BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN003F16

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008467047.1|  PREDICTED: glutamate--glyoxylate aminotransf...    246   2e-78   Cucumis melo [Oriental melon]
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    253   6e-78   Nicotiana tomentosiformis
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    252   8e-78   Solanum lycopersicum
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    251   2e-77   Nicotiana sylvestris
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    251   2e-77   Malus domestica [apple tree]
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    250   4e-77   
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    250   5e-77   Solanum tuberosum [potatoes]
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           250   5e-77   Morus notabilis
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    250   7e-77   Prunus mume [ume]
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    249   8e-77   Eucalyptus grandis [rose gum]
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    249   1e-76   Pyrus x bretschneideri [bai li]
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   248   2e-76   Citrus sinensis [apfelsine]
emb|CBI23368.3|  unnamed protein product                                248   2e-76   Vitis vinifera
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             248   3e-76   Citrus clementina [clementine]
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                248   3e-76   Erythranthe guttata [common monkey flower]
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             248   3e-76   Prunus persica
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    248   4e-76   
emb|CDP13207.1|  unnamed protein product                                248   5e-76   Coffea canephora [robusta coffee]
ref|NP_001268094.1|  uncharacterized protein LOC100261274               248   5e-76   Vitis vinifera
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    247   5e-76   
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    247   6e-76   Cicer arietinum [garbanzo]
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       247   1e-75   Cucumis sativus [cucumbers]
ref|XP_003613139.1|  Alanine aminotransferase                           246   1e-75   Medicago truncatula
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         246   2e-75   Jatropha curcas
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    246   2e-75   Nelumbo nucifera [Indian lotus]
emb|CAN62302.1|  hypothetical protein VITISV_023686                     246   3e-75   Vitis vinifera
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    245   3e-75   Glycine max [soybeans]
ref|NP_001237567.1|  alanine aminotransferase 2                         244   8e-75   
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    243   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    243   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|AET06145.1|  PLP-dependent aminotransferase                          242   6e-74   Papaver somniferum
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                242   6e-74   Glycine soja [wild soybean]
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    242   7e-74   Fragaria vesca subsp. vesca
gb|AAZ43368.1|  AlaT1                                                   241   1e-73   Vitis labrusca [Concord grape]
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             240   3e-73   Phaseolus vulgaris [French bean]
ref|NP_001237581.1|  alanine aminotransferase 3                         240   3e-73   Glycine max [soybeans]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    240   4e-73   Populus trichocarpa [western balsam poplar]
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    240   5e-73   
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          240   5e-73   Amborella trichopoda
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    238   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    238   4e-72   Tarenaya hassleriana [spider flower]
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    237   4e-72   Elaeis guineensis
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    237   4e-72   
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    237   4e-72   Elaeis guineensis
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    237   5e-72   Brassica rapa
emb|CDY61225.1|  BnaC06g43710D                                          237   5e-72   Brassica napus [oilseed rape]
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    238   7e-72   Brassica rapa
gb|AAM22749.1|  alanine aminotransferase                                225   2e-71   Deschampsia antarctica
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    236   2e-71   Gossypium arboreum [tree cotton]
gb|KJB31170.1|  hypothetical protein B456_005G179600                    235   4e-71   Gossypium raimondii
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             234   5e-71   Populus trichocarpa [western balsam poplar]
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    234   6e-71   
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    234   7e-71   Populus euphratica
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          234   7e-71   
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    234   8e-71   
gb|KJB31175.1|  hypothetical protein B456_005G179600                    234   9e-71   Gossypium raimondii
dbj|BAJ90574.1|  predicted protein                                      228   9e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             234   1e-70   
emb|CDX91708.1|  BnaC08g06270D                                          231   1e-70   
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    233   2e-70   Brassica rapa
emb|CDY66294.1|  BnaAnng22050D                                          233   2e-70   Brassica napus [oilseed rape]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              232   5e-70   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20108.1|  AT1G70580                                              232   5e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61453.1|  putative alanine aminotransferase                       232   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             232   6e-70   Capsella rubella
gb|EPS68501.1|  hypothetical protein M569_06265                         231   8e-70   Genlisea aurea
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             231   1e-69   
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    231   1e-69   Brassica rapa
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             231   1e-69   
emb|CDY25780.1|  BnaA07g10020D                                          228   2e-69   Brassica napus [oilseed rape]
emb|CDY41452.1|  BnaA08g20540D                                          230   3e-69   Brassica napus [oilseed rape]
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    226   3e-69   
gb|EMS58349.1|  Alanine aminotransferase 2                              229   6e-69   Triticum urartu
gb|AAK68842.1|  alanine aminotransferase-like protein                   225   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    228   2e-68   Camelina sativa [gold-of-pleasure]
emb|CDY12474.1|  BnaC07g13140D                                          229   2e-68   Brassica napus [oilseed rape]
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    227   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    227   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    227   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010248614.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    223   4e-68   
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    227   4e-68   Camelina sativa [gold-of-pleasure]
ref|NP_001058716.1|  Os07g0108300                                       227   5e-68   
gb|AAO84040.1|  alanine aminotransferase                                226   6e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    226   9e-68   Setaria italica
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    226   9e-68   Camelina sativa [gold-of-pleasure]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 226   1e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24255.1|  At1g23310/F26F24_4                                      226   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    225   3e-67   Brassica rapa
tpg|DAA59363.1|  TPA: putative MATE efflux family protein isoform 1     222   6e-67   
ref|XP_009151206.1|  PREDICTED: glutamate--glyoxylate aminotransf...    214   7e-67   
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    223   9e-67   Brachypodium distachyon [annual false brome]
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       223   1e-66   Cucumis sativus [cucumbers]
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          223   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    222   3e-66   Solanum lycopersicum
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    222   3e-66   
ref|NP_001151209.1|  alanine aminotransferase 2                         222   4e-66   
