BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN004D19

Length=494
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004960824.1|  PREDICTED: uncharacterized protein LOC101759031  88.6    2e-19   Setaria italica
ref|XP_002439373.1|  hypothetical protein SORBIDRAFT_09g005320        86.3    1e-18   
ref|XP_008649395.1|  PREDICTED: uncharacterized protein LOC100276587  85.5    3e-18   
ref|XP_008785323.1|  PREDICTED: uncharacterized protein LOC103703...  84.0    9e-18   Phoenix dactylifera
ref|XP_009608238.1|  PREDICTED: uncharacterized protein LOC104102265  80.1    2e-16   Nicotiana tomentosiformis
ref|XP_008785314.1|  PREDICTED: uncharacterized protein LOC103703...  78.6    9e-16   
ref|XP_004242579.1|  PREDICTED: uncharacterized protein LOC101263916  78.2    1e-15   Solanum lycopersicum
ref|XP_006343664.1|  PREDICTED: uncharacterized protein LOC102592195  77.8    1e-15   Solanum tuberosum [potatoes]
dbj|BAK00985.1|  predicted protein                                    76.6    5e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568825.1|  PREDICTED: uncharacterized protein LOC100845082  76.3    6e-15   
ref|XP_003633138.1|  PREDICTED: uncharacterized protein LOC100854061  76.3    6e-15   Vitis vinifera
ref|XP_003524529.1|  PREDICTED: uncharacterized protein LOC100820016  75.9    9e-15   Glycine max [soybeans]
ref|XP_011000680.1|  PREDICTED: uncharacterized protein LOC105108179  74.7    2e-14   Populus euphratica
gb|ACU19699.1|  unknown                                               74.3    3e-14   Glycine max [soybeans]
ref|XP_002316603.2|  hypothetical protein POPTR_0011s00570g           75.1    4e-14   
gb|EYU28372.1|  hypothetical protein MIMGU_mgv1a017412mg              73.9    5e-14   Erythranthe guttata [common monkey flower]
ref|XP_008457941.1|  PREDICTED: uncharacterized protein LOC103497503  73.2    9e-14   Cucumis melo [Oriental melon]
emb|CDP03406.1|  unnamed protein product                              73.2    1e-13   Coffea canephora [robusta coffee]
ref|XP_009403412.1|  PREDICTED: uncharacterized protein LOC103986975  73.2    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK41292.1|  hypothetical protein AALP_AA2G111200                  72.8    1e-13   Arabis alpina [alpine rockcress]
ref|XP_010533182.1|  PREDICTED: uncharacterized protein LOC104809007  72.8    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_002887198.1|  hypothetical protein ARALYDRAFT_315886           72.0    2e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_002524438.1|  conserved hypothetical protein                   72.0    3e-13   Ricinus communis
gb|KGN60655.1|  hypothetical protein Csa_2G006000                     71.6    3e-13   Cucumis sativus [cucumbers]
ref|XP_007154953.1|  hypothetical protein PHAVU_003G161000g           71.2    5e-13   Phaseolus vulgaris [French bean]
ref|NP_564939.1|  uncharacterized protein                             70.9    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011078029.1|  PREDICTED: uncharacterized protein LOC105161882  70.9    7e-13   Sesamum indicum [beniseed]
gb|AFK34652.1|  unknown                                               70.5    1e-12   Lotus japonicus
ref|XP_008242717.1|  PREDICTED: uncharacterized protein LOC103341015  70.5    1e-12   Prunus mume [ume]
emb|CDY04243.1|  BnaC06g25720D                                        70.1    1e-12   
gb|EPS64767.1|  hypothetical protein M569_10020                       69.3    2e-12   Genlisea aurea
ref|XP_004508537.1|  PREDICTED: uncharacterized protein LOC101495050  69.7    2e-12   Cicer arietinum [garbanzo]
ref|XP_006391110.1|  hypothetical protein EUTSA_v10019233mg           71.2    2e-12   
gb|KJB64815.1|  hypothetical protein B456_010G066200                  69.3    3e-12   Gossypium raimondii
gb|ABK27051.1|  unknown                                               69.3    3e-12   Picea sitchensis
ref|XP_010688088.1|  PREDICTED: uncharacterized protein LOC104902105  67.8    9e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010047783.1|  PREDICTED: uncharacterized protein LOC104436641  67.8    9e-12   Eucalyptus grandis [rose gum]
ref|XP_009348188.1|  PREDICTED: uncharacterized protein LOC103939802  67.4    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_008385907.1|  PREDICTED: uncharacterized protein LOC103448416  67.4    1e-11   
ref|XP_009762882.1|  PREDICTED: uncharacterized protein LOC104214857  66.2    3e-11   Nicotiana sylvestris
emb|CDY07371.1|  BnaA07g24500D                                        66.6    3e-11   Brassica napus [oilseed rape]
ref|XP_006303087.1|  hypothetical protein CARUB_v10021249mg           66.2    3e-11   Capsella rubella
ref|XP_009105026.1|  PREDICTED: uncharacterized protein LOC103830955  66.2    3e-11   Brassica rapa
ref|XP_010249978.1|  PREDICTED: uncharacterized protein LOC104592348  65.5    6e-11   Nelumbo nucifera [Indian lotus]
gb|AFW77323.1|  hypothetical protein ZEAMMB73_342548                  65.5    7e-11   
gb|KCW79959.1|  hypothetical protein EUGRSUZ_C01288                   63.9    4e-10   Eucalyptus grandis [rose gum]
gb|KDP32356.1|  hypothetical protein JCGZ_13281                       60.1    5e-09   Jatropha curcas
gb|KHN27402.1|  hypothetical protein glysoja_022111                   60.1    7e-09   Glycine soja [wild soybean]
ref|XP_006654098.1|  PREDICTED: uncharacterized protein LOC102708154  58.9    1e-08   
ref|NP_001054791.1|  Os05g0176600                                     58.9    1e-08   
ref|XP_004287370.1|  PREDICTED: uncharacterized protein LOC101311024  57.8    3e-08   Fragaria vesca subsp. vesca
ref|XP_004139325.1|  PREDICTED: uncharacterized protein LOC101204...  58.5    4e-08   
ref|XP_006451005.1|  hypothetical protein CICLE_v10009973mg           58.2    4e-08   
ref|XP_006391111.1|  hypothetical protein EUTSA_v10019233mg           58.5    6e-08   
gb|KJB64814.1|  hypothetical protein B456_010G066200                  55.5    2e-07   Gossypium raimondii
gb|KCW79767.1|  hypothetical protein EUGRSUZ_C011091                  54.7    4e-07   Eucalyptus grandis [rose gum]
ref|XP_010042008.1|  PREDICTED: uncharacterized protein LOC104431005  54.7    9e-07   Eucalyptus grandis [rose gum]
ref|XP_010047936.1|  PREDICTED: uncharacterized protein LOC104436763  54.3    1e-06   
gb|KCW79971.1|  hypothetical protein EUGRSUZ_C01298                   54.3    1e-06   Eucalyptus grandis [rose gum]
ref|XP_007013337.1|  SH3 and FCH domain-containing protein DDB_G0...  52.8    2e-06   
gb|KCW79962.1|  hypothetical protein EUGRSUZ_C01292                   50.4    1e-05   Eucalyptus grandis [rose gum]



