
Sbjct  151  LVFEFNKGTLQNLYWKANGCSACSGQPSFTCVD-QNCAISTANCTGKGGSVDCSPGIQLA  209

Query  621  FSGTDK  638
            FSGTDK
Sbjct  210  FSGTDK  215



>ref|XP_004248747.1| PREDICTED: uncharacterized protein LOC101250348 [Solanum lycopersicum]
Length=238

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 141/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN VF PC+DT VQ+ DGFTFG+VF+++ + F N++     QLSPCDRRLSL  N+A+L
Sbjct  24   DTNSVFDPCSDTRVQRWDGFTFGLVFSSKESFFFNET-----QLSPCDRRLSLTGNSAEL  78

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLL +N S+F P   GGYMVAFAGRKYAARS PAFVA+ ++ V+SFTLV 
Sbjct  79   AVFRPKVDEISLLKINNSNFNPSKSGGYMVAFAGRKYAARSLPAFVADSTHTVTSFTLVL  138

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+ GC SCKG S F CLN  DCA+  N     GG++DC + IQL FSG
Sbjct  139  EFQKGTLQNLFWKKFGCDSCKGDS-FVCLNKTDCAVPNNKCNGNGGSIDCDVSIQLAFSG  197

Query  630  TDK  638
            TDK
Sbjct  198  TDK  200



>ref|XP_004290389.1| PREDICTED: uncharacterized protein LOC101301448 [Fragaria vesca 
subsp. vesca]
Length=237

 Score =   233 bits (594),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 143/186 (77%), Gaps = 6/186 (3%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
            A++ SDTN VF PC+D T+Q+ DGFTFG+ F+ +++ F N +     QLSPCD+RLSL+ 
Sbjct  30   ADAGSDTNGVFDPCSDATIQRWDGFTFGLAFSTKDSFFSNQT-----QLSPCDKRLSLST  84

Query  261  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AQLA+FRPKVDEISLL++N+S+F P   GGYMVAFAGRKYAARSPP  VA+ S  ++SFT
Sbjct  85   AQLALFRPKVDEISLLSINSSNFNPARAGGYMVAFAGRKYAARSPPILVADDSNTITSFT  144

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF +G LQNLYWK+ GC +C G     CLNG+DCA+  +  ++ GG+ DC+L IQLT
Sbjct  145  LVLEFDRGILQNLYWKKFGCKACSGDYS-VCLNGEDCAVPNSKCKSNGGSFDCNLSIQLT  203

Query  621  FSGTDK  638
            FSGTDK
Sbjct  204  FSGTDK  209



>ref|NP_001148355.1| expp1 protein precursor [Zea mays]
 gb|ACG31007.1| expp1 protein precursor [Zea mays]
Length=244

 Score =   233 bits (594),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 141/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNSVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  85   VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSTPIFVSNTSVTVSSFTLVL  144

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSG
Sbjct  145  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  203

Query  630  TDK  638
            TDK
Sbjct  204  TDK  206



>ref|XP_010498123.1| PREDICTED: uncharacterized protein LOC104775868 [Camelina sativa]
Length=246

 Score =   233 bits (594),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 145/186 (78%), Gaps = 6/186 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  269
            D N V+SPC+D+TV   DGFTFGI FA+++ +F   S N  VQ SPCDRR LSLN N+++
Sbjct  24   DDNGVYSPCSDSTVGIGDGFTFGIAFASKD-SFFGGSTNHTVQYSPCDRRRLSLNGNSEV  82

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSNNFRPDASKGYMVAFAGSKYAARSVPIMVADSNHIVTSFT  142

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF+KGRL+N++WK+DGC+ C G + F CLN   CA+K+ + +N+GG  DCSLGIQL 
Sbjct  143  LVLEFQKGRLENMFWKKDGCSKCSGDTKFVCLNNDQCAIKSQNCKNQGGQADCSLGIQLA  202

Query  621  FSGTDK  638
            FSGTDK
Sbjct  203  FSGTDK  208



>ref|NP_001148709.1| expp1 protein precursor [Zea mays]
 gb|ACG32616.1| expp1 protein precursor [Zea mays]
Length=244

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 141/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  85   VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  144

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSG
Sbjct  145  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  203

Query  630  TDK  638
            TDK
Sbjct  204  TDK  206



>ref|NP_001140927.1| expp1 protein precursor [Zea mays]
 gb|ACF84982.1| unknown [Zea mays]
 tpg|DAA50289.1| TPA: expp1 protein [Zea mays]
Length=244

 Score =   233 bits (593),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 141/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  85   VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  144

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSG
Sbjct  145  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  203

Query  630  TDK  638
            TDK
Sbjct  204  TDK  206



>ref|XP_010486846.1| PREDICTED: uncharacterized protein LOC104764937 [Camelina sativa]
Length=246

 Score =   233 bits (593),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 145/186 (78%), Gaps = 6/186 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  269
            D N V+SPC+D+TV   DGFTFGI FA+++ +F   S N  VQ SPCDRR LSLN N+++
Sbjct  24   DDNGVYSPCSDSTVGIGDGFTFGIAFASKD-SFFGGSTNHTVQYSPCDRRRLSLNGNSEV  82

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSNNFRPDASKGYMVAFAGSKYAARSVPIMVADSNHIVTSFT  142

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF+KGRL+N++WK+DGC+ C G + F CLN   CA+K+ + +N+GG  DCSLGIQL 
Sbjct  143  LVLEFQKGRLENMFWKKDGCSKCSGDAKFVCLNTDQCAIKSQNCKNQGGQADCSLGIQLA  202

Query  621  FSGTDK  638
            FSGTDK
Sbjct  203  FSGTDK  208



>ref|XP_009759897.1| PREDICTED: uncharacterized protein LOC104212369 [Nicotiana sylvestris]
Length=237

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 140/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN VF PC+DT +Q+ DGFTFG+ F+++ + F N +     QLSPCD+RLSL  N+AQL
Sbjct  23   DTNPVFDPCSDTKIQRLDGFTFGLAFSSKESFFSNGT-----QLSPCDQRLSLSGNSAQL  77

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+ +S F P   GGYMVAFAGRKYAARS PAFVA+ ++ ++SFTLV 
Sbjct  78   AVFRPKVDEISLLTITSSDFNPSKAGGYMVAFAGRKYAARSLPAFVADNTHTITSFTLVL  137

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+ GC SC G S F CLN  DCA+  N     GG+VDC++GIQL FSG
Sbjct  138  EFQKGTLQNLFWKKFGCGSCTGGS-FVCLNKTDCAVPNNKCSGNGGSVDCNVGIQLAFSG  196

Query  630  TDK  638
            TDK
Sbjct  197  TDK  199



>ref|XP_008667260.1| PREDICTED: expp1 protein isoform X2 [Zea mays]
Length=298

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 141/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  84   DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  138

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  139  VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  198

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSG
Sbjct  199  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  257

Query  630  TDK  638
            TDK
Sbjct  258  TDK  260



>ref|XP_008667257.1| PREDICTED: expp1 protein isoform X1 [Zea mays]
Length=320

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 141/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  106  DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  160

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  161  VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  220

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSG
Sbjct  221  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  279

Query  630  TDK  638
            TDK
Sbjct  280  TDK  282



>ref|XP_002464167.1| hypothetical protein SORBIDRAFT_01g013420 [Sorghum bicolor]
 gb|EER91165.1| hypothetical protein SORBIDRAFT_01g013420 [Sorghum bicolor]
Length=244

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NA  263
            +++DTN V+ PC+D  +Q+ DGFTFG+VFA  N  F     + + QLSPCDRRL+L  + 
Sbjct  27   AAADTNGVYEPCSDARIQRGDGFTFGVVFAGYNTFF-----SGNTQLSPCDRRLNLAASG  81

Query  264  QLAVFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            QLA+FRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFT
Sbjct  82   QLALFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSVPIFVSNTSVTVSSFT  141

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T S + + G VDCS+GIQL 
Sbjct  142  LVLEFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKTQ-GPVDCSIGIQLA  200

Query  621  FSGTDK  638
            FSGTDK
Sbjct  201  FSGTDK  206



>gb|ACL53994.1| unknown [Zea mays]
Length=244

 Score =   230 bits (587),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 141/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDGRIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  85   VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  144

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRL+NL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSG
Sbjct  145  EFNKGRLENLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  203

Query  630  TDK  638
            TDK
Sbjct  204  TDK  206



>gb|ABF97892.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG91851.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87811.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59593.1| hypothetical protein OsJ_11902 [Oryza sativa Japonica Group]
Length=245

 Score =   230 bits (587),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 139/183 (76%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            D N V+ PC+DT +Q+ DGF+FGI FA   A +   S    VQLSPCDRRLSL ++ QLA
Sbjct  30   DENGVYDPCSDTRIQRGDGFSFGIAFATLGAFYSGGS----VQLSPCDRRLSLASSGQLA  85

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV 
Sbjct  86   VFRPKVDEISLLTINTTTGFNPATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVL  145

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C  SS   C+  Q CA +T S +++ G VDCS+GIQL FSG
Sbjct  146  EFNKGRLQNLHWKKDGCGACAKSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSG  204

Query  630  TDK  638
            TDK
Sbjct  205  TDK  207



>emb|CDY08494.1| BnaA05g27300D [Brassica napus]
 emb|CDY01059.1| BnaC05g41410D [Brassica napus]
Length=245

 Score =   230 bits (587),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 143/190 (75%), Gaps = 9/190 (5%)
 Frame = +3

Query  87   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-N  260
            S+ D NHV+SPC+D+TV   DGFTFGI FAA+++       N+ VQ SPCDRR LSLN N
Sbjct  21   SAGDDNHVYSPCSDSTVAVGDGFTFGIAFAAKDSFL---GTNRSVQYSPCDRRRLSLNGN  77

Query  261  AQLAVFRPKVDEISLLTVNTSSFFPDSVG----GYMVAFAGRKYAARSPPAFVANGSYIV  428
            ++LAVFRPKVDEI+LLT+NTSS           GYMVAFAG KYAARS P  VA+  ++V
Sbjct  78   SELAVFRPKVDEITLLTINTSSSSSSYRPDSSKGYMVAFAGAKYAARSVPIMVADNDHVV  137

Query  429  SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLG  608
            +SFTLV EF+KGRL+NL+WK+DGC+ C G + F CLN ++CA+K  S  N+GG VDCSLG
Sbjct  138  TSFTLVLEFQKGRLENLFWKKDGCSKCTGDAKFVCLNKEECAIKRQSCTNQGGQVDCSLG  197

Query  609  IQLTFSGTDK  638
            IQL FSGTDK
Sbjct  198  IQLAFSGTDK  207



>gb|EYU37728.1| hypothetical protein MIMGU_mgv1a012673mg [Erythranthe guttata]
 gb|EYU37729.1| hypothetical protein MIMGU_mgv1a012673mg [Erythranthe guttata]
Length=243

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 141/183 (77%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN VF PC+DT VQKSDGFTFG+ F+++++ F N +     QLSPCDRRLSL   +AQL
Sbjct  29   DTNIVFDPCSDTKVQKSDGFTFGLAFSSKDSFFFNQT-----QLSPCDRRLSLAGTSAQL  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+N+++F P   GGYMVAFAGR+YAARSPP FV + S+ ++SFTLV 
Sbjct  84   AVFRPKVDEISLLTINSTTFNPSLFGGYMVAFAGRQYAARSPPVFVGDSSHTITSFTLVL  143

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+ GC+SC G S   CLN  DCA+  +  +   G++DC +G+QL FSG
Sbjct  144  EFQKGILQNLFWKKFGCSSCSGPS-LVCLNNTDCAVLNSKCKGNDGDIDCGVGVQLAFSG  202

Query  630  TDK  638
            TDK
Sbjct  203  TDK  205



>gb|EEC77546.1| hypothetical protein OsI_16454 [Oryza sativa Indica Group]
Length=247

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 140/183 (77%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            D N V+ PC+DT +Q+ DGF+FGI FA+  A +   S    VQLSPCDRRLSL ++ QLA
Sbjct  32   DENGVYDPCSDTRIQRGDGFSFGIAFASLGAFYSGGS----VQLSPCDRRLSLASSGQLA  87

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV 
Sbjct  88   VFRPKVDEISLLTINTTTGFNPATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVL  147

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C  SS   C+  Q CA +T S +++ G VDCS+GIQL FSG
Sbjct  148  EFNKGRLQNLHWKKDGCGACAKSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSG  206

Query  630  TDK  638
            TDK
Sbjct  207  TDK  209



>ref|XP_009146681.1| PREDICTED: uncharacterized protein LOC103870308 [Brassica rapa]
Length=247

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 143/190 (75%), Gaps = 9/190 (5%)
 Frame = +3

Query  87   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-N  260
            S+ D NHV+SPC+D+TV   DGFTFGI FAA+++       N+ VQ SPCDRR LSLN N
Sbjct  23   SAGDDNHVYSPCSDSTVAVGDGFTFGIAFAAKDSFL---GTNRSVQYSPCDRRRLSLNGN  79

Query  261  AQLAVFRPKVDEISLLTVNTSSFFPDSV----GGYMVAFAGRKYAARSPPAFVANGSYIV  428
            ++LAVFRPKVDEI+LLT+NTSS           GYMVAFAG KYAARS P  VA+  ++V
Sbjct  80   SELAVFRPKVDEITLLTINTSSSSSSYRPDSSNGYMVAFAGAKYAARSVPIMVADNDHVV  139

Query  429  SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLG  608
            +SFTLV EF+KGRL+NL+WK+DGC+ C G + F CLN ++CA+K  S  N+GG VDCSLG
Sbjct  140  TSFTLVLEFQKGRLENLFWKKDGCSKCTGDAKFVCLNKEECAIKRQSCTNQGGQVDCSLG  199

Query  609  IQLTFSGTDK  638
            IQL FSGTDK
Sbjct  200  IQLAFSGTDK  209



>emb|CAN82373.1| hypothetical protein VITISV_027624 [Vitis vinifera]
Length=249

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 144/194 (74%), Gaps = 18/194 (9%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  269
            DTN VF PC+D  V++ DGFTFG+ F+ +++ F N +     QLSPCDRRLSL+  N+QL
Sbjct  23   DTNXVFDPCSDAKVKRFDGFTFGLAFSTKDSFFFNQT-----QLSPCDRRLSLSSTNSQL  77

Query  270  AVFRPKVDEISLLTVNTSSFFP-----------DSVGGYMVAFAGRKYAARSPPAFVANG  416
            AVFRPKVDEISLLTVN+++F P            S GGYMVAFAGRKYAARS P  VA+G
Sbjct  78   AVFRPKVDEISLLTVNSTNFNPVWFNDFLVFSQISNGGYMVAFAGRKYAARSTPVLVADG  137