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             221   9e-66   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    220   1e-65   
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    220   1e-65   Cucumis sativus [cucumbers]
ref|NP_001183048.1|  uncharacterized protein LOC100501386               220   1e-65   Zea mays [maize]
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    219   4e-65   
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    219   4e-65   Nicotiana sylvestris
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    219   5e-65   Cucumis melo [Oriental melon]
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    218   6e-65   Nicotiana tomentosiformis
gb|ABK25444.1|  unknown                                                 208   6e-61   Picea sitchensis
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              206   5e-60   
ref|XP_011034252.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    202   1e-59   Populus euphratica
ref|XP_010230121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    195   2e-59   
gb|AFK42206.1|  unknown                                                 198   6e-59   Lotus japonicus
ref|XP_001763950.1|  predicted protein                                  197   7e-57   
ref|XP_001782822.1|  predicted protein                                  188   4e-53   
ref|XP_001777071.1|  predicted protein                                  184   6e-52   
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             175   2e-48   Selaginella moellendorffii
ref|XP_005651940.1|  alanine aminotransferase                           173   2e-47   Coccomyxa subellipsoidea C-169
ref|XP_003613140.1|  Alanine aminotransferase                           168   1e-45   
emb|CDX91589.1|  BnaC02g15710D                                          155   2e-44   
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    164   2e-44   
ref|XP_002947519.1|  alanine aminotransferase                           164   3e-44   Volvox carteri f. nagariensis
gb|KIZ07569.1|  alanine transaminase                                    161   1e-42   Monoraphidium neglectum
gb|EMT29455.1|  Alanine aminotransferase 2                              158   9e-42   
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              155   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003291733.1|  alanine transaminase                               154   2e-40   Dictyostelium purpureum
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               154   3e-40   Nannochloropsis gaditana
gb|AFK38994.1|  unknown                                                 144   5e-40   Lotus japonicus
gb|AFK36743.1|  unknown                                                 145   7e-40   Lotus japonicus
ref|XP_001698518.1|  alanine aminotransferase                           152   8e-40   Chlamydomonas reinhardtii
gb|AAB01685.1|  alanine aminotransferase                                150   5e-39   Chlamydomonas reinhardtii
gb|EEE58449.1|  hypothetical protein OsJ_09677                          145   8e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         147   3e-38   
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    147   4e-38   Auxenochlorella protothecoides
ref|NP_001060284.1|  Os07g0617800                                       143   2e-37   
gb|KIY92376.1|  hypothetical protein MNEG_15586                         138   2e-37   Monoraphidium neglectum
ref|NP_001064504.1|  Os10g0390500                                       145   3e-37   
tpg|DAA41461.1|  TPA: hypothetical protein ZEAMMB73_764403              142   3e-37   
gb|AAK52114.1|AC079936_10  Putative alanine aminotransferase            145   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         145   3e-37   Oryza brachyantha
gb|ETK83815.1|  hypothetical protein L915_11053                         139   5e-37   Phytophthora parasitica
ref|XP_006657961.1|  PREDICTED: alanine aminotransferase 2-like i...    144   6e-37   Oryza brachyantha
tpg|DAA63613.1|  TPA: hypothetical protein ZEAMMB73_743428              141   7e-37   
gb|EEC74641.1|  hypothetical protein OsI_10280                          144   8e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    144   9e-37   Oryza brachyantha
gb|ETL90369.1|  hypothetical protein L917_10859                         137   1e-36   Phytophthora parasitica
dbj|BAC79866.1|  putative alanine aminotransferase                      143   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEE67593.1|  hypothetical protein OsJ_25140                          143   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          143   2e-36   Oryza sativa Indica Group [Indian rice]
emb|CDJ93113.1|  Aminotransferase domain containing protein             142   2e-36   Haemonchus contortus [red stomach worm]
gb|ETL37230.1|  hypothetical protein L916_10951                         136   3e-36   Phytophthora parasitica
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          142   3e-36   Sorghum bicolor [broomcorn]
gb|AAV64199.1|  putative alanine aminotransferase                       142   5e-36   Zea mays [maize]
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              142   6e-36   Zea mays [maize]
gb|AAV64237.1|  putative alanine aminotransferase                       141   7e-36   Zea mays [maize]
gb|EFA80185.1|  alanine transaminase                                    141   1e-35   Heterostelium album PN500
gb|KHN77825.1|  Alanine aminotransferase 1                              140   1e-35   Toxocara canis
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              140   2e-35   Fragaria vesca subsp. vesca
gb|KDD76740.1|  aminotransferase                                        139   2e-35   Helicosporidium sp. ATCC 50920
ref|XP_637993.1|  alanine transaminase                                  140   3e-35   Dictyostelium discoideum AX4
emb|CEF68484.1|  Alanine aminotransferase 1                             139   3e-35   Strongyloides ratti
gb|ETP13560.1|  hypothetical protein F441_11279                         139   3e-35   Phytophthora parasitica CJ01A1
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...    139   3e-35   Acanthamoeba castellanii str. Neff
gb|ETP41623.1|  hypothetical protein F442_11247                         139   3e-35   Phytophthora parasitica P10297
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    139   3e-35   Phytophthora parasitica INRA-310
gb|EYC32542.1|  hypothetical protein Y032_0003g1641                     139   4e-35   Ancylostoma ceylanicum
gb|EYC32543.1|  hypothetical protein Y032_0003g1641                     139   5e-35   Ancylostoma ceylanicum
ref|XP_002887430.1|  ALAAT2                                             139   6e-35   
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350               138   8e-35   Acytostelium subglobosum LB1
gb|KIY93453.1|  alanine transaminase                                    130   9e-35   Monoraphidium neglectum
ref|XP_002430266.1|  Alanine aminotransferase, putative                 137   1e-34   Pediculus humanus corporis [human body lice]
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              137   1e-34   Phoenix dactylifera
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         137   1e-34   Phoenix dactylifera
emb|CDJ93112.1|  Aminotransferase domain containing protein             137   2e-34   Haemonchus contortus [red stomach worm]
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    137   2e-34   Hordeum vulgare [barley]
ref|XP_002906656.1|  alanine aminotransferase 2                         137   2e-34   Phytophthora infestans T30-4
gb|ETI43749.1|  hypothetical protein F443_11362                         137   2e-34   Phytophthora parasitica P1569
gb|EHJ76295.1|  putative alanine aminotransferase                       137   2e-34   
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              137   2e-34   Elaeis guineensis
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              137   2e-34   Brachypodium distachyon [annual false brome]
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    137   3e-34   Hordeum vulgare [barley]
ref|XP_003055208.1|  predicted protein                                  136   3e-34   Micromonas pusilla CCMP1545
gb|ADB91976.1|  alanine aminotransferase                                136   3e-34   Branchiostoma belcheri
gb|ENN78579.1|  hypothetical protein YQE_04947                          136   4e-34   Dendroctonus ponderosae
ref|XP_005775483.1|  alanine aminotransferase                           136   5e-34   Emiliania huxleyi CCMP1516
dbj|BAN21041.1|  alanine aminotransferase                               136   5e-34   Riptortus pedestris
gb|KFK41472.1|  hypothetical protein AALP_AA2G135300                    136   5e-34   Arabis alpina [alpine rockcress]
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         135   7e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939850.1|  PREDICTED: alanine aminotransferase 2 isofor...    133   7e-34   
ref|XP_008620886.1|  alanine transaminase                               135   8e-34   Saprolegnia diclina VS20
ref|XP_003724792.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    135   9e-34   
ref|XP_002499950.1|  alanine aminotransferase                           135   9e-34   Micromonas commoda