>ref|XP_004960824.1| PREDICTED: uncharacterized protein LOC101759031 [Setaria italica]
Length=81

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 3/81 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRT---RKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGV  284
            MASR+  Q  +     R     ++PP+M+LLPLVYAPVLPLIRI LRHNPVVRDRLFYGV
Sbjct  1    MASRSSSQFDDPAAARRPPQRERKPPYMLLLPLVYAPVLPLIRIGLRHNPVVRDRLFYGV  60

Query  285  LAGAFAHGLYLISELYDVESK  347
            LAGAFAHG YLISELYDVESK
Sbjct  61   LAGAFAHGAYLISELYDVESK  81



>ref|XP_002439373.1| hypothetical protein SORBIDRAFT_09g005320 [Sorghum bicolor]
 gb|EES17803.1| hypothetical protein SORBIDRAFT_09g005320 [Sorghum bicolor]
Length=81

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  171  KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            ++PP+M+LLPLVYAPVLPLIRI LRHNPVVRDRLFYGVLAGAFAHG YLISELYDVESK
Sbjct  23   RKPPYMLLLPLVYAPVLPLIRIGLRHNPVVRDRLFYGVLAGAFAHGAYLISELYDVESK  81



>ref|XP_008649395.1| PREDICTED: uncharacterized protein LOC100276587 [Zea mays]
 gb|ACG35616.1| hypothetical protein [Zea mays]
Length=80

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  171  KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            ++PP+M+LLPLVYAPVLPLIRI LRHNPVVRDRLFYGVLAGAFAHG YLISELYDVESK
Sbjct  22   RKPPYMLLLPLVYAPVLPLIRIGLRHNPVVRDRLFYGVLAGAFAHGAYLISELYDVESK  80



>ref|XP_008785323.1| PREDICTED: uncharacterized protein LOC103703984 isoform X2 [Phoenix 
dactylifera]
Length=77

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  144  NEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLIS  323
             +  + R RK PPFM+LLPL+YAPVLPLIRI LRHNPV+RDRLFYGVLAGAFAHG YLI+
Sbjct  10   GDAAVRRRRKGPPFMLLLPLIYAPVLPLIRIGLRHNPVLRDRLFYGVLAGAFAHGTYLIT  69

Query  324  ELYDVESK  347
            +LYD+E K
Sbjct  70   DLYDIERK  77



>ref|XP_009608238.1| PREDICTED: uncharacterized protein LOC104102265 [Nicotiana tomentosiformis]
Length=75

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS +D     E ++ R RK P F  L+PLVYAPVLPLIRI+LRH PV+RDRLFYGVLAG
Sbjct  1    MASPSDSA---ESQVIRRRKGPAFEYLVPLVYAPVLPLIRIALRHKPVLRDRLFYGVLAG  57

Query  294  AFAHGLYLISELYDVESK  347
            AFAHG YL+++LYD ESK
Sbjct  58   AFAHGTYLVTDLYDAESK  75



>ref|XP_008785314.1| PREDICTED: uncharacterized protein LOC103703984 isoform X1 [Phoenix 
dactylifera]
Length=79

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = +3

Query  144  NEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLI-  320
             +  + R RK PPFM+LLPL+YAPVLPLIRI LRHNPV+RDRLFYGVLAGAFAHG YLI 
Sbjct  10   GDAAVRRRRKGPPFMLLLPLIYAPVLPLIRIGLRHNPVLRDRLFYGVLAGAFAHGTYLIF  69