Query  417  SYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVD  596
             + ++SFTLV EFKKG LQ+ YWK+ GC+ C  SS F CLN QDCA+K++  +N+GG++D
Sbjct  138  QHTITSFTLVLEFKKGTLQSFYWKKFGCSKCSKSSAFVCLNEQDCAVKSSHCKNQGGSID  197

Query  597  CSLGIQLTFSGTDK  638
            C++ IQL FSGTDK
Sbjct  198  CNISIQLIFSGTDK  211



>ref|XP_009590990.1| PREDICTED: uncharacterized protein LOC104088076 [Nicotiana tomentosiformis]
 ref|XP_009590991.1| PREDICTED: uncharacterized protein LOC104088076 [Nicotiana tomentosiformis]
Length=237

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 139/183 (76%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN VF PC+DT +Q+ DGFTFG+ F+++ + F N +     QLSPCD+RLSL  N+AQL
Sbjct  23   DTNPVFDPCSDTKIQRWDGFTFGLAFSSKESFFSNGT-----QLSPCDQRLSLSANSAQL  77

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLT+ +S F P   G YMVAFAGRKYAARS PAFVA+ ++ ++SFTLV 
Sbjct  78   AVFRPKVDEISLLTITSSDFNPSKAGSYMVAFAGRKYAARSLPAFVADNTHTITSFTLVL  137

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+ GC SC G S F CLN  DCA+  N     GG+VDC++GIQL FSG
Sbjct  138  EFQKGALQNLFWKKFGCGSCTGGS-FVCLNKTDCAVPNNKCNGNGGSVDCNVGIQLAFSG  196

Query  630  TDK  638
            TDK
Sbjct  197  TDK  199



>ref|NP_001050775.2| Os03g0647800 [Oryza sativa Japonica Group]
 dbj|BAF12689.2| Os03g0647800, partial [Oryza sativa Japonica Group]
Length=263

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 139/183 (76%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            D N V+ PC+DT +Q+ DGF+FGI FA   A +   S    VQLSPCDRRLSL ++ QLA
Sbjct  48   DENGVYDPCSDTRIQRGDGFSFGIAFATLGAFYSGGS----VQLSPCDRRLSLASSGQLA  103

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV 
Sbjct  104  VFRPKVDEISLLTINTTTGFNPATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVL  163

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C  SS   C+  Q CA +T S +++ G VDCS+GIQL FSG
Sbjct  164  EFNKGRLQNLHWKKDGCGACAKSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSG  222

Query  630  TDK  638
            TDK
Sbjct  223  TDK  225



>ref|XP_002519146.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43357.1| conserved hypothetical protein [Ricinus communis]
Length=237

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 143/188 (76%), Gaps = 9/188 (5%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--  254
            A +++D+N VFSPC+D  ++KSDGFTFG+ F+++ + F +      VQLSPCD RL+L  
Sbjct  20   AANAADSNDVFSPCSDAKIEKSDGFTFGLAFSSKESFFFDH-----VQLSPCDSRLALFS  74

Query  255  NNAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
              AQLAVFRPKVDEISLLT+N+S+F P   GGYMVAFAGRKYAARS P  VA+   IV+S
Sbjct  75   KMAQLAVFRPKVDEISLLTINSSTFNPGMSGGYMVAFAGRKYAARSFPVMVADNGIIVTS  134

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EF++G LQNLYWK  GC  C  S  F CLNG+DCA+  +  ++ GG++DC+LG+Q
Sbjct  135  FTLVLEFQQGILQNLYWKSFGCDKC--SKDFVCLNGKDCAVHNSKCRSNGGHIDCNLGVQ  192

Query  615  LTFSGTDK  638
            LTFSGTDK
Sbjct  193  LTFSGTDK  200



>ref|XP_003559352.1| PREDICTED: uncharacterized protein LOC100825968 [Brachypodium 
distachyon]
Length=248

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 142/190 (75%), Gaps = 11/190 (6%)
 Frame = +3

Query  84   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-  260
            E+  D N V+ PCAD TVQ+ DGFTFG+ F++R++ F     + DVQLSPCD RL+L + 
Sbjct  27   EARGDGNGVYEPCADATVQRGDGFTFGVAFSSRDSFF-----SGDVQLSPCDSRLNLQSR  81

Query  261  AQLAVFRPKVDEISLLTVNTS---SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVS  431
            A LA+FRP VDEISLLT+N S   +F P S GGYMVAFAGRKYAARSPP FV+N SY V+
Sbjct  82   APLALFRPMVDEISLLTINASGGTAFDPASAGGYMVAFAGRKYAARSPPVFVSNSSYTVT  141

Query  432  SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRG-GNVDCSLG  608
             FTLV EF+KG LQN +WK DGC+SC G S F C++ Q CA+KT+S +  G G VDCS G
Sbjct  142  GFTLVLEFQKGILQNFFWKTDGCSSCSGQSDFACVD-QSCAIKTSSCKGNGAGQVDCSPG  200

Query  609  IQLTFSGTDK  638
            IQL FSGTDK
Sbjct  201  IQLAFSGTDK  210



>ref|XP_009135184.1| PREDICTED: uncharacterized protein LOC103859409 [Brassica rapa]
 emb|CDX73852.1| BnaA03g31950D [Brassica napus]
Length=245

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 142/187 (76%), Gaps = 9/187 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  269
            D N V+SPC+D+TV   DGFTFGI FAAR + F     N+ VQ SPCDRR LSL+ N++L
Sbjct  24   DDNRVYSPCSDSTVAVGDGFTFGIAFAARASFF---GTNRSVQYSPCDRRRLSLSGNSEL  80

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVG----GYMVAFAGRKYAARSPPAFVANGSYIVSSF  437
            AVFRPKVDEI+LLT+NTSS           GYMVAFAG KYAARS P  VA+  ++V+SF
Sbjct  81   AVFRPKVDEITLLTINTSSSSSSFRPDSSKGYMVAFAGAKYAARSVPIMVADNDHVVTSF  140

Query  438  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQL  617
            TLV EF+KGRL+NL+WK+DGC+ C G++ F CLN ++CA+K  S +N+GG VDCSLGIQL
Sbjct  141  TLVLEFQKGRLENLFWKKDGCSKCSGNAKFVCLNKEECAIKRQSCKNQGGQVDCSLGIQL  200

Query  618  TFSGTDK  638
             FSGTDK
Sbjct  201  AFSGTDK  207



>ref|XP_006651887.1| PREDICTED: uncharacterized protein LOC102713815, partial [Oryza 
brachyantha]
Length=222

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 139/186 (75%), Gaps = 11/186 (6%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            +TN V+ PCAD TVQ+ DGFTFG+ F+ R+A F     +  VQLSPCD RLSL    A+L
Sbjct  5    ETNGVYEPCADATVQRGDGFTFGVAFSGRDAFF-----SGGVQLSPCDSRLSLASGGAKL  59

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRPKVDEISLLTVNTS      P +  GYMVAFAGRKYAARS P FV+N SY V+S+T
Sbjct  60   AVFRPKVDEISLLTVNTSGGGGVDPATSDGYMVAFAGRKYAARSSPVFVSNISYTVTSYT  119

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LVFEFKKG LQNLYWK +GC++C G   F C++ Q+CA+ T +   +GG+VDCS GIQL 
Sbjct  120  LVFEFKKGTLQNLYWKANGCSACSGQPSFACVD-QNCAISTANCTGKGGSVDCSPGIQLA  178

Query  621  FSGTDK  638
            FSGTDK
Sbjct  179  FSGTDK  184



>ref|XP_006651640.1| PREDICTED: uncharacterized protein LOC102702926, partial [Oryza 
brachyantha]
Length=217

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 139/183 (76%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQLA  272
            D N V+ PC+D  +Q+ DGF+FGI FA   A F + S    V+LSPCDRRL+L + AQLA
Sbjct  3    DGNGVYDPCSDARIQRGDGFSFGIAFA-NAAAFYSGS----VELSPCDRRLNLASPAQLA  57

Query  273  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLT+NT++ F P S GGYMVAFAGRKYAARS P FV+N S+ VSSFTLV 
Sbjct  58   VFRPKVDEISLLTINTTTGFNPASAGGYMVAFAGRKYAARSTPTFVSNSSFTVSSFTLVL  117

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KGRLQNL+WK+DGC +C  SS   CL  Q CA +T S +++ G VDCS+GIQL FSG
Sbjct  118  EFNKGRLQNLHWKKDGCGACAKSSNLVCLGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSG  176

Query  630  TDK  638
            TDK
Sbjct  177  TDK  179



>emb|CDO97124.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 145/188 (77%), Gaps = 8/188 (4%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  257
            A  + DTN  F PC+D  VQ+SDGF+FG+ F+++++ F N +     QLSPCD+RLSL+ 
Sbjct  18   AVHAGDTNPEFDPCSDAKVQRSDGFSFGLAFSSKDSFFFNQT-----QLSPCDQRLSLSA  72

Query  258  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             +AQLA+FRPKVDE+SLLT+N+S+F P + GGYMVAFAGR+YAARS P FVA+ +  V+S
Sbjct  73   KSAQLAIFRPKVDEMSLLTINSSTFDPRNSGGYMVAFAGRRYAARSIPVFVADNAQTVTS  132

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EF+KG LQNL+WK+ GC +C G S F C+N  DCA++ +  +  GG++DC++GIQ
Sbjct  133  FTLVLEFQKGTLQNLFWKKYGCDACSGDS-FVCMNNTDCAIRNSKCKGNGGSLDCNIGIQ  191

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  192  LAFSGTDK  199



>gb|EPS70295.1| hypothetical protein M569_04465, partial [Genlisea aurea]
Length=227

 Score =   222 bits (566),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 140/186 (75%), Gaps = 10/186 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN V+SPC+D  VQK+DGFTFG+ F++RN+ F N +     QLSPCD RLSL   NAQL
Sbjct  17   DTNPVYSPCSDAKVQKNDGFTFGLAFSSRNSFFFNQT-----QLSPCDNRLSLAGTNAQL  71

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            A+FRPKVDEI+LLTVN+S+F P   GGYMVAFAGR+YAARS P FVA+ ++ ++SFTLVF
Sbjct  72   AIFRPKVDEITLLTVNSSTFNPSLAGGYMVAFAGRQYAARSQPVFVADNTHTITSFTLVF  131

Query  450  EFKKGRLQNLYWKR---DGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            EF+KG L+NLYWK+      +   G +   CLNG DCA++++   + GG V+C LGIQL 
Sbjct  132  EFQKGTLENLYWKKFGCSSSSCGGGGASLVCLNGTDCAVQSSQCTSNGGTVECDLGIQLA  191

Query  621  FSGTDK  638
            FSGTDK
Sbjct  192  FSGTDK  197



>ref|XP_006407410.1| hypothetical protein EUTSA_v10021362mg [Eutrema salsugineum]
 gb|ESQ48863.1| hypothetical protein EUTSA_v10021362mg [Eutrema salsugineum]
Length=257

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 145/200 (73%), Gaps = 17/200 (9%)
 Frame = +3

Query  87   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-N  260
             + D N V+SPC+D+TV   DGFTFGI FAAR+ +F   +++  VQ SPCDRR LSLN N
Sbjct  21   EAGDDNRVYSPCSDSTVAIGDGFTFGIAFAARD-SFFGTNRSVRVQYSPCDRRRLSLNGN  79

Query  261  AQLAVFRPKVDEISLLTVNTSSFFPDSVG----GYMVAFAGRKYAARSPPAFVANGSYIV  428
            ++LAVFRPKVDEI+LLT+NTSS           GYMVAFAG KYAARS P  VA+  +IV
Sbjct  80   SELAVFRPKVDEITLLTINTSSSSSSFRPDSSKGYMVAFAGAKYAARSVPIMVADNDHIV  139

Query  429  SSFTL----------VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQN  578
            +SFTL          V EF+KGRL+NL+WK+DGC+ C G + F CLN ++CA+KT + +N
Sbjct  140  TSFTLFCNIHLSTRLVLEFQKGRLENLFWKKDGCSKCSGDAKFVCLNKEECAIKTQNCKN  199

Query  579  RGGNVDCSLGIQLTFSGTDK  638
            RGG VDCSLGIQL FSGTDK
Sbjct  200  RGGQVDCSLGIQLAFSGTDK  219



>ref|XP_011088314.1| PREDICTED: uncharacterized protein LOC105169588 [Sesamum indicum]
Length=242

 Score =   222 bits (566),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            + DTN  FSPC+D  VQ+ DGFTFG+ F+++ + F N +     QLSPCDRRLSL+  NA
Sbjct  26   AGDTNIEFSPCSDAKVQRFDGFTFGLAFSSKESFFFNQT-----QLSPCDRRLSLSGYNA  80

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRPKVDEISLLT+N+++F P   GGYMVAFAGR+YAARS P FVA+    ++SFTL
Sbjct  81   QLAVFRPKVDEISLLTINSAAFNPSKAGGYMVAFAGRQYAARSIPVFVADDINTITSFTL  140

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V +F+KG LQNL+WK+ GC SC G+S F CLN  DCA+  +  ++ GG++ C LGIQ+TF
Sbjct  141  VLDFRKGTLQNLFWKKFGCGSCTGNS-FVCLNNTDCAVPNSKCKSNGGSIGCDLGIQVTF  199

Query  624  SGTDK  638
            SGTD+
Sbjct  200  SGTDR  204



>ref|XP_010690983.1| PREDICTED: uncharacterized protein LOC104904437 [Beta vulgaris 
subsp. vulgaris]
Length=241

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 8/182 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            DTN V  PC DT VQ+ DGFTFG+ F+++ + +  D     VQLSPCD RL L N AQLA
Sbjct  32   DTNPVHDPCTDTKVQRWDGFTFGLAFSSKESFYAPDQ----VQLSPCDSRLQLVNKAQLA  87

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            VFRP+VDEISLLT+N S+F PD+ GGYMVAFAGR YAARSPP FVA+ + IV+SFTLV E
Sbjct  88   VFRPRVDEISLLTIN-STFSPDTSGGYMVAFAGRAYAARSPPVFVADSTNIVTSFTLVLE  146

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F+KG LQNLYWK+ GC SCK      C + Q+CA+ T+  +++GG +DC++ IQLTFSGT
Sbjct  147  FEKGILQNLYWKKFGCDSCKDYH--ICKDNQECAVPTSKCKDKGGPIDCTISIQLTFSGT  204