ref|XP_007024768.1|  Alanine aminotransferase 2                         135   1e-33   
gb|EMT23015.1|  Alanine aminotransferase 2                              135   1e-33   
gb|KJB68682.1|  hypothetical protein B456_011G0552001                   132   1e-33   Gossypium raimondii
gb|KJB68683.1|  hypothetical protein B456_011G0552001                   133   1e-33   Gossypium raimondii
gb|EMS46317.1|  Alanine aminotransferase 2                              135   1e-33   Triticum urartu
gb|ERG84738.1|  alanine aminotransferase 2-like protein                 135   1e-33   
ref|XP_010096539.1|  Alanine aminotransferase 2                         134   2e-33   Morus notabilis
ref|XP_005443445.1|  PREDICTED: alanine aminotransferase 2-like         134   2e-33   Falco cherrug
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         134   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               134   2e-33   Glycine soja [wild soybean]
ref|XP_004992298.1|  alanine aminotransferase                           134   2e-33   Salpingoeca rosetta
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             134   2e-33   Prunus persica
ref|NP_001185380.1|  alanine aminotransferase 2                         134   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59591.2|  putative alanine aminotransferase                       134   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565040.2|  alanine aminotransferase 2                            134   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    134   3e-33   Prunus mume [ume]
ref|XP_005230442.1|  PREDICTED: alanine aminotransferase 2-like         134   3e-33   
gb|KHN72520.1|  Alanine aminotransferase 2                              134   3e-33   Toxocara canis
ref|XP_010428116.1|  PREDICTED: alanine aminotransferase 2, mitoc...    134   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    133   3e-33   Elaeis guineensis
ref|XP_008560719.1|  PREDICTED: alanine aminotransferase 1              134   4e-33   Microplitis demolitor
gb|KGB32667.1|  Alanine aminotransferase 2                              133   4e-33   Schistosoma haematobium
gb|EHJ78976.1|  putative Alanine aminotransferase                       133   4e-33   
ref|XP_002166762.2|  PREDICTED: alanine aminotransferase 2-like         133   4e-33   
gb|KFM79416.1|  Alanine aminotransferase 2                              131   4e-33   Stegodyphus mimosarum
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    133   4e-33   Cicer arietinum [garbanzo]
gb|AHJ25706.1|  GPT2                                                    129   4e-33   Panthera tigris altaica
ref|XP_002681562.1|  alanine aminotransferase                           133   5e-33   Naegleria gruberi strain NEG-M
emb|CCD81366.1|  putative alanine aminotransferase                      133   5e-33   Schistosoma mansoni
gb|AIT69935.1|  alanine transaminase                                    133   5e-33   Dumontia simplex
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    133   5e-33   Cucumis melo [Oriental melon]
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...    133   5e-33   Gossypium arboreum [tree cotton]
gb|KFB49063.1|  AGAP000901-PA-like protein                              133   5e-33   Anopheles sinensis
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like         133   5e-33   
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    133   5e-33   Elaeis guineensis
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g             133   6e-33   Phaseolus vulgaris [French bean]
gb|KDO24164.1|  hypothetical protein SPRG_10592                         133   6e-33   Saprolegnia parasitica CBS 223.65
ref|XP_010235387.1|  PREDICTED: alanine aminotransferase 2-like i...    133   6e-33   Brachypodium distachyon [annual false brome]
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         133   6e-33   
gb|ADE77246.1|  unknown                                                 131   6e-33   Picea sitchensis
gb|ETN63742.1|  alanine aminotransferase                                132   7e-33   Anopheles darlingi [American malaria mosquito]
gb|EHJ74142.1|  putative alanine aminotransferase                       133   7e-33   
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             132   8e-33   Guillardia theta CCMP2712
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    132   9e-33   Cucumis melo [Oriental melon]
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...    132   9e-33   
gb|KGN58474.1|  hypothetical protein Csa_3G646610                       132   9e-33   Cucumis sativus [cucumbers]
ref|XP_004166923.1|  PREDICTED: alanine aminotransferase 2, mitoc...    132   9e-33   
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...    132   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    132   1e-32   Cucumis melo [Oriental melon]
ref|XP_001660470.1|  AAEL009872-PA                                      132   1e-32   
gb|ELK29365.1|  Alanine aminotransferase 2                              131   1e-32   Myotis davidii
gb|AHW58022.1|  alanine aminotransferase 1                              132   1e-32   Sogatella furcifera
ref|XP_001660471.1|  AAEL009875-PA                                      131   1e-32   
ref|XP_010235383.1|  PREDICTED: alanine aminotransferase 2-like i...    132   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_009059448.1|  hypothetical protein LOTGIDRAFT_192553             132   1e-32   Lottia gigantea
gb|KDR12685.1|  Alanine aminotransferase 2                              132   1e-32   Zootermopsis nevadensis
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like         132   1e-32   Anolis carolinensis [Carolina anole]
ref|XP_001660472.1|  AAEL009875-PB                                      131   2e-32   
ref|XP_002826439.1|  PREDICTED: alanine aminotransferase 2              127   2e-32   
emb|CDQ55985.1|  unnamed protein product                                126   2e-32   Oncorhynchus mykiss
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...    131   2e-32   Cucumis sativus [cucumbers]
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like         132   2e-32   Populus euphratica
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...    131   2e-32   
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...    131   2e-32   
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...    131   2e-32   
ref|XP_006105500.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    131   2e-32   
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...    131   2e-32   
ref|XP_008569975.1|  PREDICTED: alanine aminotransferase 1              128   2e-32   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg             131   3e-32   Citrus clementina [clementine]
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    131   3e-32   
gb|ETL95505.1|  hypothetical protein L917_06707                         125   3e-32   Phytophthora parasitica
ref|XP_008150574.1|  PREDICTED: alanine aminotransferase 2 isofor...    131   3e-32   
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    131   3e-32   Solanum lycopersicum
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             131   3e-32   
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...    131   3e-32   Citrus sinensis [apfelsine]
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                   131   3e-32   Citrus sinensis [apfelsine]
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like         131   3e-32   Anolis carolinensis [Carolina anole]
ref|XP_009826737.1|  hypothetical protein H257_04062                    131   3e-32   Aphanomyces astaci
ref|XP_005880402.1|  PREDICTED: alanine aminotransferase 2              131   3e-32   
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316              131   3e-32   
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640              130   3e-32   
gb|EXX69945.1|  alanine transaminase ALT1                               131   3e-32   Rhizophagus irregularis DAOM 197198w
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                  130   4e-32   
ref|XP_008150573.1|  PREDICTED: alanine aminotransferase 2 isofor...    130   4e-32   Eptesicus fuscus
emb|CDQ05042.1|  Protein Bm9838, isoform b                              123   4e-32   
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    130   4e-32   Solanum tuberosum [potatoes]
gb|KDE04574.1|  hypothetical protein MVLG_05042                         131   4e-32   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         130   5e-32   Sesamum indicum [beniseed]
ref|XP_010471259.1|  PREDICTED: alanine aminotransferase 2, mitoc...    130   5e-32   Camelina sativa [gold-of-pleasure]
gb|AIT69944.1|  alanine transaminase                                    130   5e-32   Gracilaria vermiculophylla
ref|NP_001086104.1|  alanine aminotransferase 2                         130   5e-32   Xenopus laevis [clawed frog]
ref|NP_001021021.1|  Protein C32F10.8, isoform a                        130   6e-32   
gb|AIT69939.1|  alanine transaminase                                    130   6e-32   
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    130   7e-32   