Query  321  -SELYDVESK  347
             ++LYD+E K
Sbjct  70   RTDLYDIERK  79



>ref|XP_004242579.1| PREDICTED: uncharacterized protein LOC101263916 [Solanum lycopersicum]
Length=72

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 6/78 (8%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            M S++D Q+       R RK P F  L+PL+YAP LPLIRI+LRH PV+RDRLFYGVLAG
Sbjct  1    MDSQSDSQV------IRRRKGPAFEYLVPLIYAPALPLIRIALRHKPVLRDRLFYGVLAG  54

Query  294  AFAHGLYLISELYDVESK  347
            AFAHG YL+++LYD ESK
Sbjct  55   AFAHGTYLVTDLYDAESK  72



>ref|XP_006343664.1| PREDICTED: uncharacterized protein LOC102592195 [Solanum tuberosum]
Length=72

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +3

Query  144  NEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLIS  323
            ++ ++ R RK P F  L+PL+YAP LPLIRI+LRH PV+RDRLFYGVLAGAFAHG YL++
Sbjct  5    SDSQVIRRRKGPAFEYLVPLIYAPALPLIRIALRHKPVLRDRLFYGVLAGAFAHGTYLVT  64

Query  324  ELYDVESK  347
            +LYD ESK
Sbjct  65   DLYDAESK  72



>dbj|BAK00985.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=81

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            IRI LRHNPV RDRLFYGVLAGAF HG YLISELYDVESK
Sbjct  42   IRIGLRHNPVWRDRLFYGVLAGAFVHGTYLISELYDVESK  81



>ref|XP_003568825.1| PREDICTED: uncharacterized protein LOC100845082 [Brachypodium 
distachyon]
 ref|XP_010231661.1| PREDICTED: uncharacterized protein LOC100845082 [Brachypodium 
distachyon]
Length=81

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            IRI LRHNPV RDRLFYGVLAGAFAHG YLISELYD ESK
Sbjct  42   IRIGLRHNPVWRDRLFYGVLAGAFAHGTYLISELYDAESK  81



>ref|XP_003633138.1| PREDICTED: uncharacterized protein LOC100854061 [Vitis vinifera]
 emb|CBI28151.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  FRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDV  338
            ++ ++ PPF + +PL+YAP+LP+IRI+LR NPV+RDRLFYGVLAGAF HGLYLI++LYD 
Sbjct  15   WKHKRGPPFALFVPLIYAPILPIIRITLRKNPVLRDRLFYGVLAGAFGHGLYLITDLYDT  74

Query  339  ESK  347
            E K
Sbjct  75   EKK  77



>ref|XP_003524529.1| PREDICTED: uncharacterized protein LOC100820016 [Glycine max]
Length=77

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 3/79 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQ-PPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MA+ +DP   N++ + R R   PP   LLPL+YAPVLPLIR+SLRH PV+RDRLF  VLA
Sbjct  1    MATPSDPS--NQEAVVRRRNNGPPIKFLLPLIYAPVLPLIRLSLRHKPVLRDRLFTAVLA  58

Query  291  GAFAHGLYLISELYDVESK  347
            GAFAHG YL+++LYD+ESK
Sbjct  59   GAFAHGFYLVTDLYDIESK  77



>ref|XP_011000680.1| PREDICTED: uncharacterized protein LOC105108179 [Populus euphratica]
 gb|ABK93653.1| unknown [Populus trichocarpa]
Length=79

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQ-PPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +DP  P      R +K  PP   L+PLVYAPVLPLIR++LR NPVVRDRLF  VL 
Sbjct  1    MASPSDPTNPEAAAAIRRKKNGPPIKFLVPLVYAPVLPLIRLTLRKNPVVRDRLFTAVLV  60

Query  291  GAFAHGLYLISELYDVESK  347
            GAFAHG YL++++YD ESK
Sbjct  61   GAFAHGFYLVTDIYDSESK  79



>gb|ACU19699.1| unknown [Glycine max]
Length=77

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 3/79 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQ-PPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MA+ +DP   N++ + R R   PP   LLPL+YAPVLPLIR+SLRH PV+RDRLF  VLA
Sbjct  1    MATPSDPS--NQEAVVRRRNNGPPIKFLLPLIYAPVLPLIRLSLRHKPVLRDRLFTAVLA  58

Query  291  GAFAHGLYLISELYDVESK  347
            GAFAHG YL+++LYD+ES+
Sbjct  59   GAFAHGFYLVTDLYDIESE  77



>ref|XP_002316603.2| hypothetical protein POPTR_0011s00570g, partial [Populus trichocarpa]
 gb|EEE97215.2| hypothetical protein POPTR_0011s00570g, partial [Populus trichocarpa]
Length=114

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQ-PPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +DP  P      R +K  PP   L+PLVYAPVLPLIR++LR NPVVRDRLF  VL 
Sbjct  36   MASPSDPTNPEAAAAIRRKKNGPPIKFLVPLVYAPVLPLIRLTLRKNPVVRDRLFTAVLV  95

Query  291  GAFAHGLYLISELYDVESK  347
            GAFAHG YL++++YD ESK
Sbjct  96   GAFAHGFYLVTDIYDSESK  114



>gb|EYU28372.1| hypothetical protein MIMGU_mgv1a017412mg [Erythranthe guttata]
Length=76