Query  633  DK  638
            D+
Sbjct  205  DR  206



>gb|KDP38260.1| hypothetical protein JCGZ_04903 [Jatropha curcas]
Length=238

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 137/183 (75%), Gaps = 9/183 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            DTN VFSPC D  V KSDGFTFG+ F+++ + F +      VQLSPCD RLSL+   AQL
Sbjct  26   DTNDVFSPCLDAKVAKSDGFTFGLAFSSKESFFFDQ-----VQLSPCDIRLSLSTKTAQL  80

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            ++FRP VDE+SLLT+N+++F P   GGYMVAFAGRKYAARS P  +A+ + I++SFTLV 
Sbjct  81   SIFRPIVDELSLLTINSTTFDPVKFGGYMVAFAGRKYAARSLPIMMADNNLIITSFTLVL  140

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF++G LQNLYWK  GC +C  SSGF CLN +DCA++T+     GG++DCS  IQL FSG
Sbjct  141  EFQEGTLQNLYWKNFGCETC--SSGFVCLNEKDCAIQTSKCTVHGGSIDCSPSIQLAFSG  198

Query  630  TDK  638
            TDK
Sbjct  199  TDK  201



>ref|XP_008374037.1| PREDICTED: uncharacterized protein LOC103437345 [Malus domestica]
 ref|XP_008374038.1| PREDICTED: uncharacterized protein LOC103437345 [Malus domestica]
Length=239

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 136/185 (74%), Gaps = 8/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            ++DTN V+ PC+D  +Q+ DGFTFG+ F+ ++  F N +     QLSPCD+RLSL  N+A
Sbjct  33   AADTNSVYDPCSDAKIQRLDGFTFGLAFSKKDKFFFNQT-----QLSPCDKRLSLTGNDA  87

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRPKVDE+S L++N S+F P   GGYMVAFAGRKYAARSPP  VA+ S+ ++SFTL
Sbjct  88   QLAVFRPKVDEMSFLSINNSTFSPIKAGGYMVAFAGRKYAARSPPILVADDSHTITSFTL  147

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G L NLYWK+ GC +C G     CLN +DCA+  +  +  GG+ DC+L IQL F
Sbjct  148  VLEFERGTLLNLYWKKFGCKACSGDYS-VCLNDEDCAVPNSKCKGSGGSFDCNLSIQLAF  206

Query  624  SGTDK  638
            SGTDK
Sbjct  207  SGTDK  211



>ref|XP_010526940.1| PREDICTED: uncharacterized protein LOC104804369 [Tarenaya hassleriana]
 ref|XP_010526941.1| PREDICTED: uncharacterized protein LOC104804369 [Tarenaya hassleriana]
Length=246

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 135/183 (74%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN VFSPC+D  + K DGFTFG+V +++ A F     N  +QLSPCD RL L   NA+L
Sbjct  35   DTNGVFSPCSDVQISKGDGFTFGVVISSKEAFF-----NNKIQLSPCDSRLGLASKNAKL  89

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            A+FRPKVDEISLL+++T+ F P   GG+MVAFAG KYAARS PA +A+GS  ++SFTLV 
Sbjct  90   ALFRPKVDEISLLSIDTTQFSPSEAGGHMVAFAGSKYAARSFPAKIADGSNTITSFTLVM  149

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK  GC SCK  S   CLNG DCA+ ++  +  GG V+C +GIQLTFSG
Sbjct  150  EFQKGTLQNLFWKSFGCDSCKSGSS-VCLNGTDCAVPSSKCKGNGGRVNCDIGIQLTFSG  208

Query  630  TDK  638
            TDK
Sbjct  209  TDK  211



>ref|XP_010263791.1| PREDICTED: uncharacterized protein LOC104601968 isoform X4 [Nelumbo 
nucifera]
Length=235

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 129/183 (70%), Gaps = 23/183 (13%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            DTN ++ PC+D  + KSDGFT G+ F+++ + F      + +QLSPCDRRLSL+   AQL
Sbjct  36   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFFF-----EKIQLSPCDRRLSLSTKIAQL  90

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPK                D  GGYMVAFAGRKYAARS P FVAN SYI++SFTLV 
Sbjct  91   AVFRPK----------------DMYGGYMVAFAGRKYAARSQPTFVANSSYIITSFTLVL  134

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF+KG LQNL+WK+DGCA+C G S F CLN QDCA + ++ Q+ GG  DCSLGIQL FSG
Sbjct  135  EFQKGTLQNLHWKKDGCATCAGKSSFICLNLQDCATRISNCQSHGGPFDCSLGIQLAFSG  194

Query  630  TDK  638
            TDK
Sbjct  195  TDK  197



>ref|XP_010096267.1| hypothetical protein L484_027004 [Morus notabilis]
 gb|EXB63662.1| hypothetical protein L484_027004 [Morus notabilis]
Length=242

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            ++DTN V+ PC+D+ VQK DGFTFG+ F+ + + F N +     QLSPCD+RLSL+  N+
Sbjct  26   AADTNDVYDPCSDSKVQKLDGFTFGLAFSTKESFFFNQT-----QLSPCDKRLSLSDSNS  80

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRPKVDEISLL+++ ++F P + GGYMVAFAGR YAARS P  VA+ ++ ++SFTL
Sbjct  81   QLAVFRPKVDEISLLSIDGNTFDPATSGGYMVAFAGRNYAARSQPILVADSTHSITSFTL  140

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+ G LQNLYWK+ GC  C G   F CLN QDCA+  +  ++ GG  DC+L IQLTF
Sbjct  141  VLEFQSGTLQNLYWKKFGCDKCSGGP-FVCLNEQDCAVPNSKCKSNGGTFDCNLSIQLTF  199

Query  624  SGTDK  638
            SGTDK
Sbjct  200  SGTDK  204



>ref|XP_004981507.1| PREDICTED: uncharacterized protein LOC101763233 [Setaria italica]
Length=244

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 137/182 (75%), Gaps = 7/182 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQLA  272
            D N V+ PCADTTV + DGFTFG+ F  R+A F     +  VQLSPCD RL L+N AQ+A
Sbjct  31   DRNGVYDPCADTTVGRGDGFTFGVAFTGRDAFF-----SGGVQLSPCDSRLGLSNRAQVA  85

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            +FRP+VDEISLLT+N+SSF P S GGYMVAFAGRKYAARS P FV N SY V+SFTLV E
Sbjct  86   LFRPQVDEISLLTINSSSFDPSSSGGYMVAFAGRKYAARSAPVFVGNSSYTVTSFTLVLE  145

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F+KGRL+NL+WK   C SC G + F C++ + CA+KT S + +GG  DCS GIQL FSGT
Sbjct  146  FQKGRLENLFWKDGDCKSCSGRADFACVD-KSCAVKTTSCKGKGGQADCSPGIQLAFSGT  204

Query  633  DK  638
            DK
Sbjct  205  DK  206



>ref|XP_007199436.1| hypothetical protein PRUPE_ppa026636mg [Prunus persica]
 gb|EMJ00635.1| hypothetical protein PRUPE_ppa026636mg [Prunus persica]
Length=214

 Score =   214 bits (545),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            ++DTN V+ PC+D  +++ DGFTFG+ F+ +++   N +     QLSPCD RL+L  NNA
Sbjct  8    AADTNSVYDPCSDAKIRRLDGFTFGLAFSKKDSFAFNQT-----QLSPCDSRLNLAGNNA  62

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRPKVDE+SLLT+N+S+F P + GGYMVAFAGRKYAARS P  +A+ S  ++SFTL
Sbjct  63   QLAVFRPKVDEMSLLTINSSTFSPINAGGYMVAFAGRKYAARSLPTLIADESNTITSFTL  122

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G LQNLYWK+ GC +C G     CLN +DCA+  +  ++ GG+ DC+L IQL F
Sbjct  123  VLEFQRGTLQNLYWKKFGCKACSGDYS-VCLNNEDCAVPNSKCKSSGGSFDCNLSIQLAF  181

Query  624  SGTDK  638
            SGTDK
Sbjct  182  SGTDK  186



>ref|XP_008236692.1| PREDICTED: uncharacterized protein LOC103335461 [Prunus mume]
Length=233

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 137/185 (74%), Gaps = 8/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            ++DTN V+ PC+D  +++ DGFTFG+ F+ +++   N +     QLSPCD RL+L  NNA
Sbjct  27   AADTNSVYDPCSDAKIRRLDGFTFGLAFSKKDSFSFNQT-----QLSPCDSRLNLAGNNA  81

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRPKVDE+SLLT+N+S+F P   GGYMVAFAGRKYAARS P  VA+ S  ++SFTL
Sbjct  82   QLAVFRPKVDEMSLLTINSSTFSPIKAGGYMVAFAGRKYAARSLPTLVADDSNTITSFTL  141

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G LQNLYWK+ GC +C G     CLN +DCA+  +  ++ GG+ DC+L IQL F
Sbjct  142  VLEFQRGTLQNLYWKKFGCKACSGDYS-VCLNNEDCAVPNSKCKSSGGSFDCNLSIQLAF  200

Query  624  SGTDK  638
            SGTDK
Sbjct  201  SGTDK  205



>ref|XP_003561838.1| PREDICTED: uncharacterized protein LOC100825689 [Brachypodium 
distachyon]
Length=243

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 141/185 (76%), Gaps = 10/185 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQLA  272
            DTN V+ PC+D+ +Q+ DGFTFG+ FA  +A F     +   QLSPCDRRL+L N +QLA
Sbjct  27   DTNGVYDPCSDSRIQRGDGFTFGLAFAGSSAFF-----SGSTQLSPCDRRLNLANPSQLA  81

Query  273  VFRPKVDEISLLTVNTSS-FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            VFRPKVDEISLLTVNT++ F P S GGYMVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  82   VFRPKVDEISLLTVNTTTGFSPASAGGYMVAFAGRKYAARSAPVFVSNSSVTVSSFTLVL  141

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTN--SXQNRGGNVDCSLGIQLTF  623
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++TN    QN+ G +DCS+GIQL F
Sbjct  142  EFNKGRLQNLHWKKDGCGACSGKSNFICLGKQTCAIRTNVCKSQNQ-GTMDCSIGIQLAF  200

Query  624  SGTDK  638
            SGTDK
Sbjct  201  SGTDK  205



>ref|NP_001149996.1| expp1 protein precursor [Zea mays]
 gb|ACG37435.1| expp1 protein precursor [Zea mays]
 gb|AFW67425.1| expp1 protein [Zea mays]
Length=244

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 7/182 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            D N V+ PCAD +VQ+ DGFTFG+VF+ R++       +  VQLSPCD RL L N AQ+A
Sbjct  31   DHNGVYDPCADASVQRGDGFTFGVVFSGRDSF-----SSGGVQLSPCDSRLGLANRAQVA  85

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            +FRP+VDEISLLTVN+SSF P S G YMVAFAG+KYAARSPP FV N SY V+ FTLV E
Sbjct  86   LFRPQVDEISLLTVNSSSFDPSSSGVYMVAFAGKKYAARSPPVFVGNISYTVTGFTLVLE  145

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F+KG LQNL+WK  GC+SC G S F C++G  CA++T S + +GG V+CS GIQL FSGT
Sbjct  146  FQKGTLQNLFWKAGGCSSCSGRSDFACVDG-SCAVRTASCRGKGGQVECSPGIQLAFSGT  204

Query  633  DK  638
            D+
Sbjct  205  DR  206



>ref|XP_010517082.1| PREDICTED: uncharacterized protein LOC104792590 [Camelina sativa]
Length=233

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 7/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            +SD N V+SPC+DT + K DGFT G+  ++R A F++      VQLSPCD RL L    A
Sbjct  19   ASDNNAVYSPCSDTQISKGDGFTIGLAISSREAFFLDQ-----VQLSPCDSRLGLAAKMA  73

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS P  VA+GS  +++FTL
Sbjct  74   QLALFRPKVDEISLLSIDTSKFNPSKAGGYMVGFAGSKYAARSYPVKVADGSNTITAFTL  133

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KG LQNL+WK  GC  CKG +   CLNG DCA+ T+  +  GG  +C++GIQ+ F
Sbjct  134  VMEFQKGVLQNLFWKSFGCDMCKGGTSSVCLNGTDCAVPTSKCKANGGEANCNIGIQVAF  193

Query  624  SGTDK  638
            SGTDK
Sbjct  194  SGTDK  198



>ref|XP_010467337.1| PREDICTED: uncharacterized protein LOC104747407 [Camelina sativa]
Length=239

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 7/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            +SD N V+SPC+DT + K DGFT G+  ++R A F++      VQLSPCD RL L    A
Sbjct  25   ASDNNAVYSPCSDTQISKGDGFTIGLAISSREAFFLDQ-----VQLSPCDSRLGLAAKMA  79

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS P  VA+GS  +++FTL
Sbjct  80   QLALFRPKVDEISLLSIDTSKFNPSKAGGYMVGFAGSKYAARSYPVKVADGSNTITAFTL  139

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KG LQNL+WK  GC  CKG +   CLNG DCA+ T+  +  GG  +C++GIQ+ F
Sbjct  140  VMEFQKGVLQNLFWKSFGCDMCKGGTSSVCLNGTDCAVPTSKCKANGGEANCNIGIQVAF  199

Query  624  SGTDK  638
            SGTDK
Sbjct  200  SGTDK  204



>ref|XP_008459230.1| PREDICTED: uncharacterized protein LOC103498418 [Cucumis melo]
 ref|XP_008459231.1| PREDICTED: uncharacterized protein LOC103498418 [Cucumis melo]
 ref|XP_008459232.1| PREDICTED: uncharacterized protein LOC103498418 [Cucumis melo]
Length=235

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 136/183 (74%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN V+SPC D+ +Q+SDGFTFG+ F+++ + F        +Q SPCD RLSL   NAQL
Sbjct  24   DTNDVYSPCLDSKIQRSDGFTFGVAFSSKESFF-----QDQIQFSPCDARLSLASKNAQL  78

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVD++S LT++TS+F P   GGYMVAFAG+KYAARS P  V + S+ ++SFTLVF
Sbjct  79   AVFRPKVDQLSFLTIDTSTFNPALNGGYMVAFAGQKYAARSLPVMVTDNSHTITSFTLVF  138

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF++G LQNL+WK+ GC  C G     C++ QDCA+ ++  +  GG+VDC+LGIQL FSG
Sbjct  139  EFERGTLQNLFWKKFGCDKCSGDFSL-CVDNQDCAILSSKCKYSGGSVDCNLGIQLAFSG  197