ref|XP_006034404.1|  PREDICTED: alanine aminotransferase 2              129   7e-32   
gb|KHJ47772.1|  aminotransferase, class I/II                            130   7e-32   
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              130   7e-32   
ref|XP_002158641.1|  PREDICTED: alanine aminotransferase 2-like         129   8e-32   
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1              129   8e-32   
ref|XP_008869166.1|  hypothetical protein H310_06043                    129   9e-32   
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              129   1e-31   
ref|XP_005608301.1|  PREDICTED: alanine aminotransferase 2 isofor...    129   1e-31   
emb|CCI42079.1|  unnamed protein product                                129   1e-31   
ref|XP_008507870.1|  PREDICTED: alanine aminotransferase 2 isofor...    129   1e-31   
ref|XP_005608300.1|  PREDICTED: alanine aminotransferase 2 isofor...    129   1e-31   
ref|XP_002639464.1|  Hypothetical protein CBG04059                      129   1e-31   
ref|XP_006764960.1|  PREDICTED: alanine aminotransferase 2              131   1e-31   
ref|XP_002042929.1|  GM11628                                            130   1e-31   
gb|AAL39959.1|  SD05601p                                                130   1e-31   
ref|NP_572879.2|  CG1640, isoform A                                     130   1e-31   
ref|XP_003627448.1|  Alanine aminotransferase                           129   1e-31   
gb|EFX71233.1|  hypothetical protein DAPPUDRAFT_309150                  129   1e-31   
gb|ACJ85860.1|  unknown                                                 129   1e-31   
ref|XP_002106853.1|  GD17120                                            129   1e-31   
ref|XP_003978704.1|  PREDICTED: alanine aminotransferase 2-like         129   1e-31   
ref|XP_004697404.1|  PREDICTED: alanine aminotransferase 1              129   1e-31   
ref|NP_727696.2|  CG1640, isoform B                                     129   1e-31   
ref|XP_011260421.1|  PREDICTED: alanine aminotransferase 1              129   1e-31   
ref|XP_005608298.1|  PREDICTED: alanine aminotransferase 2 isofor...    129   1e-31   
gb|ETK88933.1|  hypothetical protein L915_06890                         126   1e-31   
ref|XP_010835881.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    128   2e-31   
ref|XP_001490415.3|  PREDICTED: alanine aminotransferase 2 isofor...    129   2e-31   
ref|XP_011372050.1|  PREDICTED: alanine aminotransferase 2              128   2e-31   
ref|XP_009175684.1|  hypothetical protein T265_10908                    129   2e-31   
gb|EFN75006.1|  Alanine aminotransferase 2                              129   2e-31   
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              129   2e-31   
ref|XP_006261713.1|  PREDICTED: alanine aminotransferase 2              128   2e-31   
ref|XP_004265286.1|  PREDICTED: alanine aminotransferase 1              129   2e-31   
gb|EPS60556.1|  hypothetical protein M569_14246                         129   2e-31   
ref|XP_009515714.1|  hypothetical protein PHYSODRAFT_476244             129   2e-31   
ref|XP_006064662.1|  PREDICTED: alanine aminotransferase 1 isofor...    129   2e-31   
gb|AET06148.1|  PLP-dependent aminotransferase                          128   2e-31   
gb|KFD51767.1|  hypothetical protein M513_07294                         130   2e-31   
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              129   2e-31   
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2              128   2e-31   
ref|XP_005709075.1|  alanine transaminase                               128   2e-31   
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1              128   2e-31   
ref|XP_006530622.1|  PREDICTED: alanine aminotransferase 2 isofor...    125   3e-31   
ref|XP_005688941.1|  PREDICTED: alanine aminotransferase 1              126   3e-31   
gb|KFR15864.1|  Alanine aminotransferase 2                              128   3e-31   
emb|CDS24338.1|  alanine aminotransferase 2                             129   3e-31   
ref|XP_004443056.1|  PREDICTED: alanine aminotransferase 1              128   3e-31   
ref|XP_006908800.1|  PREDICTED: alanine aminotransferase 2              127   3e-31   
ref|NP_001077209.1|  alanine aminotransferase 1                         128   3e-31   
ref|XP_005215289.1|  PREDICTED: alanine aminotransferase 1 isofor...    128   3e-31   
ref|XP_003998055.1|  PREDICTED: alanine aminotransferase 2              128   3e-31   
ref|XP_010015482.1|  PREDICTED: alanine aminotransferase 2              127   3e-31   
ref|XP_008246599.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    128   3e-31   
ref|XP_007096772.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    128   3e-31   
ref|XP_009939421.1|  PREDICTED: alanine aminotransferase 2              127   3e-31   
ref|XP_004023140.1|  PREDICTED: alanine aminotransferase 1              127   4e-31   
ref|XP_009557985.1|  PREDICTED: alanine aminotransferase 2-like         127   4e-31   
gb|KFQ52041.1|  Alanine aminotransferase 2                              127   4e-31   
ref|XP_004580835.1|  PREDICTED: alanine aminotransferase 1              128   4e-31   
ref|XP_008053205.1|  PREDICTED: alanine aminotransferase 2              127   4e-31   
ref|XP_006729760.1|  PREDICTED: alanine aminotransferase 2 isofor...    128   4e-31   
gb|ETL42327.1|  hypothetical protein L916_06840                         123   4e-31   
ref|XP_006746371.1|  PREDICTED: alanine aminotransferase 1              125   4e-31   
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1              127   4e-31   
gb|KFO75258.1|  Alanine aminotransferase 2                              127   4e-31   
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1              127   4e-31   
ref|XP_003111097.1|  hypothetical protein CRE_03967                     127   4e-31   
ref|XP_316880.5|  AGAP000901-PA                                         128   4e-31   
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg             128   4e-31   
ref|XP_002112002.1|  hypothetical protein TRIADDRAFT_50189              127   4e-31   
ref|XP_010394851.1|  PREDICTED: alanine aminotransferase 2              127   4e-31   
ref|XP_004664888.1|  PREDICTED: alanine aminotransferase 2              127   5e-31   
gb|EGT35396.1|  hypothetical protein CAEBREN_11946                      127   5e-31   
gb|EGT33395.1|  hypothetical protein CAEBREN_19959                      127   5e-31   
gb|KFP35282.1|  Alanine aminotransferase 2                              127   5e-31   
ref|XP_008584771.1|  PREDICTED: alanine aminotransferase 2              127   5e-31   
ref|XP_010113991.1|  PREDICTED: alanine aminotransferase 2              127   5e-31   
ref|XP_007464592.1|  PREDICTED: alanine aminotransferase 1              127   5e-31   
ref|XP_009051124.1|  hypothetical protein LOTGIDRAFT_114341             127   5e-31   
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   5e-31   
ref|XP_005426315.1|  PREDICTED: alanine aminotransferase 2              127   5e-31   
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   5e-31   
gb|AIT69941.1|  alanine transaminase                                    127   6e-31   
ref|XP_006828623.1|  hypothetical protein AMTR_s00129p00080070          127   6e-31   
ref|XP_005490144.1|  PREDICTED: alanine aminotransferase 2              127   6e-31   
gb|ELK15350.1|  Alanine aminotransferase 2                              127   6e-31   
emb|CDQ98213.1|  unnamed protein product                                121   6e-31   
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   6e-31   
emb|CDS30789.1|  gag pol polyprotein                                    127   6e-31   
ref|XP_009079156.1|  PREDICTED: alanine aminotransferase 2              125   6e-31   
ref|XP_011226825.1|  PREDICTED: alanine aminotransferase 1 isofor...    127   6e-31   
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   7e-31   
ref|XP_011373236.1|  PREDICTED: alanine aminotransferase 1              127   7e-31   
gb|AIT69934.1|  alanine transaminase                                    127   7e-31   
gb|KFU99477.1|  Alanine aminotransferase 2                              127   7e-31   
gb|KFQ20610.1|  Alanine aminotransferase 2                              127   7e-31   
ref|XP_006064660.1|  PREDICTED: alanine aminotransferase 1 isofor...    128   7e-31   
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   7e-31   
ref|XP_009976045.1|  PREDICTED: alanine aminotransferase 2              127   7e-31   
ref|XP_008700888.1|  PREDICTED: alanine aminotransferase 2              127   7e-31   
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    127   7e-31   
ref|XP_005318527.1|  PREDICTED: alanine aminotransferase 2              127   7e-31   
ref|XP_002760962.1|  PREDICTED: alanine aminotransferase 2              127   8e-31   
ref|XP_010193171.1|  PREDICTED: alanine aminotransferase 2              126   8e-31   
ref|XP_007474882.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   8e-31   
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2              127   8e-31   
ref|XP_011235435.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    127   8e-31   
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like         127   8e-31   