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  132  PQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGL  311
            P  P+ Q+  R +K  P   L+PL+YAPVLPLIR++LRH PV+RDRLF  VLAGAFAHG+
Sbjct  5    PLDPSNQEFIRRKKSAPIKFLVPLIYAPVLPLIRLTLRHRPVLRDRLFTAVLAGAFAHGM  64

Query  312  YLISELYDVESK  347
            YL+S++YD ESK
Sbjct  65   YLVSDIYDAESK  76



>ref|XP_008457941.1| PREDICTED: uncharacterized protein LOC103497503 [Cucumis melo]
Length=76

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  126  TDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAH  305
            + P  P+ ++ F  ++  PF  L+PLVYAPVLPLIRI+LR NPVVRDRLF  VLAGAFAH
Sbjct  3    SPPVDPSSREAFPRKQSAPFKFLVPLVYAPVLPLIRIALRKNPVVRDRLFTAVLAGAFAH  62

Query  306  GLYLISELYDVESK  347
            G YL++++YD ESK
Sbjct  63   GFYLVTDIYDAESK  76



>emb|CDP03406.1| unnamed protein product [Coffea canephora]
Length=76

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  144  NEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLIS  323
            N++ + R  K PPF  L+PL+YAPVLPLIR++LRH PV+RDRLF  VLAGAFAHG YL++
Sbjct  9    NQEVVRRQNKGPPFKFLVPLIYAPVLPLIRLTLRHRPVLRDRLFTAVLAGAFAHGFYLVT  68

Query  324  ELYDVESK  347
            ++YD ESK
Sbjct  69   DIYDAESK  76



>ref|XP_009403412.1| PREDICTED: uncharacterized protein LOC103986975 [Musa acuminata 
subsp. malaccensis]
Length=77

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS +D     +  M R  +  P   L+PL+YAP+LPLIRI LRHNPV+R+RLF+GVLAG
Sbjct  1    MASSSDFST-GDAVMKRQNRGSPIKFLVPLIYAPILPLIRIGLRHNPVMRERLFFGVLAG  59

Query  294  AFAHGLYLISELYDVESK  347
            AFAHG YL+++LYD+ESK
Sbjct  60   AFAHGAYLVTDLYDIESK  77



>gb|KFK41292.1| hypothetical protein AALP_AA2G111200 [Arabis alpina]
Length=75

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS +DP   ++  M R +K  P   L+PL+YAP LPLIR+SLRH PV+RDRLF  VLAG
Sbjct  1    MASSSDP---SKTVMERKKKSAPIKFLVPLIYAPALPLIRLSLRHKPVLRDRLFGLVLAG  57

Query  294  AFAHGLYLISELYDVESK  347
            AFAHG YL++++YD ESK
Sbjct  58   AFAHGFYLVTDIYDAESK  75



>ref|XP_010533182.1| PREDICTED: uncharacterized protein LOC104809007 [Tarenaya hassleriana]
Length=79

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +3

Query  114  MASRTDPQIP-NEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            M S +DP     +    R RK PPF  L+PLVYAPVLPL+R+SLRH PV+RDRLF  VLA
Sbjct  1    MESSSDPSKQLRDSVTERKRKGPPFKFLVPLVYAPVLPLVRLSLRHKPVLRDRLFTLVLA  60

Query  291  GAFAHGLYLISELYDVESK  347
            GAFAHG YL++++YD ESK
Sbjct  61   GAFAHGFYLVTDIYDAESK  79



>ref|XP_002887198.1| hypothetical protein ARALYDRAFT_315886 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63457.1| hypothetical protein ARALYDRAFT_315886 [Arabidopsis lyrata subsp. 
lyrata]
Length=75

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS +DP   ++  M R +K  P   L+PL+YAP LPLIR+SLRH PV+RDRLF  VLAG
Sbjct  1    MASSSDP---SKTVMERKKKGAPIKFLVPLIYAPALPLIRLSLRHKPVLRDRLFGLVLAG  57

Query  294  AFAHGLYLISELYDVESK  347
            AFAHG YL++++YD ESK
Sbjct  58   AFAHGFYLVTDIYDAESK  75



>ref|XP_002524438.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37878.1| conserved hypothetical protein [Ricinus communis]
Length=80

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  129  DPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHG  308
            DP +  +  + +    PP   L+PLVYAP+LPLIRI+LR NPVVRDRLF  VLAGAFAHG
Sbjct  8    DPSVRRDVAVRKQNNGPPVKFLVPLVYAPILPLIRIALRRNPVVRDRLFTAVLAGAFAHG  67

Query  309  LYLISELYDVESK  347
             YL++++YDVESK
Sbjct  68   FYLVTDIYDVESK  80



>gb|KGN60655.1| hypothetical protein Csa_2G006000 [Cucumis sativus]
Length=76

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  132  PQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGL  311
            P  P+ ++ F  ++  P+  L+PLVYAPVLPLIRI+LR NPVVRDRLF  VLAGAFAHG 
Sbjct  5    PVDPSSREAFPRKQSAPYKFLVPLVYAPVLPLIRIALRKNPVVRDRLFTAVLAGAFAHGF  64

Query  312  YLISELYDVESK  347
            YL++++YD ESK
Sbjct  65   YLVTDIYDAESK  76



>ref|XP_007154953.1| hypothetical protein PHAVU_003G161000g [Phaseolus vulgaris]
 gb|ESW26947.1| hypothetical protein PHAVU_003G161000g [Phaseolus vulgaris]
Length=77