Query  630  TDK  638
            TDK
Sbjct  198  TDK  200



>ref|XP_006299440.1| hypothetical protein CARUB_v10015605mg, partial [Capsella rubella]
 gb|EOA32338.1| hypothetical protein CARUB_v10015605mg, partial [Capsella rubella]
Length=247

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 132/185 (71%), Gaps = 7/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            +SD N V+SPC+DT + K DGFT G+  +++ A F++      VQLSPCD RL L    A
Sbjct  33   ASDNNAVYSPCSDTQISKGDGFTIGVAISSKEAFFLDQ-----VQLSPCDSRLGLAAKMA  87

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS PA V +GS  +++FTL
Sbjct  88   QLALFRPKVDEISLLSIDTSKFSPSEAGGYMVGFAGSKYAARSYPAKVVDGSNTITAFTL  147

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KG LQNL+WK  GC  CKG +   CLNG DCA+ T+  +  GG  +C++GIQ+ F
Sbjct  148  VMEFQKGVLQNLFWKSFGCDLCKGGTSSVCLNGTDCAVPTSKCKANGGEANCNIGIQVAF  207

Query  624  SGTDK  638
            SGTDK
Sbjct  208  SGTDK  212



>ref|XP_009136289.1| PREDICTED: uncharacterized protein LOC103860439 [Brassica rapa]
Length=241

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 131/183 (72%), Gaps = 7/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            D N V+SPC+DT + K DGFT G+  +++ A F++      +QLSPCD RL L    AQL
Sbjct  29   DNNVVYSPCSDTEISKGDGFTVGVAISSKEAFFLDQ-----IQLSPCDSRLGLAAKMAQL  83

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            A+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS PA VA+GS+ ++SFTLV 
Sbjct  84   ALFRPKVDEISLLSIDTSKFNPSEAGGHMVGFAGSKYAARSYPAKVADGSHTITSFTLVM  143

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF++G LQNL+W   GC SCKG S   CLNG DCA+ T   +  GG  +C++GIQ+ FSG
Sbjct  144  EFQRGVLQNLFWNNFGCDSCKGGSSSVCLNGTDCAVPTAKCKANGGEANCNIGIQVAFSG  203

Query  630  TDK  638
            TDK
Sbjct  204  TDK  206



>ref|XP_009417070.1| PREDICTED: uncharacterized protein LOC103997543 [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 136/183 (74%), Gaps = 6/183 (3%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            D N VF PCAD  VQ+ DGFTFGI F+ R++  +N S    +QLSPCD RLSL+   AQL
Sbjct  27   DKNSVFQPCADAKVQRWDGFTFGIAFSGRDSFLLNQS----LQLSPCDSRLSLSTRGAQL  82

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
            AVFRPKVDEISLLTVNT++    + GG+MVAFAGRKYAARS P FV N SY ++SFTLV 
Sbjct  83   AVFRPKVDEISLLTVNTTTNPSINSGGFMVAFAGRKYAARSSPVFVGNSSYAITSFTLVL  142

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF KG LQ+L+WK   C+SC G S F CL  Q CA+K  + + +GG+VDCS+GIQL FSG
Sbjct  143  EFHKGTLQDLHWKTGSCSSCSGKSSFVCLREQGCAIKAPNCKGQGGSVDCSIGIQLAFSG  202

Query  630  TDK  638
            TDK
Sbjct  203  TDK  205



>emb|CDX89683.1| BnaC03g45970D [Brassica napus]
Length=350

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 7/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            +SD N V+SPC+DT + K DGFT G+  +++ A F++      +QLSPCD RL L    A
Sbjct  136  ASDNNVVYSPCSDTEISKGDGFTVGVAISSKEAFFLDQ-----IQLSPCDSRLGLAAKMA  190

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS PA VA+GS+ ++SFTL
Sbjct  191  QLALFRPKVDEISLLSIDTSKFNPSEAGGHMVGFAGSKYAARSYPAKVADGSHTITSFTL  250

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G LQNL+W   GC SCKG S   CLNG DCA+ T   +  GG  +C++GIQ+ F
Sbjct  251  VMEFQRGVLQNLFWNNFGCDSCKGGSSSVCLNGTDCAVPTAKCKANGGEANCNIGIQVAF  310

Query  624  SGTDK  638
            SGTDK
Sbjct  311  SGTDK  315



>dbj|BAJ94664.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
            A +  D N V+ PCAD TV + DGFTFG+ FA R+A F     +  VQLSPCD RL L N
Sbjct  28   ASARGDGNGVYEPCADATVSRGDGFTFGVAFAGRDAFF-----SGGVQLSPCDGRLPLQN  82

Query  261  -AQLAVFRPKVDEISLLTVNTSSFFP-DSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             A+LA+FRP VDEISLLTVN S      S GGYMVAFAGRK+AARSPP FV N SY V+ 
Sbjct  83   TAKLALFRPTVDEISLLTVNASGAGDLTSAGGYMVAFAGRKFAARSPPVFVGNSSYTVTG  142

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQ-----NRGGNVDC  599
            FTLVFEF KG LQNL+WK DGC+SC G + F C+    CA+KT+S +        G VDC
Sbjct  143  FTLVFEFHKGTLQNLFWKADGCSSCSGQANFGCVE-NSCAIKTSSCRGGNGGGGAGQVDC  201

Query  600  SLGIQLTFSGTDK  638
            S GIQL FSGTDK
Sbjct  202  SPGIQLAFSGTDK  214



>dbj|BAJ90624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
            A +  D N V+ PCAD TV + DGFTFG+ FA R+A F     +  VQLSPCD RL L N
Sbjct  28   ASARGDGNGVYEPCADATVSRGDGFTFGVAFAGRDAFF-----SGGVQLSPCDGRLPLQN  82

Query  261  -AQLAVFRPKVDEISLLTVNTSSFFP-DSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             A+LA+FRP VDEISLLTVN S      S GGYMVAFAGRK+AARSPP FV N SY V+ 
Sbjct  83   TAKLALFRPTVDEISLLTVNASGAGDLTSAGGYMVAFAGRKFAARSPPVFVGNSSYTVTG  142

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQ-----NRGGNVDC  599
            FTLVFEF KG LQNL+WK DGC+SC G + F C+    CA+KT+S +        G VDC
Sbjct  143  FTLVFEFHKGTLQNLFWKADGCSSCSGQANFGCVE-NSCAIKTSSCRGGNGGGGAGQVDC  201

Query  600  SLGIQLTFSGTDK  638
            S GIQL FSGTDK
Sbjct  202  SPGIQLAFSGTDK  214



>emb|CDY02274.1| BnaA03g38930D [Brassica napus]
Length=350

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 7/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            +SD N V+SPC+DT + K DGFT G+  +++ A F++      +QLSPCD RL L    A
Sbjct  136  ASDNNVVYSPCSDTEISKGDGFTVGVAISSKEAFFLDQ-----IQLSPCDSRLGLAAKMA  190

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS PA VA+GS+ ++SFTL
Sbjct  191  QLALFRPKVDEISLLSIDTSKFNPSEAGGHMVGFAGSKYAARSYPAKVADGSHTITSFTL  250

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G LQNL+W   GC SCKG S   CLNG DCA+ T   +  GG  +C++GIQ+ F
Sbjct  251  VMEFQRGVLQNLFWNNFGCDSCKGGSSSVCLNGTDCAVPTAKCKANGGEANCNIGIQVAF  310

Query  624  SGTDK  638
            SGTDK
Sbjct  311  SGTDK  315



>ref|XP_010066065.1| PREDICTED: uncharacterized protein LOC104453239 [Eucalyptus grandis]
Length=244

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 135/185 (73%), Gaps = 11/185 (6%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            + DTN VF PC+DT +QK DGF+FG+ F+ + + F      + +QLSPCD RL L  ++A
Sbjct  31   AEDTNLVFDPCSDTKIQKGDGFSFGLAFSTKESFFF-----QQIQLSPCDNRLPLAGSSA  85

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAV+RPKVDEISLLT+N+S+F P   GGYMVAFAG KYAARS P  VA+ ++ ++SFTL
Sbjct  86   QLAVYRPKVDEISLLTINSSTFNPGMSGGYMVAFAGHKYAARSLPVQVADSTHTITSFTL  145

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KG LQNLYWK+ GC SC G S   CLN +DCA+  +   + G    C++GIQLTF
Sbjct  146  VLEFQKGTLQNLYWKKFGCDSCPGDST-VCLNNEDCAVPNSKCSHAGA---CNIGIQLTF  201

Query  624  SGTDK  638
            SGTDK
Sbjct  202  SGTDK  206



>ref|XP_006409495.1| hypothetical protein EUTSA_v10023083mg [Eutrema salsugineum]
 gb|ESQ50948.1| hypothetical protein EUTSA_v10023083mg [Eutrema salsugineum]
Length=335

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 133/185 (72%), Gaps = 7/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            +SD N V+SPC+DT + K DGFT G+  +++ A F++      +QLSPCD RL L    A
Sbjct  121  ASDNNAVYSPCSDTQISKGDGFTIGVAISSKEAFFLDQ-----IQLSPCDSRLGLAAKMA  175

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS P  VA+ S  +++FTL
Sbjct  176  QLALFRPKVDEISLLSIDTSKFNPSEAGGYMVGFAGSKYAARSYPVKVADASNTITAFTL  235

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KG LQNL+WK  GC SCKG+S   CLNG DCA+ T+  +  GG  +C++GIQ+ F
Sbjct  236  VMEFQKGVLQNLFWKNFGCDSCKGASSSVCLNGTDCAVPTSKCKANGGEANCNIGIQVAF  295

Query  624  SGTDK  638
            SGT+K
Sbjct  296  SGTEK  300



>ref|XP_004507366.1| PREDICTED: uncharacterized protein LOC101506783 [Cicer arietinum]
Length=252

 Score =   210 bits (534),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 132/185 (71%), Gaps = 9/185 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  263
            ++DTN V+SPC D  VQK DGFTFGI F+ +  TF  D+     QLSPCD RL L N  A
Sbjct  37   AADTNDVYSPCHDAKVQKDDGFTFGIAFSNKQ-TFTPDNGP---QLSPCDSRLDLPNKGA  92

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRPKVDEISLLT+N S+  P + GGYMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  93   QLAVFRPKVDEISLLTINKSTLNPATTGGYMVAFAGQKYAARSLPIMFADDSHTITSFTL  152

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF +G LQNL+WK  GC SC G S   CLN QDCA+     Q   G++ C++GIQLTF
Sbjct  153  VLEFHEGTLQNLFWKSFGCGSCPGGS--VCLNKQDCAVPNTKCQTN-GDISCNIGIQLTF  209

Query  624  SGTDK  638
            SGTDK
Sbjct  210  SGTDK  214



>ref|XP_002885990.1| hypothetical protein ARALYDRAFT_319534 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62249.1| hypothetical protein ARALYDRAFT_319534 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 135/190 (71%), Gaps = 10/190 (5%)
 Frame = +3

Query  84   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--N  257
            + SSD N V+SPC+DT + K DGFT GI  +++ A F++      VQLSPCD RL L   
Sbjct  139  DDSSDNNPVYSPCSDTQISKGDGFTIGIAISSKEAFFLDQ-----VQLSPCDSRLGLAAK  193

Query  258  NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  437
             AQLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS P  VA+GS  +++F
Sbjct  194  MAQLALFRPKVDEISLLSIDTSKFNPSEAGGFMVGFAGSKYAARSSPVKVADGSNTITAF  253

Query  438  TLVFEFKKGRLQNLYWKRDGCASCKG---SSGFTCLNGQDCAMKTNSXQNRGGNVDCSLG  608
            TLV EF+KG LQNL+WK  GC SCKG   SS   CLNG DCA+ T+  +  GG  +C++G
Sbjct  254  TLVLEFQKGVLQNLFWKSFGCDSCKGIGSSSSSVCLNGTDCAVPTSKCKANGGEANCNIG  313

Query  609  IQLTFSGTDK  638
            IQ+ FSGTDK
Sbjct  314  IQVAFSGTDK  323



>ref|XP_006384473.1| hypothetical protein POPTR_0004s15390g [Populus trichocarpa]
 gb|ERP62270.1| hypothetical protein POPTR_0004s15390g [Populus trichocarpa]
Length=224

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 138/190 (73%), Gaps = 11/190 (6%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
            A +++DTN VF PC+D  VQK DGFTFG+ F+ +++ F N      VQLSPCD RL+L+ 
Sbjct  4    AINAADTNEVFDPCSDAMVQKFDGFTFGLAFSDKDSFFSNQ-----VQLSPCDSRLALSK  58

Query  261  -AQLAVFRPKVDEISLLTVNTSSFFPDS---VGGYMVAFAGRKYAARSPPAFVANGSYIV  428
             AQLAVFRP+VDEISLLT+N+S   P +   +G YMVAFAGRK+AARS P  +++ + I+
Sbjct  59   KAQLAVFRPQVDEISLLTINSSPSDPGAPGPLGSYMVAFAGRKHAARSFPVMISDNNTII  118

Query  429  SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLG  608
            +SFTLV EF+KG LQ LYWK+ GC SC  S  F CL G+DCA+  +  +  GG  DC+L 
Sbjct  119  TSFTLVLEFQKGTLQTLYWKKFGCQSC--SKDFVCLGGEDCALPISKCKINGGAHDCNLS  176

Query  609  IQLTFSGTDK  638
            IQLTFSGTDK
Sbjct  177  IQLTFSGTDK  186



>ref|XP_011005674.1| PREDICTED: uncharacterized protein LOC105111893 [Populus euphratica]
Length=249

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 138/190 (73%), Gaps = 11/190 (6%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
            A +++DTN VF PC+D  VQK DGFTFG+ F+ +++ F N      VQLSPCD RL L+ 
Sbjct  29   AINAADTNEVFDPCSDAMVQKFDGFTFGLAFSDKDSFFSNQ-----VQLSPCDSRLGLSK  83

Query  261  -AQLAVFRPKVDEISLLTVNTSSFFPDS---VGGYMVAFAGRKYAARSPPAFVANGSYIV  428
             AQLAVFRP+VDEISLLT+N+S   P +   +G +MVAFAGRK+AARS P  +++ + I+
Sbjct  84   KAQLAVFRPQVDEISLLTINSSPSDPGAPGPLGSHMVAFAGRKHAARSFPVMISDNNTII  143

Query  429  SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLG  608
            +SFTLV EF+KG LQNLYWK+ GC SC  S  F CL G+DCA+  +  ++ GG  DC L 
Sbjct  144  TSFTLVLEFQKGTLQNLYWKKFGCQSC--SKDFVCLGGEDCALPISKCKSNGGANDCVLS  201