ref|XP_007537772.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   8e-31   
ref|XP_009274977.1|  PREDICTED: alanine aminotransferase 2              126   8e-31   
ref|XP_009899311.1|  PREDICTED: alanine aminotransferase 1              126   8e-31   
ref|XP_002100462.1|  GE17071                                            127   8e-31   
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2              127   8e-31   
dbj|GAA29952.1|  alanine transaminase                                   127   8e-31   
gb|KFO63157.1|  Alanine aminotransferase 2                              127   8e-31   
ref|XP_005895414.1|  PREDICTED: alanine aminotransferase 2              127   8e-31   
ref|XP_010078751.1|  PREDICTED: alanine aminotransferase 2              125   9e-31   
ref|XP_004472119.1|  PREDICTED: alanine aminotransferase 1              127   9e-31   
gb|KFV00293.1|  Alanine aminotransferase 2                              125   9e-31   
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   9e-31   
ref|XP_007450446.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   9e-31   
gb|KFV67752.1|  Alanine aminotransferase 2                              126   9e-31   
dbj|BAC04465.1|  unnamed protein product                                126   9e-31   
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2              127   9e-31   
ref|NP_001135938.1|  alanine aminotransferase 2 isoform 2               126   1e-30   
emb|CDI98892.1|  alanine aminotransferase 2                             127   1e-30   
ref|XP_004744170.1|  PREDICTED: alanine aminotransferase 2 isofor...    127   1e-30   
ref|XP_004403733.1|  PREDICTED: alanine aminotransferase 2              127   1e-30   
ref|XP_004779455.1|  PREDICTED: alanine aminotransferase 1 isofor...    126   1e-30   
ref|XP_006191406.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
pdb|3IHJ|A  Chain A, Human Alanine Aminotransferase 2 In Complex ...    126   1e-30   
ref|XP_007450447.1|  PREDICTED: alanine aminotransferase 2 isofor...    126   1e-30   
gb|KFZ65228.1|  Alanine aminotransferase 2                              126   1e-30   
gb|KFQ05762.1|  Alanine aminotransferase 2                              126   1e-30   
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         127   1e-30   
ref|XP_005959811.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    127   1e-30   
gb|KFQ54613.1|  Alanine aminotransferase 2                              126   1e-30   
ref|XP_009700544.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
ref|XP_010151513.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
ref|XP_010884988.1|  PREDICTED: alanine aminotransferase 2-like i...    126   1e-30   
ref|XP_004826063.1|  PREDICTED: alanine aminotransferase 1 isofor...    126   1e-30   
ref|XP_009816631.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
gb|KFZ58051.1|  Alanine aminotransferase 2                              126   1e-30   
gb|EFA11840.1|  hypothetical protein TcasGA2_TC004262                   119   1e-30   
ref|XP_005613478.1|  PREDICTED: alanine aminotransferase 1              126   1e-30   
ref|XP_010285870.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
ref|XP_010166043.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
gb|KFQ69505.1|  Alanine aminotransferase 2                              126   1e-30   
ref|XP_006530621.1|  PREDICTED: alanine aminotransferase 2 isofor...    125   1e-30   
ref|XP_011226824.1|  PREDICTED: alanine aminotransferase 1 isofor...    127   1e-30   
gb|AFK39904.1|  unknown                                                 126   1e-30   
ref|XP_009487594.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
gb|KFP59082.1|  Alanine aminotransferase 2                              126   1e-30   
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2              127   1e-30   
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...    126   1e-30   
ref|XP_004779454.1|  PREDICTED: alanine aminotransferase 1 isofor...    126   1e-30   
ref|XP_009571057.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
gb|KHJ79030.1|  hypothetical protein OESDEN_21333                       120   1e-30   
gb|KFW64540.1|  Alanine aminotransferase 2                              127   1e-30   
ref|XP_006887880.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
ref|NP_001012057.1|  alanine aminotransferase 2                         126   1e-30   
ref|XP_004944250.1|  PREDICTED: alanine aminotransferase 2 isofor...    126   1e-30   
gb|KFM05788.1|  Alanine aminotransferase 2                              126   1e-30   
gb|KFV58998.1|  Alanine aminotransferase 2                              126   1e-30   
ref|XP_005838227.1|  hypothetical protein GUITHDRAFT_103164             126   1e-30   
ref|XP_005233896.1|  PREDICTED: alanine aminotransferase 2              125   1e-30   
ref|NP_597700.1|  alanine aminotransferase 2 isoform 1                  126   1e-30   
ref|XP_004400797.1|  PREDICTED: alanine aminotransferase 1              126   1e-30   
ref|XP_009920931.1|  PREDICTED: alanine aminotransferase 2              125   1e-30   
gb|EHH31638.1|  Alanine aminotransferase 2                              126   1e-30   
ref|XP_011499275.1|  PREDICTED: alanine aminotransferase 2              126   1e-30   
gb|KFP94695.1|  Alanine aminotransferase 2                              126   1e-30   
ref|XP_004362319.1|  alanine transaminase                               126   1e-30   
ref|XP_005591897.1|  PREDICTED: alanine aminotransferase 2 isofor...    126   1e-30   
ref|XP_004479736.1|  PREDICTED: alanine aminotransferase 2 isoform 2    126   2e-30   
gb|KFO93213.1|  Alanine aminotransferase 2                              125   2e-30   
ref|XP_010884980.1|  PREDICTED: alanine aminotransferase 2-like i...    126   2e-30   
ref|XP_005141728.1|  PREDICTED: alanine aminotransferase 2              126   2e-30   
gb|EMP35918.1|  Alanine aminotransferase 2                              126   2e-30   
ref|XP_010140032.1|  PREDICTED: alanine aminotransferase 2              125   2e-30   
ref|XP_004629253.1|  PREDICTED: alanine aminotransferase 2              126   2e-30   
ref|XP_010776891.1|  PREDICTED: alanine aminotransferase 2-like         125   2e-30   
ref|XP_006830849.1|  PREDICTED: alanine aminotransferase 1              126   2e-30   
ref|XP_008524431.1|  PREDICTED: alanine aminotransferase 1              126   2e-30   
ref|XP_006170526.1|  PREDICTED: alanine aminotransferase 2              126   2e-30   
ref|XP_003463744.1|  PREDICTED: alanine aminotransferase 1 isofor...    126   2e-30   
ref|XP_003127043.1|  PREDICTED: alanine aminotransferase 2 isofor...    126   2e-30   
ref|XP_004479735.1|  PREDICTED: alanine aminotransferase 2 isoform 1    126   2e-30   
gb|KFO06425.1|  Alanine aminotransferase 2                              125   2e-30   
ref|XP_003280453.1|  PREDICTED: alanine aminotransferase 2              126   2e-30   
ref|XP_008827853.1|  PREDICTED: alanine aminotransferase 2 isofor...    125   2e-30   
ref|XP_010309159.1|  PREDICTED: alanine aminotransferase 2              125   2e-30   
gb|EHH60359.1|  Alanine aminotransferase 2                              125   2e-30   
gb|ELV09912.1|  Alanine aminotransferase 2                              125   2e-30   
gb|KFP49490.1|  Alanine aminotransferase 2                              125   2e-30   
gb|KFQ82063.1|  Alanine aminotransferase 2                              125   2e-30   
ref|XP_006207932.1|  PREDICTED: alanine aminotransferase 2              126   2e-30   
ref|XP_005662864.1|  PREDICTED: alanine aminotransferase 1 isofor...    125   2e-30   
gb|KFQ95766.1|  Alanine aminotransferase 2                              126   2e-30   
ref|XP_005591896.1|  PREDICTED: alanine aminotransferase 2 isofor...    126   2e-30   
ref|XP_001745052.1|  hypothetical protein                               125   2e-30   
ref|XP_010716082.1|  PREDICTED: alanine aminotransferase 2              125   2e-30   
gb|ETI43741.1|  hypothetical protein F443_11357                         125   2e-30   
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg                125   2e-30   
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2              126   2e-30   
ref|XP_005662863.1|  PREDICTED: alanine aminotransferase 1 isofor...    125   2e-30   
ref|XP_009676627.1|  PREDICTED: alanine aminotransferase 2              125   2e-30   
ref|XP_008936281.1|  PREDICTED: alanine aminotransferase 2              125   2e-30   
gb|KFV83100.1|  Alanine aminotransferase 2                              125   2e-30   
gb|KFQ16813.1|  Alanine aminotransferase 2                              125   2e-30   
gb|KFP31561.1|  Alanine aminotransferase 2                              125   2e-30   
ref|XP_010346117.1|  PREDICTED: alanine aminotransferase 2              126   2e-30   
gb|AIT69936.1|  alanine transaminase                                    125   2e-30   
ref|XP_003416391.1|  PREDICTED: alanine aminotransferase 2              125   2e-30   
ref|XP_006186085.1|  PREDICTED: alanine aminotransferase 1              125   2e-30   
ref|XP_005401471.1|  PREDICTED: alanine aminotransferase 2-like i...    125   2e-30   
ref|XP_003222977.1|  PREDICTED: alanine aminotransferase 2              126   2e-30   