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MA+ +DP    E  M R    PP   L+PL+YAP LPLIR++LRH PV+RDRLF  VLAG
Sbjct  1    MATPSDPSN-QEAVMRRKNNGPPIKFLIPLIYAPALPLIRLALRHKPVLRDRLFTAVLAG  59

Query  294  AFAHGLYLISELYDVESK  347
             FAHG YLI++LYD ESK
Sbjct  60   GFAHGFYLITDLYDKESK  77



>ref|NP_564939.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65811.1| unknown [Arabidopsis thaliana]
 gb|ABD38870.1| At1g68680 [Arabidopsis thaliana]
 gb|AEE34827.1| uncharacterized protein AT1G68680 [Arabidopsis thaliana]
Length=75

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS +DP  P    M R +K  P   L+PL+YAP LPLIR+SLRH PV+RDRLF  VL G
Sbjct  1    MASSSDPSKPV---MERKKKGAPIKFLVPLIYAPALPLIRLSLRHKPVLRDRLFGLVLVG  57

Query  294  AFAHGLYLISELYDVESK  347
            AFAHG YL++++YD ESK
Sbjct  58   AFAHGFYLVTDIYDAESK  75



>ref|XP_011078029.1| PREDICTED: uncharacterized protein LOC105161882 [Sesamum indicum]
Length=77

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 2/74 (3%)
 Frame = +3

Query  126  TDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAH  305
            +DP   N + + R +K  PF  L+PL+YAPVLPLIR+SLRH PV+RDRLF  VLAGAFAH
Sbjct  6    SDPS--NLEVIRRQKKGAPFKFLVPLIYAPVLPLIRLSLRHRPVLRDRLFTAVLAGAFAH  63

Query  306  GLYLISELYDVESK  347
            G YL++++YD ESK
Sbjct  64   GFYLVTDIYDAESK  77



>gb|AFK34652.1| unknown [Lotus japonicus]
Length=80

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            IRI+LRH PVVRDRLF+ VLAGAFAHG YL+++LYD ESK
Sbjct  41   IRIALRHKPVVRDRLFFAVLAGAFAHGSYLVTDLYDAESK  80



>ref|XP_008242717.1| PREDICTED: uncharacterized protein LOC103341015 [Prunus mume]
Length=80

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = +3

Query  108  ATMASRTDPQIPNEQKMFRTRK-QPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGV  284
            A+  S +DP   N++   R R     F  L+PL+YAPVLPLIR+SLR NPVVRDRLF  V
Sbjct  2    ASWPSSSDPS--NQEAAIRKRSPGSQFKFLVPLIYAPVLPLIRLSLRKNPVVRDRLFTAV  59

Query  285  LAGAFAHGLYLISELYDVESK  347
            L GAFAHG YL+++LYDVESK
Sbjct  60   LVGAFAHGFYLVTDLYDVESK  80



>emb|CDY04243.1| BnaC06g25720D [Brassica napus]
Length=75

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            M+S +DP   ++  M R +K  P   L+PL+YAP LPLIR++LRH PV+RDRLF  VLAG
Sbjct  1    MSSSSDP---SKTGMERKKKGAPIKFLVPLIYAPALPLIRLTLRHQPVLRDRLFGLVLAG  57

Query  294  AFAHGLYLISELYDVESK  347
            AFAHG YL++++YD ESK
Sbjct  58   AFAHGFYLVTDIYDAESK  75



>gb|EPS64767.1| hypothetical protein M569_10020, partial [Genlisea aurea]
Length=63

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  162  RTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVE  341
            R R   PF  L+PL+YAPVLPLIRISLRH PV+RDRLF  VLAGAFAHG YL+++LYD E
Sbjct  2    RKRSNTPFKFLVPLIYAPVLPLIRISLRHKPVLRDRLFTVVLAGAFAHGFYLVTDLYDSE  61

Query  342  SK  347
            SK
Sbjct  62   SK  63



>ref|XP_004508537.1| PREDICTED: uncharacterized protein LOC101495050 [Cicer arietinum]
Length=78

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MA      I  E  + R    PPF  L PL+YAPVLPLIR+SLRH PV+RDRLF  VLAG
Sbjct  1    MAPPPSDPINQEAVVRRKNNGPPFKFLFPLIYAPVLPLIRLSLRHKPVLRDRLFTAVLAG  60

Query  294  AFAHGLYLISELYDVESK  347
            A  HG+YL+++LYD+ESK
Sbjct  61   AVVHGVYLVTDLYDIESK  78



>ref|XP_006391110.1| hypothetical protein EUTSA_v10019233mg [Eutrema salsugineum]
 gb|ESQ28396.1| hypothetical protein EUTSA_v10019233mg [Eutrema salsugineum]
Length=167

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 60/79 (76%), Gaps = 3/79 (4%)
 Frame = +3

Query  111  TMASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
             MAS +DP   ++  M R +K  P   L+PL+YAPVLPLIR+SLRH PV+RDRLF  VLA
Sbjct  92   VMASSSDP---SKTVMERKKKGAPIKFLVPLIYAPVLPLIRLSLRHKPVLRDRLFGLVLA  148