Query  609  IQLTFSGTDK  638
            IQLTFSGTDK
Sbjct  202  IQLTFSGTDK  211



>gb|KDO39918.1| hypothetical protein CISIN_1g040802mg [Citrus sinensis]
Length=245

 Score =   207 bits (526),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 135/184 (73%), Gaps = 8/184 (4%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  266
            +DTN +F+PC D+ V++ DGFTFG+ F+ + A F++      +QLSPCD RL+L   NA+
Sbjct  33   ADTNIIFNPCDDSKVKRWDGFTFGLAFSTKEAFFLDQ-----IQLSPCDSRLALPTKNAK  87

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRPKVDEISLLT++ ++F P   GGY+VAFAGRKYAARS P  VA+ ++ V++ TLV
Sbjct  88   LAIFRPKVDEISLLTIDDTNFNPILSGGYVVAFAGRKYAARSAPTLVADSTHTVTNLTLV  147

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF++G L+NLYWK  GC SC G +   C+N   CA+     +N GG +DC++GIQLTFS
Sbjct  148  LEFQQGTLENLYWKSLGCDSCSGETS-VCINNTVCAVPNLKCRNHGGPIDCNIGIQLTFS  206

Query  627  GTDK  638
            GTD+
Sbjct  207  GTDE  210



>ref|XP_006480155.1| PREDICTED: uncharacterized protein LOC102615233 [Citrus sinensis]
Length=249

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 135/184 (73%), Gaps = 8/184 (4%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  266
            +DTN +F+PC D+ V++ DGFTFG+ F+ + A F++      +QLSPCD RL+L   NA+
Sbjct  37   ADTNIIFNPCDDSKVKRWDGFTFGLAFSTKEAFFLDQ-----IQLSPCDSRLALPTKNAK  91

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            LA+FRPKVDEISLLT++ ++F P   GGY+VAFAGRKYAARS P  VA+ ++ V++ TLV
Sbjct  92   LAIFRPKVDEISLLTIDDTNFNPILSGGYVVAFAGRKYAARSAPTLVADSTHTVTNLTLV  151

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF++G L+NLYWK  GC SC G +   C+N   CA+     +N GG +DC++GIQLTFS
Sbjct  152  LEFQQGTLENLYWKSLGCDSCSGETS-VCINNTVCAVPNLKCRNHGGPIDCNIGIQLTFS  210

Query  627  GTDK  638
            GTD+
Sbjct  211  GTDE  214



>ref|XP_006423087.1| hypothetical protein CICLE_v10029171mg [Citrus clementina]
 gb|ESR36327.1| hypothetical protein CICLE_v10029171mg [Citrus clementina]
Length=244

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 134/184 (73%), Gaps = 8/184 (4%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  266
            +DTN +F+PC DT V++ DGFTFG+ F+ + A F++      +QLSPCD RL+L   NA+
Sbjct  32   ADTNIIFNPCDDTKVKRLDGFTFGLAFSTKEAFFLDQ-----IQLSPCDSRLALATKNAK  86

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            L +FRPKVDEISLLT++ ++F P   GGY+VAFAGRKYAARS P  VA+ ++ V++ TLV
Sbjct  87   LTIFRPKVDEISLLTIDGTNFNPILSGGYVVAFAGRKYAARSAPTLVADSTHTVTNLTLV  146

Query  447  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFS  626
             EF++G L+NLYWK  GC SC G +   C+N   CA+     +N GG +DC++GIQLTFS
Sbjct  147  LEFQQGTLENLYWKSLGCDSCSGETS-VCINNTVCAVPNLKCRNHGGPIDCNVGIQLTFS  205

Query  627  GTDK  638
            GTD+
Sbjct  206  GTDE  209



>ref|XP_004145350.1| PREDICTED: uncharacterized protein LOC101213680 [Cucumis sativus]
 ref|XP_004153260.1| PREDICTED: uncharacterized protein LOC101222204 [Cucumis sativus]
 ref|XP_004161628.1| PREDICTED: uncharacterized LOC101222204 [Cucumis sativus]
Length=235

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 132/183 (72%), Gaps = 8/183 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            DTN V+SPC D+ +Q+SDGFTFG+ F+++ + F        +Q SPCD RLSL +  AQL
Sbjct  24   DTNDVYSPCLDSKIQRSDGFTFGVAFSSKESFF-----QDQIQFSPCDTRLSLASKMAQL  78

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
             VFRPKVD++S LT+N+S+F P   GGYMVAFAG+KYAARS P  + + S  ++SFTLV 
Sbjct  79   VVFRPKVDQLSFLTINSSTFNPALNGGYMVAFAGQKYAARSLPVMITDNSNTITSFTLVL  138

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF++G LQNL+WK+ GC  C G     C++ QDCA+  +  +  GG+VDC+LGIQL FSG
Sbjct  139  EFQRGILQNLFWKKFGCDKCSGDFSL-CVDNQDCAIPNSKCKYNGGSVDCNLGIQLAFSG  197

Query  630  TDK  638
            TDK
Sbjct  198  TDK  200



>ref|XP_011001205.1| PREDICTED: uncharacterized protein LOC105108558 [Populus euphratica]
 ref|XP_011016215.1| PREDICTED: uncharacterized protein LOC105119739 [Populus euphratica]
Length=249

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 135/187 (72%), Gaps = 11/187 (6%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQ  266
            ++DTN VF PC+D  VQK DGFTFG+ F+ +++ F N      VQLSPCD RL L+  AQ
Sbjct  32   AADTNEVFDPCSDAMVQKFDGFTFGLAFSDKDSFFSNQ-----VQLSPCDSRLGLSKKAQ  86

Query  267  LAVFRPKVDEISLLTVNTSSFFPDS---VGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  437
            LAVFRP+VDEISLLT+N+S   P +   +G +MVAFAGRK+AARS P  +++ + I++SF
Sbjct  87   LAVFRPQVDEISLLTINSSPSDPGAPGPLGSHMVAFAGRKHAARSFPVMISDNNTIITSF  146

Query  438  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQL  617
            TLV EF+KG LQNLYWK+ GC SC  S  F CL G+DCA+  +  ++  G  DC L IQL
Sbjct  147  TLVLEFQKGTLQNLYWKKFGCQSC--SKDFVCLGGEDCALPISKCKSNSGANDCVLSIQL  204

Query  618  TFSGTDK  638
            TFSGTDK
Sbjct  205  TFSGTDK  211



>ref|XP_008643755.1| PREDICTED: expp1 protein isoform X1 [Zea mays]
Length=778

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 7/182 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            D N V+ PCAD +VQ+ DGFTFG+VF+ R++       +  VQLSPCD RL L N AQ+A
Sbjct  565  DHNGVYDPCADASVQRGDGFTFGVVFSGRDSF-----SSGGVQLSPCDSRLGLANRAQVA  619

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            +FRP+VDEISLLTVN+SSF P S G YMVAFAG+KYAARSPP FV N SY V+ FTLV E
Sbjct  620  LFRPQVDEISLLTVNSSSFDPSSSGVYMVAFAGKKYAARSPPVFVGNISYTVTGFTLVLE  679

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F+KG LQNL+WK  GC+SC G S F C++G  CA++T S + +GG V+CS GIQL FSGT
Sbjct  680  FQKGTLQNLFWKAGGCSSCSGRSDFACVDG-SCAVRTASCRGKGGQVECSPGIQLAFSGT  738

Query  633  DK  638
            D+
Sbjct  739  DR  740



>gb|AFK46494.1| unknown [Lotus japonicus]
Length=254

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 127/185 (69%), Gaps = 8/185 (4%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            ++DTN V+SPC D  VQ+ DGFTFGI  A +   F  D      QLSPCD RL L+   A
Sbjct  43   AADTNDVYSPCLDAKVQRGDGFTFGIALADKQ-IFFQDGNGP--QLSPCDSRLGLSSKEA  99

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            Q A+FRPKVDEISLLT+N S+      GGYMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  100  QAAMFRPKVDEISLLTINRSALDSGKTGGYMVAFAGQKYAARSLPIMFADNSHTITSFTL  159

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EFK+G LQNL+WKR GC +C  S G  CLN QDCA+     Q  GG   C++GIQLTF
Sbjct  160  VLEFKEGTLQNLFWKRFGCGAC--SKGSVCLNNQDCAVPNTDCQKNGGTT-CNIGIQLTF  216

Query  624  SGTDK  638
            SGTDK
Sbjct  217  SGTDK  221



>ref|XP_002463772.1| hypothetical protein SORBIDRAFT_01g005890 [Sorghum bicolor]
 gb|EER90770.1| hypothetical protein SORBIDRAFT_01g005890 [Sorghum bicolor]
Length=245

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 139/182 (76%), Gaps = 7/182 (4%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            D N V+ PCAD +VQ+ DGFTFG+VF+ R++ F     +  VQLSPCD RL L N AQLA
Sbjct  32   DHNGVYDPCADASVQRGDGFTFGVVFSGRDSFF-----SGGVQLSPCDSRLGLANRAQLA  86

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            ++RP+VDEISLLTVN+SSF P S GGYMVAFAG+KYAARS P FVAN SY V+ FTLV E
Sbjct  87   LYRPQVDEISLLTVNSSSFDPSSSGGYMVAFAGKKYAARSTPVFVANTSYTVTGFTLVLE  146

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F+KG LQNL+WK  GC+SC G S F C++   CA+KT S + +GG VDC+ GIQL FSGT
Sbjct  147  FQKGTLQNLFWKPSGCSSCSGRSDFACVD-SSCAIKTTSCKGKGGQVDCNPGIQLAFSGT  205

Query  633  DK  638
            DK
Sbjct  206  DK  207



>ref|XP_007042316.1| CSL zinc finger domain-containing protein [Theobroma cacao]
 gb|EOX98147.1| CSL zinc finger domain-containing protein [Theobroma cacao]
Length=238

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 130/188 (69%), Gaps = 14/188 (7%)
 Frame = +3

Query  81   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  260
            A  + DTN VFSPC D+ V KSDGFTFG+ F+ + + F ++     VQLSPCD RL+L +
Sbjct  22   AAIADDTNGVFSPCEDSKVHKSDGFTFGLAFSKKESFFFDN-----VQLSPCDSRLALAS  76

Query  261  --AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
              A LAVFRPKVDEISLLT+N S   P   GG+MVAFAGRKYAARS P  VA+    ++S
Sbjct  77   KMAPLAVFRPKVDEISLLTINGS--IPLVAGGFMVAFAGRKYAARSFPVMVADDRNTITS  134

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQ  614
            FTLV EF KG LQNL+WK  GC SC G S   CLN QDCA+ T     + G+  CSLGIQ
Sbjct  135  FTLVLEFHKGTLQNLHWKSFGCDSCSGESA-VCLNNQDCAIPT----PKCGHTGCSLGIQ  189

Query  615  LTFSGTDK  638
            L FSGTDK
Sbjct  190  LAFSGTDK  197



>gb|KJB78926.1| hypothetical protein B456_013G040100 [Gossypium raimondii]
Length=197

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 126/186 (68%), Gaps = 16/186 (9%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNA-TFINDSKNKDVQLSPCDRRLSL--NN  260
            + DTN V+SPC D  VQK DGFTFG+ F+ +   +F N      VQLSPCD RL L   +
Sbjct  18   ADDTNDVYSPCDDAKVQKLDGFTFGVAFSKKEFFSFEN------VQLSPCDSRLGLATKS  71

Query  261  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AQLAVFRPK+DEISLLT+N S       GGYMVAFAGRKYAARS P  VA+    ++SFT
Sbjct  72   AQLAVFRPKLDEISLLTINGSDLL--KAGGYMVAFAGRKYAARSLPIMVADDKNTITSFT  129

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EFK+G LQNL+WK  GC SC G S  TCLN QDCA  T+     G    C+LGIQL 
Sbjct  130  LVLEFKQGTLQNLFWKSSGCDSCSGESA-TCLNNQDCARPTSKCGQNG----CNLGIQLA  184

Query  621  FSGTDK  638
            FSGTDK
Sbjct  185  FSGTDK  190



>gb|ACF84480.1| unknown [Zea mays]
 gb|AFW68145.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_851126 [Zea 
mays]
Length=227

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 126/182 (69%), Gaps = 23/182 (13%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDGRIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            VFRPK                 S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV E
Sbjct  85   VFRPKA----------------SAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVLE  128

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F KGRL+NL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSGT
Sbjct  129  FNKGRLENLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSGT  187

Query  633  DK  638
            DK
Sbjct  188  DK  189



>gb|KJB78925.1| hypothetical protein B456_013G040100 [Gossypium raimondii]
Length=221

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 126/186 (68%), Gaps = 16/186 (9%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNA-TFINDSKNKDVQLSPCDRRLSL--NN  260
            + DTN V+SPC D  VQK DGFTFG+ F+ +   +F N      VQLSPCD RL L   +
Sbjct  18   ADDTNDVYSPCDDAKVQKLDGFTFGVAFSKKEFFSFEN------VQLSPCDSRLGLATKS  71

Query  261  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AQLAVFRPK+DEISLLT+N S       GGYMVAFAGRKYAARS P  VA+    ++SFT
Sbjct  72   AQLAVFRPKLDEISLLTINGSDLL--KAGGYMVAFAGRKYAARSLPIMVADDKNTITSFT  129

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV EFK+G LQNL+WK  GC SC G S  TCLN QDCA  T+     G    C+LGIQL 
Sbjct  130  LVLEFKQGTLQNLFWKSSGCDSCSGESA-TCLNNQDCARPTSKCGQNG----CNLGIQLA  184

Query  621  FSGTDK  638
            FSGTDK
Sbjct  185  FSGTDK  190



>ref|XP_001762404.1| predicted protein [Physcomitrella patens]
 gb|EDQ72871.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 133/186 (72%), Gaps = 10/186 (5%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLS--LNNAQ  266
            ++TN V+SPC D TV K+DGFTFG+ FA+  + F N      +QLSPCD RL+  L   +
Sbjct  27   ANTNKVYSPCMDATVHKNDGFTFGLAFASNKSFFYNK-----IQLSPCDSRLAEKLREHK  81

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSV--GGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            +++FRP+VDE++LL VN +   P++V  GG+ VA+AG+K+A  S P F+AN SY ++S +
Sbjct  82   ISLFRPQVDEVTLLLVNHTEINPENVEGGGFAVAYAGKKHAVVSAPHFLANSSYRITSLS  141

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            LV  F++GRLQN+ WK DGC SC G+S F C+ G +CA+++ +    GG VDCSL IQLT
Sbjct  142  LVLNFEQGRLQNILWKNDGCKSCLGNSSFACVRG-ECAIQSTACIEAGGRVDCSLSIQLT  200