>ref|XP_008467047.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Cucumis melo]
Length=238

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AIE A+ LGK 
Sbjct  109  FIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIEAAKKLGKV  168

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++
Sbjct  169  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKFNDSFMEE  228

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  229  YEDHRGYSRM  238



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+ LGK 
Sbjct  352  YVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKKLGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+Q
Sbjct  412  PDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIETA  LGKA
Sbjct  352  YVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIETANKLGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM++
Sbjct  412  PDVLYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEK  471

Query  212  YEDHRGYSRM  183
            YEDH+GYSRM
Sbjct  472  YEDHKGYSRM  481



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+ LGK 
Sbjct  352  YVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKLGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+Q
Sbjct  412  PDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE AQ  GK 
Sbjct  352  FIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAQRAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFMDQ
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMDQ  471

Query  212  YEDHRGYSRM  183
            YED RGYSRM
Sbjct  472  YEDQRGYSRM  481



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK 
Sbjct  352  FIRESKGILESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFMDQ
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMDQ  471

Query  212  YEDHRGYSRM  183
            YED RGYSRM
Sbjct  472  YEDRRGYSRM  481



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  LGKA
Sbjct  352  YVRESKGILESLRRRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETANKLGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM++
Sbjct  412  ADVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEK  471

Query  212  YEDHRGYSRM  183
            YEDH+GYSRM
Sbjct  472  YEDHKGYSRM  481



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  YVRESKGILESLRRRASIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGMFHLRTTILPAEEDMPAIMESFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLRKRARIMTDGFN+CRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK 
Sbjct  352  FVRESKGILESLRKRARIMTDGFNNCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   249 bits (637),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L++R SKGI+ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ A+  GK
Sbjct  351  LYVRESKGIIESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQAAKQAGK  410

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM+
Sbjct  411  VPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKFNDEFME  470

Query  215  QYEDHRGYSRM  183
            QYEDHRGYSRM
Sbjct  471  QYEDHRGYSRM  481



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE AQ  GK 
Sbjct  352  FIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAQRAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFN+EFMDQ
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNNEFMDQ  471

Query  212  YEDHRGYSRM  183
            YED RGYSRM
Sbjct  472  YEDQRGYSRM  481



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  334  FVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKV  393

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCL+LLEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKFNDEFM+Q
Sbjct  394  PDVFYCLRLLEATGISTVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQ  453

Query  212  YEDHRGYSRM  183
            YED+RGYSRM
Sbjct  454  YEDYRGYSRM  463



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  FMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  FVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+Q
Sbjct  412  PDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED+RGYSRM
Sbjct  472  YEDYRGYSRM  481



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA++MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE AQ  GK 
Sbjct  351  FIRESKGILESLRRRAQLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAQKAGKV  410

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+Q
Sbjct  411  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQ  470

Query  212  YEDHRGYSRM  183
            YEDH+GYSRM
Sbjct  471  YEDHKGYSRM  480



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFN+CRN+VCNFTEGAMYSFPQIRLPPRAIE A+  GK 
Sbjct  352  FVRESKGILESLRRRARIMTDGFNNCRNIVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  349  YVRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKV  408

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+Q
Sbjct  409  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQ  468

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  469  YEDHRGYSRM  478



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SK +LESLRKRA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  YVRESKAVLESLRKRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDH+GYSRM
Sbjct  472  YEDHKGYSRM  481



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  FMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIMESFKKFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMESFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+ LGK 
Sbjct  331  FIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKKLGKV  390

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++
Sbjct  391  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKFNDSFMEE  450

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  451  YEDHRGYSRM  460



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +LR SKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A+ETA+  GKA
Sbjct  352  YLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALETAKQAGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKFND+FM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKFNDDFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSR+
Sbjct  472  YEDHRGYSRL  481



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+ LGK 
Sbjct  352  FIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKKLGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKFNDSFMEE  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A+ETA+  GKA
Sbjct  352  FVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKALETAKQAGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKFND+FM+Q
Sbjct  412  ADVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKFNDDFMEQ  471

Query  212  YEDHRGYSRM  183
            Y+DHRGYSR+
Sbjct  472  YDDHRGYSRL  481



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R  KGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+ LGK 
Sbjct  352  FVREGKGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRLGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMSSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDH GYSRM
Sbjct  472  YEDHTGYSRM  481