Query  291  GAFAHGLYLISELYDVESK  347
            GAFAHG YL++++YD ESK
Sbjct  149  GAFAHGFYLVTDIYDAESK  167



>gb|KJB64815.1| hypothetical protein B456_010G066200 [Gossypium raimondii]
 gb|KJB64816.1| hypothetical protein B456_010G066200 [Gossypium raimondii]
Length=77

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 3/79 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTR-KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +D    N + ++R + K PPF  L+PLVYAPVLPLIR+SLR NPV+RDRLF  VLA
Sbjct  1    MASPSDHS--NSEVVYRRQNKGPPFKFLVPLVYAPVLPLIRLSLRKNPVLRDRLFTIVLA  58

Query  291  GAFAHGLYLISELYDVESK  347
            GAF HG YL+S+LYD ESK
Sbjct  59   GAFIHGSYLVSDLYDAESK  77



>gb|ABK27051.1| unknown [Picea sitchensis]
Length=81

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +3

Query  105  SATMASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGV  284
            +A+ AS +DP +   +++ R  ++PPF  L+PLVYAP+LPLI+I+L+  PV+RDRLF+ V
Sbjct  2    AASQAS-SDPSVLAGEEIRRQPRKPPFKYLVPLVYAPILPLIKITLKRQPVLRDRLFFLV  60

Query  285  LAGAFAHGLYLISELYDVESK  347
            L GAF HG YLI++LY+VESK
Sbjct  61   LGGAFCHGSYLITDLYNVESK  81



>ref|XP_010688088.1| PREDICTED: uncharacterized protein LOC104902105 [Beta vulgaris 
subsp. vulgaris]
Length=76

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            IRISL+H PV+RDRLF  VLAGAF HG YL++ LYDVESK
Sbjct  37   IRISLKHKPVLRDRLFTAVLAGAFVHGTYLVTTLYDVESK  76



>ref|XP_010047783.1| PREDICTED: uncharacterized protein LOC104436641 [Eucalyptus grandis]
Length=77

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 60/79 (76%), Gaps = 3/79 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTR-KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +D    N++ + R + K  P   L+PL+YAPVLPLIR+SLR NPVVRDRLF  VLA
Sbjct  1    MASPSDAS--NQEAVVRKQNKGAPIKFLVPLIYAPVLPLIRLSLRRNPVVRDRLFTLVLA  58

Query  291  GAFAHGLYLISELYDVESK  347
            GAFAHG YL++++YD ESK
Sbjct  59   GAFAHGFYLVTDIYDAESK  77



>ref|XP_009348188.1| PREDICTED: uncharacterized protein LOC103939802 [Pyrus x bretschneideri]
Length=82

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            IR+SLR NPVVRDRLF  VL GAFAHG YL+++LYD ESK
Sbjct  43   IRLSLRKNPVVRDRLFTAVLVGAFAHGFYLVTDLYDAESK  82



>ref|XP_008385907.1| PREDICTED: uncharacterized protein LOC103448416 [Malus domestica]
Length=82

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            IR+SLR NPVVRDRLF  VL GAFAHG YL+++LYD ESK
Sbjct  43   IRLSLRKNPVVRDRLFTAVLVGAFAHGFYLVTDLYDAESK  82



>ref|XP_009762882.1| PREDICTED: uncharacterized protein LOC104214857 [Nicotiana sylvestris]
Length=68

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%), Gaps = 3/69 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS +D     E ++ R RK P F  L+PLVYAPVLPLIRI+LRH PV+RDRLFYGVLAG
Sbjct  1    MASPSDSA---ESQVIRRRKGPAFEYLVPLVYAPVLPLIRIALRHKPVLRDRLFYGVLAG  57

Query  294  AFAHGLYLI  320
            AFAHG YL+
Sbjct  58   AFAHGTYLV  66



>emb|CDY07371.1| BnaA07g24500D [Brassica napus]
Length=76

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  141  PNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLI  320
            P++  M R +K  P   L+PL+YAP LPLIR++LRH PV+RDRLF  VLAGAF HG YL+
Sbjct  8    PSKTGMERKKKGAPIKFLVPLIYAPALPLIRLTLRHQPVLRDRLFGLVLAGAFVHGFYLV  67

Query  321  SELYDVESK  347
            +++YD ESK
Sbjct  68   TDIYDAESK  76



>ref|XP_006303087.1| hypothetical protein CARUB_v10021249mg [Capsella rubella]
 gb|EOA35985.1| hypothetical protein CARUB_v10021249mg [Capsella rubella]
Length=75

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 3/78 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS +DP  P    M R +K  P   L+PL+YAP LPLIR+SLR  PV+RDRLF  VL G
Sbjct  1    MASSSDPSKPV---MERKKKGAPIKFLVPLIYAPALPLIRLSLRRQPVLRDRLFGLVLVG  57

Query  294  AFAHGLYLISELYDVESK  347
            AFAHG YL++++YD ESK
Sbjct  58   AFAHGFYLVTDIYDQESK  75



>ref|XP_009105026.1| PREDICTED: uncharacterized protein LOC103830955 [Brassica rapa]
Length=76

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  141  PNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLI  320
            P++  M R +K  P   L+PL+YAP LPLIR++LRH PV+RDRLF  VLAGAF HG YL+
Sbjct  8    PSKTMMERKKKGAPIKFLVPLIYAPALPLIRLTLRHQPVLRDRLFGLVLAGAFVHGFYLV  67