Query  621  FSGTDK  638
            +SGTD+
Sbjct  201  WSGTDQ  206



>ref|NP_179191.1| CSL zinc finger domain-containing protein [Arabidopsis thaliana]
 gb|AAD41975.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06447.1| CSL zinc finger domain-containing protein [Arabidopsis thaliana]
Length=367

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 133/196 (68%), Gaps = 18/196 (9%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            ++D N V+SPC+DT + K DGFT GI  +++ A F++      VQLSPCD RL L    A
Sbjct  142  AADNNPVYSPCSDTQISKGDGFTIGIAISSKEAFFLDQ-----VQLSPCDTRLGLAAKMA  196

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT-  440
            QLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS P  VA+GS  +++FT 
Sbjct  197  QLALFRPKVDEISLLSIDTSKFNPSEAGGFMVGFAGSKYAARSYPVKVADGSNTITAFTL  256

Query  441  --------LVFEFKKGRLQNLYWKRDGCASCK--GSSGFTCLNGQDCAMKTNSXQNRGGN  590
                    LV EF+KG LQNL+WK  GC  CK  GSS   CLNG DCA+ T+  +  GG 
Sbjct  257  VMKLTLSPLVLEFQKGVLQNLFWKSFGCDLCKGTGSSSSVCLNGTDCAVPTSKCKANGGQ  316

Query  591  VDCSLGIQLTFSGTDK  638
             +C++GIQ+ FSGTD+
Sbjct  317  ANCNIGIQVAFSGTDR  332



>ref|XP_007131910.1| hypothetical protein PHAVU_011G050900g [Phaseolus vulgaris]
 gb|ESW03904.1| hypothetical protein PHAVU_011G050900g [Phaseolus vulgaris]
Length=254

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 131/185 (71%), Gaps = 10/185 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  263
            ++DTN V+SPC D  VQK DGFTFG+ F+ +       S +   QLSPCD+RL L N  A
Sbjct  40   AADTNDVYSPCFDAKVQKGDGFTFGVAFSDKQIF----SPDNGPQLSPCDKRLQLANKGA  95

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAVFRPKVDEISLLT+N S+  P +  GYMVAFAG+KYAARS P    + ++ ++S +L
Sbjct  96   QLAVFRPKVDEISLLTINRSTSDPGA-NGYMVAFAGKKYAARSLPIMFVDNTHTITSLSL  154

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G LQNL+WK  GC +C   SG +CLN QDCA+     Q  GG++ C++GIQLTF
Sbjct  155  VLEFQEGILQNLFWKSFGCDAC--PSGSSCLNQQDCAVPNTECQKNGGDI-CNVGIQLTF  211

Query  624  SGTDK  638
            SGTDK
Sbjct  212  SGTDK  216



>gb|KHN25326.1| hypothetical protein glysoja_010243 [Glycine soja]
Length=246

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 126/185 (68%), Gaps = 10/185 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  263
            ++DTN V+SPC D  VQ+ DGFTFGI F+ +       S+    QLSPCD+RL L N  A
Sbjct  32   AADTNDVYSPCLDAKVQRGDGFTFGIAFSDKQFF----SQGNGPQLSPCDKRLDLANKGA  87

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QL+VFRP VDE+SLLT+N S+  P +   YMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  88   QLSVFRPTVDEVSLLTINRSTSNPGN-NAYMVAFAGQKYAARSLPIMFADNSHTITSFTL  146

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G LQNLYWK  GC  C   SG  CLN QDCA+     Q  GG   C++GIQL F
Sbjct  147  VLEFQEGTLQNLYWKSFGCDGCP--SGSICLNQQDCAVPNKECQKNGGTA-CNMGIQLAF  203

Query  624  SGTDK  638
            SGTDK
Sbjct  204  SGTDK  208



>ref|XP_003541122.2| PREDICTED: uncharacterized protein LOC100813820 [Glycine max]
Length=248

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 126/185 (68%), Gaps = 10/185 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  263
            ++DTN V+SPC D  VQ+ DGFTFGI F+ +       S+    QLSPCD+RL L N  A
Sbjct  34   AADTNDVYSPCLDAKVQRGDGFTFGIAFSDKQFF----SQGNGPQLSPCDKRLDLANKGA  89

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QL+VFRP VDE+SLLT+N S+  P +   YMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  90   QLSVFRPTVDEVSLLTINRSTSNPGN-NAYMVAFAGQKYAARSLPIMFADNSHTITSFTL  148

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G LQNLYWK  GC  C   SG  CLN QDCA+     Q  GG   C++GIQL F
Sbjct  149  VLEFQEGTLQNLYWKSFGCDGCP--SGSICLNQQDCAVPNKECQKNGGTA-CNMGIQLAF  205

Query  624  SGTDK  638
            SGTDK
Sbjct  206  SGTDK  210



>ref|XP_002977899.1| hypothetical protein SELMODRAFT_36451, partial [Selaginella moellendorffii]
 gb|EFJ21237.1| hypothetical protein SELMODRAFT_36451, partial [Selaginella moellendorffii]
Length=231

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 128/185 (69%), Gaps = 9/185 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLS-LNNAQLA  272
            DTN VF+PC DT VQ  DGFTFG+ F++ ++ F+  S     QLSPCDRRLS L + ++A
Sbjct  16   DTNPVFNPCGDTRVQVLDGFTFGLAFSSNSSFFLGRS-----QLSPCDRRLSNLYSGRIA  70

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGG--YMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
             FRP+VDEISLLTVN +S      G   YMV++AG ++ ARS P FV +   IV+SFTLV
Sbjct  71   AFRPRVDEISLLTVNDTSTLNADNGNELYMVSYAGSRFGARSKPHFVGDNEKIVTSFTLV  130

Query  447  FEFKKGRLQNLYWKRDGCASCK-GSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
             EF+KGRL N+ WK + C SC  G   F CL   DCA++ +  ++RGG VDCS+GI +TF
Sbjct  131  LEFRKGRLINMLWKGNDCKSCSDGRDDFVCLKSGDCAVRLSHCRHRGGRVDCSIGITVTF  190

Query  624  SGTDK  638
            SGTDK
Sbjct  191  SGTDK  195



>ref|NP_001241490.1| uncharacterized protein LOC100816612 [Glycine max]
 gb|ACU24598.1| unknown [Glycine max]
 gb|KHN06175.1| hypothetical protein glysoja_031617 [Glycine soja]
Length=250

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 125/185 (68%), Gaps = 10/185 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  263
            ++DTN V+SPC D  VQ+ DGFTFGI F+ +       S+    QLSPCD+RL L N  A
Sbjct  36   AADTNDVYSPCLDAKVQRGDGFTFGIAFSDKEFF----SQGNGPQLSPCDKRLDLANKGA  91

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QL+VFRP VDEISLLT+N  S        YMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  92   QLSVFRPTVDEISLLTIN-RSIVNAGKDAYMVAFAGQKYAARSLPIMFADNSHTITSFTL  150

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF++G LQNLYWK  GC +C   SG  CLN QDCA+     Q  GG+  C+LGIQL F
Sbjct  151  VLEFQEGTLQNLYWKSFGCNAC--PSGSICLNNQDCAVPNTECQKNGGSA-CNLGIQLAF  207

Query  624  SGTDK  638
            SGTDK
Sbjct  208  SGTDK  212



>ref|XP_003606839.1| hypothetical protein MTR_4g068290 [Medicago truncatula]
Length=262

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            DTN V+ PC D  VQK DGFTFGI FA +  +F  DS     QLSPCD RLSL   AQL 
Sbjct  57   DTNDVYLPCEDAKVQKGDGFTFGIAFADKQ-SFTPDSGP---QLSPCDSRLSLAGKAQLV  112

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            VFRP VDEISLLTVN SS   DS G YMVAFAG+KYAARS P  +A+ S+ ++SFTLV E
Sbjct  113  VFRPMVDEISLLTVNRSS--SDS-GTYMVAFAGQKYAARSLPIMLADDSHTITSFTLVLE  169

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F+ G LQNL+WK  GC +C   SG  CLN QDCA+     Q + G+  C +GIQL FSG 
Sbjct  170  FQDGTLQNLFWKSFGCDAC--PSGSICLNNQDCAVPNTECQ-KNGDTACKIGIQLAFSGI  226

Query  633  DK  638
            DK
Sbjct  227  DK  228



>gb|AES89036.2| CSL zinc finger protein, putative [Medicago truncatula]
Length=243

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            DTN V+ PC D  VQK DGFTFGI FA +  +F  DS     QLSPCD RLSL   AQL 
Sbjct  38   DTNDVYLPCEDAKVQKGDGFTFGIAFADKQ-SFTPDSGP---QLSPCDSRLSLAGKAQLV  93

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            VFRP VDEISLLTVN SS   DS G YMVAFAG+KYAARS P  +A+ S+ ++SFTLV E
Sbjct  94   VFRPMVDEISLLTVNRSS--SDS-GTYMVAFAGQKYAARSLPIMLADDSHTITSFTLVLE  150

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F+ G LQNL+WK  GC +C   SG  CLN QDCA+     Q + G+  C +GIQL FSG 
Sbjct  151  FQDGTLQNLFWKSFGCDACP--SGSICLNNQDCAVPNTECQ-KNGDTACKIGIQLAFSGI  207

Query  633  DK  638
            DK
Sbjct  208  DK  209



>ref|XP_002979423.1| hypothetical protein SELMODRAFT_58114, partial [Selaginella moellendorffii]
 gb|EFJ19312.1| hypothetical protein SELMODRAFT_58114, partial [Selaginella moellendorffii]
Length=236

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 129/189 (68%), Gaps = 13/189 (7%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLS-LNNAQLA  272
            DTN VF+PC DT VQ  DGFTFG+ F++ ++ F+  S     QLSPCDRRLS L + ++A
Sbjct  23   DTNPVFNPCGDTRVQVLDGFTFGLAFSSNSSFFLGRS-----QLSPCDRRLSNLYSGRIA  77

Query  273  VFRPKVDEISLLTVNTSS------FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  434
             FRP+VDEISLLTVN +S      F  +    YMV++AG ++ ARS P FV +   IV+S
Sbjct  78   AFRPRVDEISLLTVNDTSTLNARSFQDNGNELYMVSYAGSRFGARSKPHFVGDNEKIVTS  137

Query  435  FTLVFEFKKGRLQNLYWKRDGCASCK-GSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGI  611
            FTLV EF+KGRL N+ WK + C SC  G   F CL   DCA++ +  ++RGG VDCS+GI
Sbjct  138  FTLVLEFRKGRLINMLWKGNDCKSCSDGRDDFVCLKSGDCAVRLSHCRHRGGRVDCSIGI  197

Query  612  QLTFSGTDK  638
             +TFSGTDK
Sbjct  198  TVTFSGTDK  206



>gb|KGN61748.1| hypothetical protein Csa_2G237180 [Cucumis sativus]
Length=220

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 123/183 (67%), Gaps = 23/183 (13%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  269
            DTN V+SPC D+ +Q+SDGFTFG+ F+++ + F        +Q SPCD RLSL +  AQL
Sbjct  24   DTNDVYSPCLDSKIQRSDGFTFGVAFSSKESFF-----QDQIQFSPCDTRLSLASKMAQL  78

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
             VFRPKVD++S LT+N+S+F P   GGYMVAFAG+KYAARS P               V 
Sbjct  79   VVFRPKVDQLSFLTINSSTFNPALNGGYMVAFAGQKYAARSLP---------------VL  123

Query  450  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSG  629
            EF++G LQNL+WK+ GC  C G     C++ QDCA+  +  +  GG+VDC+LGIQL FSG
Sbjct  124  EFQRGILQNLFWKKFGCDKCSGDFSL-CVDNQDCAIPNSKCKYNGGSVDCNLGIQLAFSG  182

Query  630  TDK  638
            TDK
Sbjct  183  TDK  185



>gb|EEC76294.1| hypothetical protein OsI_13809 [Oryza sativa Indica Group]
Length=220

 Score =   173 bits (438),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 114/186 (61%), Gaps = 44/186 (24%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN V+ PCAD  VQ+ DGFTFG+ FAAR   F     +  VQLSPCD RLSL    A+L
Sbjct  36   DTNGVYEPCADAAVQRGDGFTFGVAFAARGDFF-----SGGVQLSPCDGRLSLASKGAKL  90

Query  270  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  440
            AVFRP+VDEISLLTVNTS+   F P + GGYMVAFAGRKYAARSPP FV+N SY V+SFT
Sbjct  91   AVFRPEVDEISLLTVNTSAAGGFDPATSGGYMVAFAGRKYAARSPPVFVSNSSYTVTSFT  150

Query  441  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLT  620
            L                                   CA+ T +   +GG+VDCS GIQL 
Sbjct  151  L----------------------------------SCAISTANCTGKGGSVDCSPGIQLA  176

Query  621  FSGTDK  638
            FSGTDK
Sbjct  177  FSGTDK  182



>ref|XP_010517092.1| PREDICTED: uncharacterized protein LOC104792600, partial [Camelina 
sativa]
Length=156

 Score =   171 bits (433),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 7/150 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            +SD N V+SPC+DT + K DGFT G+  ++R A F++      VQLSPCD RL L    A
Sbjct  12   ASDNNAVYSPCSDTQISKGDGFTIGLAISSREAFFLDQ-----VQLSPCDSRLGLAAKMA  66

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS P  VA+ S  +++FTL
Sbjct  67   QLALFRPKVDEISLLSIDTSKFNPSKAGGYMVGFAGSKYAARSYPVKVADESNTITAFTL  126

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTC  533
            V EF+KG LQNL+WK  GC  CKG +   C
Sbjct  127  VMEFQKGVLQNLFWKSFGCDMCKGGTSSVC  156



>tpg|DAA50290.1| TPA: hypothetical protein ZEAMMB73_913292 [Zea mays]
Length=208

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 111/182 (61%), Gaps = 42/182 (23%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            VFRPKVDEISLLT+NT+                                   + F  V E
Sbjct  85   VFRPKVDEISLLTINTT-----------------------------------TGFNPVLE  109

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F KGRLQNL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSGT
Sbjct  110  FNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSGT  168

Query  633  DK  638
            DK
Sbjct  169  DK  170



>ref|XP_006838810.1| hypothetical protein AMTR_s00002p00262020 [Amborella trichopoda]
 gb|ERN01379.1| hypothetical protein AMTR_s00002p00262020 [Amborella trichopoda]
Length=157

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 89/107 (83%), Gaps = 3/107 (3%)
 Frame = +3