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++  SK IL+SLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK 
Sbjct  352  FVTESKAILDSLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKNAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  FMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE MPAIMESFKKFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEXMPAIMESFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R S GILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E A+  GK 
Sbjct  352  FVRESTGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKFNDEFM+Q
Sbjct  412  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED RGYSR+
Sbjct  472  YEDDRGYSRL  481



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R S GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E A+  GK 
Sbjct  352  FVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKFNDEFM+Q
Sbjct  412  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED RGYSR+
Sbjct  472  YEDDRGYSRL  481



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + + SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE A+  GK 
Sbjct  352  YEQESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIEDAKKAGKH  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFH+RTTILPAEEDMPAIM+SFKKFND FM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHMRTTILPAEEDMPAIMDSFKKFNDAFMEQ  471

Query  212  YEDHRGYSRM  183
            YEDHRGYSRM
Sbjct  472  YEDHRGYSRM  481



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++  S  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GKA
Sbjct  352  FVAESTAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKSAGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED+RGYSRM
Sbjct  472  YEDYRGYSRM  481



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +++ SK ILESLRKRA IMT+GFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  351  FVQESKTILESLRKRAHIMTNGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEVAKMAGKV  410

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFND FM+Q
Sbjct  411  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDAFMEQ  470

Query  212  YEDHRGYSRM  183
            YED RGYSRM
Sbjct  471  YEDQRGYSRM  480



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R S GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E A+  GK 
Sbjct  352  FVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED+RGYSR+
Sbjct  472  YEDNRGYSRL  481



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ A+  GK 
Sbjct  352  FARESKEILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQAAKSAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQK+GVFHLRTTILPAEEDMPAIM+SFKKFN+EFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKDGVFHLRTTILPAEEDMPAIMDSFKKFNNEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED RGYSRM
Sbjct  472  YEDDRGYSRM  481



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  FMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQ  471

Query  212  YEDHRG  195
            YEDHRG
Sbjct  472  YEDHRG  477



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R S GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK 
Sbjct  352  FVRESNGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFK FNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKNFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED+RGYSR+
Sbjct  472  YEDNRGYSRL  481



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R S GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E A+   K 
Sbjct  351  FVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEAAKQAAKV  410

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SFKKFNDEFM+Q
Sbjct  411  PDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSFKKFNDEFMEQ  470

Query  212  YEDHRGYSRM  183
            YED+RGYSR+
Sbjct  471  YEDNRGYSRL  480



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+  GK 
Sbjct  352  FIRESKGILESLRRRARMMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKMAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMDSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YE H GYSR+
Sbjct  472  YEGHGGYSRL  481



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+ LGK 
Sbjct  352  FIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKKLGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKFNDSFMEE  471

Query  212  YEDHRGYSRM  183
            YED  GYSRM
Sbjct  472  YEDXWGYSRM  481



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+
Sbjct  356  SKEILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKVPDVF  415

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE+DMP IM SFKKFNDEFM+QYE H
Sbjct  416  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEQDMPEIMASFKKFNDEFMEQYEHH  475

Query  200  RGYSRM  183
            RGYSRM
Sbjct  476  RGYSRM  481



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 3/135 (2%)
 Frame = -3

Query  578  ILWLR---NSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQ  408
            I +LR    S  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+
Sbjct  347  ISYLRFAAESNAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAK  406

Query  407  GLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFND  228
              GKAPDV+YCLKL+EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKFND
Sbjct  407  RAGKAPDVFYCLKLVEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKFND  466

Query  227  EFMDQYEDHRGYSRM  183
            EFM+QYED+RGYSRM
Sbjct  467  EFMEQYEDYRGYSRM  481



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP RAIE A+  GK 
Sbjct  352  FIRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPARAIEAARQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            YED+ GYSRM
Sbjct  472  YEDNFGYSRM  481



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  569  LRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAP  390
            ++ SK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP +AIE A+  GKAP
Sbjct  353  VQESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPLKAIEAARKAGKAP  412

Query  389  DVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
            DV+YCLKLLEATGI+TVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF+KFNDEFM+QY
Sbjct  413  DVFYCLKLLEATGIATVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFRKFNDEFMEQY  472

Query  209  EDHRGYSRM  183
            ED+RGYSRM
Sbjct  473  EDYRGYSRM  481



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +++ SK +LESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GKA
Sbjct  352  FVQESKAVLESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAARKAGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF+KFNDEFM+Q
Sbjct  412  PDVFYCLGLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFRKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YE+ RGYSRM
Sbjct  472  YENCRGYSRM  481



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++  SK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE A+ +GKA
Sbjct  352  FVVESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIEAAKKVGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMASFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED RGYSRM
Sbjct  472  YEDCRGYSRM  481



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y D+ GYSRM
Sbjct  472  YGDNFGYSRM  481



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y D+ GYSRM
Sbjct  472  YGDNFGYSRM  481



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  380  FVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  439

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFNDEFM Q
Sbjct  440  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKFNDEFMSQ  499

Query  212  YEDHRGYSRM  183
            Y D+ GYSRM
Sbjct  500  YGDNFGYSRM  509



>gb|AAM22749.1| alanine aminotransferase [Deschampsia antarctica]
Length=147

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +   SK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++TA+  GKA
Sbjct  21   YATESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDTAKSAGKA  80

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FM+Q
Sbjct  81   PDVFYCLMLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMEQ  140

Query  212  YEDH  201
            Y+D+
Sbjct  141  YQDY  144



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI LPP+AIE A+  GK 
Sbjct  352  YVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIHLPPKAIEAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQ  471

Query  212  YEDHRGYSRM  183
            YED+  +SRM
Sbjct  472  YEDNWNHSRM  481



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE A+  GK 
Sbjct  352  FVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQ  471

Query  212  YEDHRGYSRM  183
            YED+   SRM
Sbjct  472  YEDNWNRSRM  481



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  FIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEAAKKAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFN+EFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKFNNEFMEQ  471

Query  212  YEDHRGYSRM  183
            Y+D  GYSR+
Sbjct  472  YDDRSGYSRL  481



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGIL+SLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP+A+E A+  GK 
Sbjct  352  YVRESKGILDSLRRRAWIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPKAVEAAKKAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED+  +SRM
Sbjct  472  YEDNWSHSRM  481



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE A+  GK 
Sbjct  352  FIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEAAKKAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFN+EFM+Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKFNNEFMEQ  471

Query  212  YEDHRGYSRM  183
            Y+D  GYSR+
Sbjct  472  YDDRSGYSRL  481



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP AI+ A+  GK 
Sbjct  352  FARESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQ  471

Query  212  YEDHRGYSRM  183
            Y+++ GYSRM
Sbjct  472  YDNNVGYSRM  481



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFN CRNVVCNFTEGAMYSFPQIRLP + +E A+  GK 
Sbjct  352  YVRESKGILESLRRRARIMTDGFNCCRNVVCNFTEGAMYSFPQIRLPLKVMEAAKRAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQ  471

Query  212  YEDHRGYSRM  183
            YED+ GYSRM
Sbjct  472  YEDNGGYSRM  481



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE A+  GK 
Sbjct  366  FVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEAAKQAGKV  425

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM Q
Sbjct  426  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQ  485