Query  321  SELYDVESK  347
            +++YD ESK
Sbjct  68   TDIYDAESK  76



>ref|XP_010249978.1| PREDICTED: uncharacterized protein LOC104592348 [Nelumbo nucifera]
Length=77

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  162  RTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVE  341
            +  K PPF  L+PL+YAPVLPLIR+ LR NPV+RDRLF  VLAG F HG YL+++LYD+E
Sbjct  16   KQNKGPPFKFLVPLLYAPVLPLIRLGLRRNPVLRDRLFTVVLAGGFLHGFYLVTDLYDIE  75

Query  342  SK  347
            SK
Sbjct  76   SK  77



>gb|AFW77323.1| hypothetical protein ZEAMMB73_342548 [Zea mays]
Length=94

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  168  RKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGLYLI  320
             ++PP+M+LLPLVYAPVLPLIRI LRHNPVVRDRLFYGVLAGAFAHG YL+
Sbjct  21   ERKPPYMLLLPLVYAPVLPLIRIGLRHNPVVRDRLFYGVLAGAFAHGAYLM  71



>gb|KCW79959.1| hypothetical protein EUGRSUZ_C01288, partial [Eucalyptus grandis]
Length=109

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLISELYDVESK  347
            IR+SLR NPVVRD LF  VLAGAFAHG YL++++YD ESK
Sbjct  70   IRLSLRRNPVVRDHLFTLVLAGAFAHGFYLVTDIYDAESK  109



>gb|KDP32356.1| hypothetical protein JCGZ_13281 [Jatropha curcas]
Length=70

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS +DP +  E  + +    P F  L+PLVYAP+LPLIRISLR NPV+RDRLF  VLAG
Sbjct  1    MASSSDPSV-REPVVRKQNNGPAFKFLVPLVYAPILPLIRISLRRNPVLRDRLFTAVLAG  59

Query  294  AFAHGLYLI  320
            AFAHG YL+
Sbjct  60   AFAHGCYLV  68



>gb|KHN27402.1| hypothetical protein glysoja_022111 [Glycine soja]
Length=101

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQ-PPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MA+ +DP   N++ + R R   PP   LLPL+YAPVLPLIR+SLRH PV+RDRLF  VLA
Sbjct  1    MATPSDPS--NQEAVVRRRNNGPPIKFLLPLIYAPVLPLIRLSLRHKPVLRDRLFTAVLA  58

Query  291  GAFAHGLYLI  320
            GAFAHG YL+
Sbjct  59   GAFAHGFYLV  68



>ref|XP_006654098.1| PREDICTED: uncharacterized protein LOC102708154 [Oryza brachyantha]
Length=78

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLI  320
            IRI LRHNPV RDRLFYGVLAGAFAHG YL+
Sbjct  48   IRIGLRHNPVWRDRLFYGVLAGAFAHGTYLM  78



>ref|NP_001054791.1| Os05g0176600 [Oryza sativa Japonica Group]
 gb|AAT77345.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16705.1| Os05g0176600 [Oryza sativa Japonica Group]
 gb|EEC78612.1| hypothetical protein OsI_18654 [Oryza sativa Indica Group]
 gb|EEE62516.1| hypothetical protein OsJ_17314 [Oryza sativa Japonica Group]
Length=78

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  228  IRISLRHNPVVRDRLFYGVLAGAFAHGLYLI  320
            IRI LRHNPV RDRLFYGVLAGAFAHG YL+
Sbjct  48   IRIGLRHNPVWRDRLFYGVLAGAFAHGTYLM  78



>ref|XP_004287370.1| PREDICTED: uncharacterized protein LOC101311024 [Fragaria vesca 
subsp. vesca]
Length=77

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  108  ATMASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVL  287
            AT  S +DP     + + +  K      L+PL+YAPVLPLIRI+LR  PV+RDRLF  VL
Sbjct  2    ATWPSSSDPSNQQPEAIRKRNKSDQIKFLIPLIYAPVLPLIRITLRKQPVLRDRLFIAVL  61

Query  288  AGAFAHGLYLISELYD  335
            AGAFAHG YL+++L++
Sbjct  62   AGAFAHGTYLVTDLFN  77



>ref|XP_004139325.1| PREDICTED: uncharacterized protein LOC101204118 isoform 1 [Cucumis 
sativus]
 ref|XP_004139326.1| PREDICTED: uncharacterized protein LOC101204118 isoform 2 [Cucumis 
sativus]
 ref|XP_004163592.1| PREDICTED: uncharacterized protein LOC101231537 isoform 1 [Cucumis 
sativus]
 ref|XP_004163593.1| PREDICTED: uncharacterized protein LOC101231537 isoform 2 [Cucumis 
sativus]
Length=130

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  132  PQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAHGL  311
            P  P+ ++ F  ++  P+  L+PLVYAPVLPLIRI+LR NPVVRDRLF  VLAGAFAHG 
Sbjct  5    PVDPSSREAFPRKQSAPYKFLVPLVYAPVLPLIRIALRKNPVVRDRLFTAVLAGAFAHGF  64

Query  312  YLISEL  329
            YL+  L
Sbjct  65   YLVYPL  70



>ref|XP_006451005.1| hypothetical protein CICLE_v10009973mg [Citrus clementina]
 gb|ESR64245.1| hypothetical protein CICLE_v10009973mg [Citrus clementina]
 gb|KDO80351.1| hypothetical protein CISIN_1g033759mg [Citrus sinensis]
 gb|KDO80352.1| hypothetical protein CISIN_1g033759mg [Citrus sinensis]
Length=112