Query  327  FFP---DSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDG  497
            F P   ++ GGYMVAFAGRKYAARS P+FVAN +YIV+SFTLV EFKKG LQNLYWKRDG
Sbjct  13   FLPPPLETYGGYMVAFAGRKYAARSTPSFVANSTYIVTSFTLVLEFKKGTLQNLYWKRDG  72

Query  498  CASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTDK  638
            C SCKG+  FTCLN QDCA+K +S +  GG+VDCSLGIQ+ FSGTDK
Sbjct  73   CKSCKGNPNFTCLNFQDCAIKRSSCKGHGGSVDCSLGIQMAFSGTDK  119



>gb|EYU18142.1| hypothetical protein MIMGU_mgv1a011713mg [Erythranthe guttata]
Length=273

 Score =   163 bits (412),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 6/119 (5%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQ  266
            S +TN+VFSPC D +VQ+SDGFTFG+ FA   A   N +     QLSPCD RLSL  ++Q
Sbjct  22   SKNTNNVFSPCGDASVQRSDGFTFGVAFAQTRAFSFNGT-----QLSPCDSRLSLTGSSQ  76

Query  267  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            +AVFRPKVDEISLLT+NTS+F PDSVGGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  77   VAVFRPKVDEISLLTINTSTFQPDSVGGYMVAFAGRKYAARSMPAFVANSTYIVTSFTL  135


 Score = 51.2 bits (121),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  448  LNSKRADCKTCTGRGMGVHRAKAAQASHASMVKIVL*RPIPXRTEVGM*TVALEYN  615
            LNS+R   KTCTG+   V RA+A QAS+AS +K V       +TEVGM T A  Y+
Sbjct  135  LNSRRGGFKTCTGKETDVLRARATQASYASTIKTVPSESTTAKTEVGMWTAASGYS  190



>gb|ACL54751.1| unknown [Zea mays]
Length=208

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 111/182 (61%), Gaps = 42/182 (23%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDGRIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
            VFRPKVDEISLLT+NT+                                   + F  V E
Sbjct  85   VFRPKVDEISLLTINTT-----------------------------------TGFNPVLE  109

Query  453  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGT  632
            F KGRL+NL+WK+DGC +C G S F CL  Q CA++T S +++ G VDCS+GIQL FSGT
Sbjct  110  FNKGRLENLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSGT  168

Query  633  DK  638
            DK
Sbjct  169  DK  170



>gb|ACU17763.1| unknown [Glycine max]
Length=141

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  348  GYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGF  527
            GYMVAFAG +YAARSPPAFVANG+Y V+SFTLV EFK+GRLQNLYWKRDGCA C  +S  
Sbjct  7    GYMVAFAGHRYAARSPPAFVANGTYTVTSFTLVLEFKRGRLQNLYWKRDGCAKCSSNSKA  66

Query  528  TCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTDK  638
             CLN QDCA++T++ ++ GG VDCS+GIQL FSGTD+
Sbjct  67   VCLNNQDCALQTSTCKSHGGTVDCSIGIQLAFSGTDR  103



>gb|KCW63843.1| hypothetical protein EUGRSUZ_G01513 [Eucalyptus grandis]
Length=208

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 108/185 (58%), Gaps = 47/185 (25%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  263
            + DTN VF PC+DT +QK DGF+FG+ F+ + + F      + +QLSPCD RL L  ++A
Sbjct  31   AEDTNLVFDPCSDTKIQKGDGFSFGLAFSTKESFFF-----QQIQLSPCDNRLPLAGSSA  85

Query  264  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  443
            QLAV+RPKVDEISLLT+N+S+F P                                    
Sbjct  86   QLAVYRPKVDEISLLTINSSTFNP------------------------------------  109

Query  444  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTF  623
            V EF+KG LQNLYWK+ GC SC G S   CLN +DCA+  +   + G    C++GIQLTF
Sbjct  110  VLEFQKGTLQNLYWKKFGCDSCPGDST-VCLNNEDCAVPNSKCSHAGA---CNIGIQLTF  165

Query  624  SGTDK  638
            SGTDK
Sbjct  166  SGTDK  170



>emb|CDY70957.1| BnaC03g73480D, partial [Brassica napus]
Length=156

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 10/116 (9%)
 Frame = +3

Query  291  DEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRL  470
            D+ISL          DS  GYMVAFAG KYAARS P  VA+  ++V+SFTLV EF+KGRL
Sbjct  13   DQISL----------DSSKGYMVAFAGSKYAARSVPIMVADNDHVVTSFTLVLEFQKGRL  62

Query  471  QNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTDK  638
            +NL+WK+DGC+ C G++ F CLN ++CA+K  S +N+GG VDCSLGIQL FSGTDK
Sbjct  63   ENLFWKKDGCSKCSGNAKFVCLNKEECAIKRQSCKNQGGQVDCSLGIQLAFSGTDK  118



>ref|XP_008354774.1| PREDICTED: uncharacterized protein LOC103418422 [Malus domestica]
Length=137

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +3

Query  324  SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCA  503
            SF PD+ G +MVAFAGR Y  RS P FVANG+Y V++FTLV EF KGRLQNLYWK+D C+
Sbjct  2    SFNPDAYG-FMVAFAGRNYVTRSLPTFVANGTYTVTTFTLVLEFNKGRLQNLYWKKDRCS  60

Query  504  SCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTDK  638
             C GSS F CLN Q+CA KT+S +N GG+VDCS+ IQL F GT+K
Sbjct  61   KCSGSSDFVCLNNQNCAFKTSSCKNHGGSVDCSIIIQLAFFGTNK  105



>ref|XP_002863988.1| hypothetical protein ARALYDRAFT_495006 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40247.1| hypothetical protein ARALYDRAFT_495006 [Arabidopsis lyrata subsp. 
lyrata]
Length=222

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 112/189 (59%), Gaps = 25/189 (13%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQLA  272
            S+TN+++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCD RLSL      
Sbjct  14   SNTNNIYSPCSDTRIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDHRLSLAAMNSQ  69

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  452
                                 D+ GGYMVAFAGRKYAAR  PAF+AN ++IV+SFTL+  
Sbjct  70   S--------LSSPSTPPPSSRDNYGGYMVAFAGRKYAARLIPAFIANNTFIVTSFTLIHH  121

Query  453  FKKGRLQNLYWKRDGCASCKG-------SSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGI  611
                  + L+        C G       + G   LN QDCA++T + + RGG+VDCSLGI
Sbjct  122  ------EILFMVLLCFKICIGRETGVRRARGIKILNKQDCAIRTPTCKGRGGSVDCSLGI  175

Query  612  QLTFSGTDK  638
            QL F GTDK
Sbjct  176  QLAFFGTDK  184



>gb|AFW67426.1| hypothetical protein ZEAMMB73_369494 [Zea mays]
Length=155

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            D N V+ PCAD +VQ+ DGFTFG+VF+ R++       +  VQLSPCD RL L N AQ+A
Sbjct  31   DHNGVYDPCADASVQRGDGFTFGVVFSGRDSF-----SSGGVQLSPCDSRLGLANRAQVA  85

Query  273  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            +FRP+VDEISLLTVN+SSF P S G YMVAFAG+KYAARSPP FV N SY V+ FTLV
Sbjct  86   LFRPQVDEISLLTVNSSSFDPSSSGVYMVAFAGKKYAARSPPVFVGNISYTVTGFTLV  143



>gb|AAU89199.1| expressed protein [Oryza sativa Japonica Group]
Length=459

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = +3

Query  333  PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCK  512
            P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV EF KGRLQNL+WK+DGC +C 
Sbjct  321  PATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVLEFNKGRLQNLHWKKDGCGACA  380

Query  513  GSSGFTCLNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTDK  638
             SS   C+  Q CA +T S +++ G VDCS+GIQL FSGTDK
Sbjct  381  KSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSGTDK  421


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 5/80 (6%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  272
            D N V+ PC+DT +Q+ DGF+FGI FA   A +   S    VQLSPCDRRLSL ++ QLA
Sbjct  169  DENGVYDPCSDTRIQRGDGFSFGIAFATLGAFYSGGS----VQLSPCDRRLSLASSGQLA  224

Query  273  VFRPKVDEISLLTVNTSSFF  332
            VFRPKVDEISLLT+NT++ F
Sbjct  225  VFRPKVDEISLLTINTTTGF  244



>ref|XP_006292065.1| hypothetical protein CARUB_v10018260mg, partial [Capsella rubella]
 gb|EOA24963.1| hypothetical protein CARUB_v10018260mg, partial [Capsella rubella]
Length=117

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 88/117 (75%), Gaps = 8/117 (7%)
 Frame = +3

Query  111  FSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQLAVFRP  284
            +SPC+D+TV   DGFTFGI FAA ++ F     N+ VQ SPCDRR  SLN N+++AVFRP
Sbjct  2    YSPCSDSTVGTDDGFTFGITFAAEDSFF---GTNRSVQYSPCDRRRFSLNGNSEVAVFRP  58

Query  285  KVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  446
            KVDEI+LLT+NTSS   F PD+  GYMVAFAG KY ARS P  V + ++IV+SFTLV
Sbjct  59   KVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYTARSVPIMVVDSNHIVTSFTLV  115



>gb|AFW68146.1| expp1 protein, mRNA isoform 1 [Zea mays]
 gb|AFW68147.1| hypothetical protein ZEAMMB73_851126 [Zea mays]
Length=132

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +3

Query  354  MVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTC  533
            MVAFAGRKYAARS P FV+N S  VSSFTLV EF KGRL+NL+WK+DGC +C G S F C
Sbjct  1    MVAFAGRKYAARSIPIFVSNTSVTVSSFTLVLEFNKGRLENLHWKKDGCGACSGKSNFVC  60

Query  534  LNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTDK  638
            L  Q CA++T S +++ G VDCS+GIQL FSGTDK
Sbjct  61   LGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSGTDK  94



>gb|EMT01607.1| hypothetical protein F775_23771 [Aegilops tauschii]
Length=782

 Score =   141 bits (355),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 67/101 (66%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +3

Query  339  SVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGS  518
            S GGYMVAFAGRK+AARSPP FV N SY V+ FTLVFEF KG LQNL+WK DGC+SC G 
Sbjct  396  SAGGYMVAFAGRKFAARSPPVFVGNSSYTVTGFTLVFEFHKGTLQNLFWKADGCSSCSGQ  455

Query  519  SGFTCLNGQDCAMKTNSXQNR-GGNVDCSLGIQLTFSGTDK  638
            +   C+    CA+KT+S +   GG VDCS GIQL FSGTDK
Sbjct  456  ANLGCVE-NSCAIKTSSCKGSGGGQVDCSPGIQLAFSGTDK  495



>gb|EMS61424.1| Protein IQ-DOMAIN 1 [Triticum urartu]
Length=548

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  339  SVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGS  518
            S GGYMVAFAGRK+AARSPP FV N SY V+ FTLVFEF KG LQNL+WK DGC+SC G 
Sbjct  410  SAGGYMVAFAGRKFAARSPPVFVGNSSYTVTGFTLVFEFHKGTLQNLFWKSDGCSSCSGQ  469

Query  519  SGFTCLNGQDCAMKTNSXQNR--GGNVDCSLGIQLTFSGTDK  638
            + F C+    CA+KT+S +    GG VDCS GIQL FSGTDK
Sbjct  470  ANFGCVEN-SCAIKTSSCRGNGGGGQVDCSPGIQLAFSGTDK  510



>gb|AAF23196.1|AC016795_9 unknown protein [Arabidopsis thaliana]
Length=127

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  354  MVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTC  533
            MVAFAG KYAARS P  VA+ ++IV       EF+KGRL+N++WK+DGC+ C G S F C
Sbjct  1    MVAFAGAKYAARSLPIMVADSNHIV------LEFQKGRLENMFWKKDGCSKCSGDSKFVC  54

Query  534  LNGQDCAMKTNSXQNRGGNVDCSLGIQLTFSGTDK  638
            LN ++CA+K  + +N+GG VDCSLGIQL FSGTDK
Sbjct  55   LNKEECAIKPQNCKNQGGQVDCSLGIQLAFSGTDK  89



>gb|EMT08784.1| hypothetical protein F775_31788 [Aegilops tauschii]
Length=166

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +3

Query  339  SVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGS  518
            S GGYMVAFAGRKYAARS P FV+N S  VSSFTLV EF KG+LQNL+WK+DGC +C G 
Sbjct  28   SAGGYMVAFAGRKYAARSQPVFVSNSSVTVSSFTLVLEFNKGKLQNLHWKKDGCGACTGK  87

Query  519  SGFTCLNGQDCAMKTN-SXQNRGGNVDCSLGIQLTFSGTDK  638
              F CL  Q CA++TN    N  G++DCS+GIQL FSGTDK
Sbjct  88   PNFICLGKQTCAIRTNICKSNNQGSMDCSIGIQLAFSGTDK  128



>ref|XP_006827430.1| hypothetical protein AMTR_s00009p00088580 [Amborella trichopoda]
 gb|ERM94846.1| hypothetical protein AMTR_s00009p00088580 [Amborella trichopoda]
Length=105

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 77/130 (59%), Gaps = 34/130 (26%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  269
            + D  +VF  C D  +QKSDGFTFGI F+                               
Sbjct  7    TDDKKNVFQLCQDARIQKSDGFTFGIAFS-------------------------------  35

Query  270  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  449
               RPKVD+ISLL +NT +F P++ GGYMV FAGRKYAARSPP FVAN +Y+V++FTLVF
Sbjct  36   --LRPKVDQISLLAINTINFAPETYGGYMVEFAGRKYAARSPPTFVANSTYMVATFTLVF  93

Query  450  EFKKGRLQNL  479
            EF KG  QNL
Sbjct  94   EF-KGTWQNL  102



>emb|CAN71120.1| hypothetical protein VITISV_000390 [Vitis vinifera]
Length=140

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 8/85 (9%)
 Frame = +3

Query  90   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  263
            S D N VFSPCADTTVQKSDGFTFGI FA+R+    N++      LSPCDRRL+L+  N+
Sbjct  22   SGDNNRVFSPCADTTVQKSDGFTFGIAFASRDKFSYNNT-----LLSPCDRRLALSSQNS  76

Query  264  QLAVFRPKVDEISLLTVN-TSSFFP  335
            Q+A FRPKVDEISLL++N TSSFFP
Sbjct  77   QIAAFRPKVDEISLLSINTTSSFFP  101



>ref|XP_008350235.1| PREDICTED: uncharacterized protein LOC103413547 [Malus domestica]
Length=1016