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAG  293
            MAS ++     E  M +    PP+  L+PL+YAPVLPLIRI LR NPVVRDRLF  VLAG
Sbjct  1    MASSSNSS-QQEAVMRKQNNGPPYKFLVPLIYAPVLPLIRIGLRKNPVVRDRLFTAVLAG  59

Query  294  AFAHGLYLISELY  332
            AFAHG YL+  L+
Sbjct  60   AFAHGFYLVYPLF  72



>ref|XP_006391111.1| hypothetical protein EUTSA_v10019233mg [Eutrema salsugineum]
 gb|ESQ28397.1| hypothetical protein EUTSA_v10019233mg [Eutrema salsugineum]
Length=167

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +3

Query  111  TMASRTDPQIPNEQKMFRTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
             MAS +DP   ++  M R +K  P   L+PL+YAPVLPLIR+SLRH PV+RDRLF  VLA
Sbjct  92   VMASSSDP---SKTVMERKKKGAPIKFLVPLIYAPVLPLIRLSLRHKPVLRDRLFGLVLA  148

Query  291  GAFAHGLYLI  320
            GAFAHG YL+
Sbjct  149  GAFAHGFYLV  158



>gb|KJB64814.1| hypothetical protein B456_010G066200 [Gossypium raimondii]
Length=78

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTR-KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +D    N + ++R + K PPF  L+PLVYAPVLPLIR+SLR NPV+RDRLF  VLA
Sbjct  1    MASPSDHS--NSEVVYRRQNKGPPFKFLVPLVYAPVLPLIRLSLRKNPVLRDRLFTIVLA  58

Query  291  GAFAHGLYLISELY  332
            GAF HG YL+   Y
Sbjct  59   GAFIHGSYLVYPYY  72



>gb|KCW79767.1| hypothetical protein EUGRSUZ_C011091, partial [Eucalyptus grandis]
Length=68

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTR-KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +D    N++ + R + K  P   L+PL+YAPVLPLIR+SLR NPVVRDRLF  VLA
Sbjct  1    MASPSDAS--NQEAVVRKQNKGAPIKFLVPLIYAPVLPLIRLSLRRNPVVRDRLFTLVLA  58

Query  291  GAFAHGLYLI  320
            GAFAHG YL+
Sbjct  59   GAFAHGFYLV  68



>ref|XP_010042008.1| PREDICTED: uncharacterized protein LOC104431005 [Eucalyptus grandis]
Length=135

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTR-KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +D    N++ + R + K  P   L+PL+YAPVLPLIR+SLR NPVVRDRLF  VLA
Sbjct  1    MASPSDAS--NQEAVVRKQSKGAPIKFLVPLIYAPVLPLIRLSLRRNPVVRDRLFTLVLA  58

Query  291  GAFAHGLYLI  320
            GAFAHG YL+
Sbjct  59   GAFAHGFYLV  68



>ref|XP_010047936.1| PREDICTED: uncharacterized protein LOC104436763 [Eucalyptus grandis]
Length=135

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTR-KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +D    N++ + R + K  P   L+PL+YAPVLPLIR+SLR NPVVRDRLF  VLA
Sbjct  1    MASPSDAS--NQEAVVRKQNKGAPIKFLVPLIYAPVLPLIRLSLRRNPVVRDRLFTLVLA  58

Query  291  GAFAHGLYLI  320
            GAFAHG YL+
Sbjct  59   GAFAHGFYLV  68



>gb|KCW79971.1| hypothetical protein EUGRSUZ_C01298 [Eucalyptus grandis]
Length=135

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +3

Query  114  MASRTDPQIPNEQKMFRTR-KQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLA  290
            MAS +D    N++ + R + K  P   L+PL+YAPVLPLIR+SLR NPVVRDRLF  VLA
Sbjct  1    MASPSDTS--NQEAVVRKQNKGAPIKFLVPLIYAPVLPLIRLSLRRNPVVRDRLFTLVLA  58

Query  291  GAFAHGLYLI  320
            GAFAHG YL+
Sbjct  59   GAFAHGFYLV  68



>ref|XP_007013337.1| SH3 and FCH domain-containing protein DDB_G0271676, partial [Theobroma 
cacao]
 gb|EOY30956.1| SH3 and FCH domain-containing protein DDB_G0271676, partial [Theobroma 
cacao]
Length=96

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  132  PQIPNEQKMF--RTRKQPPFMMllplvyapvlplIRISLRHNPVVRDRLFYGVLAGAFAH  305
            P  P++ ++   R  K PPF  L+PLVYAPVLPLIR+SLR NPV+RDRLF  VLAGAF H
Sbjct  2    PSHPSDSEVVYRRQNKGPPFKFLVPLVYAPVLPLIRLSLRKNPVLRDRLFTLVLAGAFVH  61

Query  306  GLYL  317
            G YL
Sbjct  62   GSYL  65



>gb|KCW79962.1| hypothetical protein EUGRSUZ_C01292, partial [Eucalyptus grandis]
Length=97

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  231  RISLRHNPVVRDRLFYGVLAGAFAHGLYLI  320
            R+SLR NPVVRDRLF  VLAGAFAHG YL+
Sbjct  1    RLSLRRNPVVRDRLFTLVLAGAFAHGFYLV  30



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780