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 5/82 (6%)
 Frame = +3

Query  93   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQL  269
            S+ N+V+SPCADTTV++SDGFTFGI FA++ +      +N  VQLSPCD RL L +NAQ+
Sbjct  22   SNNNNVYSPCADTTVERSDGFTFGIAFASKESF----QRNGTVQLSPCDSRLFLSSNAQI  77

Query  270  AVFRPKVDEISLLTVNTSSFFP  335
            +VF PKVDEISLL+VN+SSF P
Sbjct  78   SVFXPKVDEISLLSVNSSSFNP  99



>emb|CAB62352.1| hypothetical protein [Arabidopsis thaliana]
Length=122

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  423  IVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSXQNRGGNVDCS  602
            +V +F  V EF+KGRLQNLYWKRD CASCKG+  F CL  Q CA++T S + RGG+V CS
Sbjct  14   VVMTFK-VMEFQKGRLQNLYWKRDVCASCKGNQNFVCLKKQVCAIRTPSCKGRGGSVGCS  72

Query  603  LGIQLTFSGTDK  638
            LGIQL FSGTDK
Sbjct  73   LGIQLAFSGTDK  84



>ref|XP_002975636.1| hypothetical protein SELMODRAFT_415872 [Selaginella moellendorffii]
 gb|EFJ23265.1| hypothetical protein SELMODRAFT_415872 [Selaginella moellendorffii]
Length=258

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 99/199 (50%), Gaps = 19/199 (10%)
 Frame = +3

Query  90   SSDTNHVFSPCADT-TVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---  257
            ++D N VF+PC     V   D  +  + +    + + N+S     QLSPCD  L      
Sbjct  19   AADNNPVFNPCRQLLPVGGKDSISIAVGYTGAPSVWYNNSDPSLNQLSPCDNALVAKMPA  78

Query  258  NAQLAVFRPKVDEISLLTVNTSSF------FPDSVGGYMVAFAGRKYAARSPPAFVANGS  419
            N+++AVFRP +D+IS+L  N +S+      FP +    +VA+AG      +P  F+    
Sbjct  79   NSRVAVFRPLLDQISMLRTNNASYLDLHTAFPGN--ATVVAYAGNPTIVSTPKYFLIPYG  136

Query  420  YIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNG------QDCAMKTNSXQNR  581
             I   +TLV E KKG L+NL WK D CASC G +  +C  G        C   +++  + 
Sbjct  137  RI-PIYTLVIELKKGVLKNLLWKDDKCASCGGKTSASCFQGACSTSESTCLDPSSTIASV  195

Query  582  GGNVDCSLGIQLTFSGTDK  638
             G   C   I + FSGTDK
Sbjct  196  KGADPCRFAINVAFSGTDK  214



>ref|XP_002973613.1| hypothetical protein SELMODRAFT_414097 [Selaginella moellendorffii]
 gb|EFJ25273.1| hypothetical protein SELMODRAFT_414097 [Selaginella moellendorffii]
Length=258

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 99/199 (50%), Gaps = 19/199 (10%)
 Frame = +3

Query  90   SSDTNHVFSPCADT-TVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---  257
            ++D N VF+PC     V   D  +  + +    + + N+S     QLSPCD  L      
Sbjct  19   AADNNPVFNPCRQLLPVGGKDSISIAVGYTGAPSVWYNNSDPSLNQLSPCDNALVAKMPA  78

Query  258  NAQLAVFRPKVDEISLLTVNTSSF------FPDSVGGYMVAFAGRKYAARSPPAFVANGS  419
            N+++AVFRP +D+IS+L  N +S+      FP +    +VA+AG      +P  F+    
Sbjct  79   NSRVAVFRPLLDQISMLRTNNASYLDLHTAFPGN--ATVVAYAGNPTIVSTPKYFLIPYG  136

Query  420  YIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNG------QDCAMKTNSXQNR  581
             I   +TLV E KKG L+NL WK D CASC G +  +C  G        C   +++  + 
Sbjct  137  RI-PIYTLVIELKKGVLKNLLWKDDKCASCGGKTSASCFQGACSTSESTCLDPSSTIASV  195

Query  582  GGNVDCSLGIQLTFSGTDK  638
             G   C   I + FSGTDK
Sbjct  196  KGADPCRFAINVAFSGTDK  214



>ref|NP_001051495.1| Os03g0787100 [Oryza sativa Japonica Group]
 gb|AAT75255.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99242.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13409.1| Os03g0787100 [Oryza sativa Japonica Group]
 dbj|BAG99059.1| unnamed protein product [Oryza sativa Japonica Group]
Length=123

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +3

Query  96   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  269
            DTN V+ PCAD  VQ+ DGFTFG+ FAAR   F     +  VQLSPCD RLSL    A+L
Sbjct  36   DTNGVYEPCADAAVQRGDGFTFGVAFAARGDFF-----SGGVQLSPCDGRLSLASKGAKL  90

Query  270  AVFRPKVDEISLLTVNTSS  326
            AVFRP+VDEISLLTVNTS+
Sbjct  91   AVFRPEVDEISLLTVNTSA  109



>ref|XP_002978961.1| hypothetical protein SELMODRAFT_418771 [Selaginella moellendorffii]
 gb|EFJ19918.1| hypothetical protein SELMODRAFT_418771 [Selaginella moellendorffii]
Length=379

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 99/199 (50%), Gaps = 19/199 (10%)
 Frame = +3

Query  90   SSDTNHVFSPCADTT-VQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---  257
            ++D N VF+PC     V   D  +  + +    + + N+S     QLSPCD  L      
Sbjct  19   AADKNPVFNPCRQLLPVGGKDSISIAVGYTGAPSVWYNNSDPSLNQLSPCDNALVAKMPA  78

Query  258  NAQLAVFRPKVDEISLLTVNTSSF------FPDSVGGYMVAFAGRKYAARSPPAFVANGS  419
            N+++AVFRP +D+IS+L  N +S+      FP +    +VA+AG      +P  F+    
Sbjct  79   NSRVAVFRPLLDQISMLRTNNASYLDLLTAFPGN--ATVVAYAGNPTIVSTPKYFLIPYG  136

Query  420  YIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNG------QDCAMKTNSXQNR  581
             I   +TLV E KKG L+NL WK D CASC G +  +C  G        C   +++  + 
Sbjct  137  RI-PIYTLVIELKKGVLKNLLWKDDKCASCGGKTSASCFQGACSTSESTCLDPSSTIASV  195

Query  582  GGNVDCSLGIQLTFSGTDK  638
             G   C   I + FSGTDK
Sbjct  196  KGADPCRFAINVAFSGTDK  214



>ref|XP_006303588.1| hypothetical protein CARUB_v100111180mg, partial [Capsella rubella]
 gb|EOA36486.1| hypothetical protein CARUB_v100111180mg, partial [Capsella rubella]
Length=78

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 5/74 (7%)
 Frame = +3

Query  111  FSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQLAVFRP  284
            +SPC+D+TV   DGFTFGI FAA  + F     N+ VQ SPCDRR  SLN N+++AVFRP
Sbjct  2    YSPCSDSTVGIDDGFTFGITFAAEYSFF---GTNRSVQYSPCDRRRFSLNGNSEVAVFRP  58

Query  285  KVDEISLLTVNTSS  326
            KVDEI+LLT+NTSS
Sbjct  59   KVDEITLLTINTSS  72



>ref|XP_001760696.1| predicted protein [Physcomitrella patens]
 gb|EDQ74435.1| predicted protein [Physcomitrella patens]
Length=486

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 91/199 (46%), Gaps = 17/199 (9%)
 Frame = +3

Query  87   SSSDTNHVFSPCAD-TTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--  257
            SS DTN V SPCA    +   D  T  +      AT+ N+S +K   LSPC    S    
Sbjct  240  SSKDTNPVMSPCAQLQPIGTGDAITVAVALGGNRATWHNNSNSKLNVLSPCSPHTSPGIP  299

Query  258  -NAQLAVFRPKVDEISLLTVN----TSSFFPDSVGGYMVAFAGRKYAAR-----SPPAFV  407
               Q+ VFRP VD++SL  +     TS     S    ++ +AG   A       S P   
Sbjct  300  LGTQVTVFRPIVDQLSLFQIYNQTLTSVATTFSEAASLLVYAGYNSATDNGTIVSEPRTF  359

Query  408  ANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCA--MKTNSXQNR  581
            +     +    LV EF++G L+NL WK D C  C G+S   CL+  +CA  + T   QN 
Sbjct  360  STSVGKIGGLLLVMEFEQGVLKNLTWKDDDCRDC-GNSSVLCLD-NNCATPIATCISQNT  417

Query  582  GGNVDCSLGIQLTFSGTDK  638
                 C   I + +SGTDK
Sbjct  418  TNPAICITRINVAYSGTDK  436



>emb|CDY54071.1| BnaA07g36330D [Brassica napus]
Length=169

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 23/111 (21%)
 Frame = +3

Query  111  FSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQLAVFRP  284
            +SPC+DT + K DGF  G+  + R A F++      VQL PCD RL L    AQL +FRP
Sbjct  17   YSPCSDTQISKRDGFIVGVAISRREAFFLD-----QVQLYPCDSRLGLAAKMAQLVLFRP  71

Query  285  KVDEIS------LLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGS  419
            KVDEIS      ++++  + FF        + F   ++A RS P  VA+GS
Sbjct  72   KVDEISIRWLYGIISMRLNLFF--------IFF--EQHAIRSYPVKVADGS  112



>ref|NP_190432.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE78439.1| uncharacterized protein AT3G48630 [Arabidopsis thaliana]
Length=128

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  351  YMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCA  503
            Y V   G +  +   PAF+AN ++IV+SFT V EF+KGRLQNLYWKRD CA
Sbjct  2    YNVGTRGSEIRSEVDPAFIANSTFIVTSFTWVMEFQKGRLQNLYWKRDVCA  52



>ref|XP_003064312.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51217.1| predicted protein [Micromonas pusilla CCMP1545]
Length=285

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 69/231 (30%), Positives = 91/231 (39%), Gaps = 57/231 (25%)
 Frame = +3

Query  81   AESSSDTNHVFSPC-ADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQL-SPCDRR---  245
            A S +    ++ PC A + VQ  D F+ GI F    A  I+D  +   ++  PCD     
Sbjct  34   APSPARAAGIYDPCVAQSAVQIGDTFSIGIAFYPGGA--ISDWYDSAGKIYHPCDATASA  91

Query  246  -LSLNNAQLAVFRPKVDEISLL---------TVNTSSFFPDSVGGYMVAFAGRKYAARSP  395
             L     Q   FRPKVD ++ L           NT+S  P  +   MVA+      +   
Sbjct  92   VLQTKLVQTQSFRPKVDHLTFLRGDATEETAVFNTASGTPIIM--TMVAYTANGIISDPR  149

Query  396  PAFVANGSYIV--------SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLN----  539
               V N   IV        SS TLV  F  G + +L W   GC+SCK   G +C+N    
Sbjct  150  IVRVTNSGAIVGGSDLGRVSSLTLVARFDGGNVAHLQWHDIGCSSCK--DGDSCINVDAK  207

Query  540  ----------------GQDCAMKTNSXQNRGGN--VDCSLGIQLTFSGTDK  638
                            G  CA+      N  G   + C L   L FSGTDK
Sbjct  208  GDHYACAGSETACSCTGSGCAL------NLAGTDVLRCQLTTSLGFSGTDK  252



>ref|XP_006584145.1| PREDICTED: uncharacterized protein LOC102665500 [Glycine max]
Length=129

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 3/56 (5%)
 Frame = +3

Query  168  VFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QLAVFRPKVDEISLLTVNTSSF  329
            +FA ++  F N++ + ++QLS CD RLSL+NA  Q++VFRPKVDEI LL VN SSF
Sbjct  1    MFAPKDKFFYNNNIS-NIQLSSCDMRLSLSNANSQISVFRPKVDEILLLIVNFSSF  55



>ref|XP_002501068.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62326.1| predicted protein [Micromonas sp. RCC299]
Length=265

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 89/212 (42%), Gaps = 46/212 (22%)
 Frame = +3

Query  108  VFSPCADTT-VQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDR--RLSLNNAQLA--  272
            ++ PCA    +   DGFT G+ +      +   S      L PC    R +L  A +A  
Sbjct  26   IYDPCASQPDLSAGDGFTIGLAY------YPGGSLEDWGTLHPCKSADRANLTAAGVASM  79

Query  273  VFRPKVDEISLLTVNTSSF--FPDSVGGY----MVAFAGRKYAARSPP--AFVANGSYIV  428
             FRPK+D ++    + +       SV G     +VA+AG     RS P  A V + S +V
Sbjct  80   TFRPKLDAMTFFRGSEAEEGQVLASVSGANIMTVVAYAGE---VRSEPRIARVTSASAVV  136

Query  429  --------SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLN----GQDCAMKTNSX  572
                    +S TLV  F +GRL+ L W   GC SC  + G  C++     Q CA      
Sbjct  137  GGVQPGRVNSLTLVARFDEGRLRYLQWHDLGCGSC--ARGDLCIHVGEGHQSCAGSETDC  194

Query  573  QNRGGN----------VDCSLGIQLTFSGTDK  638
               G N          + C L +   FSGTDK
Sbjct  195  SCAGDNCALDLTGSDVLRCQLTLATAFSGTDK  226



>ref|XP_001695376.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP01634.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=264

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 51/217 (24%), Positives = 87/217 (40%), Gaps = 48/217 (22%)
 Frame = +3

Query  108  VFSPCAD-TTVQKSDGFTFGI-VFAARNATFINDSK-------NKDVQLSPCDRRLSLNN  260
            ++ PC   T + + D F  G+ +  A NAT + +         N   Q    D  ++   
Sbjct  23   IYDPCQPLTPIARGDPFVIGLALIPAVNATLLANLTASYGGLCNTTFQ----DYLITNYK  78

Query  261  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYM------VAFAGRKYAARSPPAFVANGSY  422
            A +A++  +VD + +L +     +PD +   +      +A A  +    SP A++A+G  
Sbjct  79   ALIAIYNLRVDRLQVLRMP----YPDIIFNMVNATPPTMALAAFRANVTSPAAYIASGDP  134

Query  423  IVS-------SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNG------------Q  545
             V+       S  L+  F KG LQ L W    C  C G +G  C++              
Sbjct  135  AVTYGAGFVVSLALLPRFDKGNLQYLQWYDQSCNECGGKNGALCMHSTQAGVVACSTPLD  194

Query  546  DCAMKTNSXQNRGGNVD------CSLGIQLTFSGTDK  638
            +C    +   N   ++D      CS  I   + GTD+
Sbjct  195  NCTCTVSGVTNSSCSLDDARFDVCSTSINTAWMGTDR  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750