Query  212  YEDHRGYSRM  183
            YED+   SRM
Sbjct  486  YEDNWNRSRM  495



>dbj|BAJ90574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   228 bits (582),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ A+  GK PDVY
Sbjct  173  SKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDVAKSAGKEPDVY  232

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+DH
Sbjct  233  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMDQYQDH  292



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y D  GYSRM
Sbjct  472  YGDSFGYSRM  481



>emb|CDX91708.1| BnaC08g06270D [Brassica napus]
Length=403

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK 
Sbjct  274  FARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKV  333

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  334  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQ  393

Query  212  YEDHRGYSRM  183
            YE+  GYSRM
Sbjct  394  YENGFGYSRM  403



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GKA
Sbjct  349  FARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKA  408

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  409  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQ  468

Query  212  YEDHRGYSRM  183
            YE+  GYSRM
Sbjct  469  YENGFGYSRM  478



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R S+GILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  352  FVRESEGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFN EFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKFNHEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y D+ GYSRM
Sbjct  472  YGDNFGYSRM  481



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y D+ GYSRM
Sbjct  472  YADNFGYSRM  481



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y D+ GYSRM
Sbjct  472  YADNFGYSRM  481



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y D+ GYSRM
Sbjct  472  YADNFGYSRM  481



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK 
Sbjct  352  FARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQ  471

Query  212  YEDHRGYSRM  183
            Y+++ GYSRM
Sbjct  472  YDNNVGYSRM  481



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++  SKGILESLR+RARIMTDGFNSCRN+VCNFTEGAMYSFPQI+LP RAIE A   GK 
Sbjct  350  FITESKGILESLRRRARIMTDGFNSCRNIVCNFTEGAMYSFPQIQLPARAIEAANRAGKV  409

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFND+FMDQ
Sbjct  410  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKFNDDFMDQ  469

Query  212  YED--HRGYSRM  183
            YE+  H+ YSRM
Sbjct  470  YEEDHHKAYSRM  481



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -3

Query  566  RNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPD  387
            R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PD
Sbjct  351  RESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPD  410

Query  386  VYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  207
            V+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+
Sbjct  411  VFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYD  470

Query  206  DHRGYSRM  183
            ++ GYSRM
Sbjct  471  NNFGYSRM  478



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP A++ A+  GK 
Sbjct  349  FARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPGALQAAKQAGKV  408

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  409  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQ  468

Query  212  YEDHRGYSRM  183
            YE+  GYSRM
Sbjct  469  YENSFGYSRM  478



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMGSFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y D+ GYSRM
Sbjct  472  YGDNFGYSRM  481



>emb|CDY25780.1| BnaA07g10020D [Brassica napus]
Length=403

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK 
Sbjct  274  FTRESKGILESLRRRANIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKV  333

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLE TGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  334  PDVFYCLKLLETTGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQ  393

Query  212  YEDHRGYSRM  183
            Y+++ GYSRM
Sbjct  394  YDNNFGYSRM  403



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK 
Sbjct  349  FARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKV  408

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  409  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQ  468

Query  212  YEDHRGYSRM  183
            Y++  GYSRM
Sbjct  469  YDNGFGYSRM  478



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++  SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQIRLPPRAIE+A+ LGK 
Sbjct  212  YISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPRAIESAKQLGKV  271

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++
Sbjct  272  PDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKFNDAFMEE  331

Query  212  Y  210
            Y
Sbjct  332  Y  332



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ A+  GKAPDVY
Sbjct  356  SKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDVAKSAGKAPDVY  415

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FM+QY+DH
Sbjct  416  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMEQYQDH  475



>gb|AAK68842.1| alanine aminotransferase-like protein [Arabidopsis thaliana]
Length=379

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK 
Sbjct  250  FARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKV  309

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM Q
Sbjct  310  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQ  369

Query  212  YEDHRGYSRM  183
            Y+++ GYS+M
Sbjct  370  YDNNFGYSKM  379



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK 
Sbjct  352  FTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQ  471

Query  212  YEDHRGYSRM  183
            Y++  GYSRM
Sbjct  472  YDNTVGYSRM  481



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+N VCNFTEGAMYSFPQI+LPP A++ A+  GK 
Sbjct  408  FTRESKGILESLRRRAKIMTDGFNSCKNAVCNFTEGAMYSFPQIQLPPGALQAAKQAGKV  467

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  468  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQ  527

Query  212  YEDHRGYSRM  183
            Y+++ GYSRM
Sbjct  528  YDNNFGYSRM  537



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y    GYSRM
Sbjct  472  Y--GVGYSRM  479



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQ  471

Query  212  YEDHRGYSRM  183
            Y    GYSRM
Sbjct  472  Y--GVGYSRM  479



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NV CNFTEGAMYSFPQIRLP  A++ A+  GK 
Sbjct  352  FARESKGILESLRRRAKIMTDGFNSCKNVACNFTEGAMYSFPQIRLPAGALQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQ  471

Query  212  YEDHRGYSRM  183
            Y+++ GYSRM
Sbjct  472  YDNNVGYSRM  481



>ref|XP_010248614.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Nelumbo nucifera]
Length=338

 Score =   223 bits (568),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  557  KGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYY  378
            K I ESL++RA IMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIETA+  GK PDV+Y
Sbjct  214  KFITESLKRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQMRLPPKAIETAKRAGKVPDVFY  273

Query  377  CLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  198
            CLKLLEATGIS VPGSGFGQKE  FHL TTILPAEEDMPAIM SFKKFNDEFM+QY DHR
Sbjct  274  CLKLLEATGISMVPGSGFGQKEEAFHLMTTILPAEEDMPAIMASFKKFNDEFMEQYGDHR  333

Query  197  GYSRM  183
            GYS M
Sbjct  334  GYSWM  338



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK 
Sbjct  352  FARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFND+FM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDDFMTQ  471

Query  212  YEDHRGYSRM  183
            Y+++ GYSRM
Sbjct  472  YDNNFGYSRM  481



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 116/126 (92%), Gaps = 3/126 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ A+  GKA DV+
Sbjct  363  SKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAADVF  422

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+  
Sbjct  423  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD--  480

Query  200  RGYSRM  183
             GYSRM
Sbjct  481  -GYSRM  485



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 116/126 (92%), Gaps = 3/126 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ A+  GKA DV+
Sbjct  362  SKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAADVF  421

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+  
Sbjct  422  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD--  479

Query  200  RGYSRM  183
             GYSRM
Sbjct  480  -GYSRM  484



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK IL+SLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GKAPDV+
Sbjct  356  SKSILDSLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKAPDVF  415

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFK FND FM QYE  
Sbjct  416  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKNFNDSFMAQYE--  473

Query  200  RGYSRM  183
             GYSRM
Sbjct  474  -GYSRM  478



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  352  FVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFND+FM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDDFMSQ  471

Query  212  YEDHRGYSRM  183
            Y    GYSRM
Sbjct  472  Y--GVGYSRM  479



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK 
Sbjct  352  FARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQ  471

Query  212  YEDHRGYSRM  183
            Y+++ GYS+M
Sbjct  472  YDNNFGYSKM  481



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK 
Sbjct  352  FARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQ  471

Query  212  YEDHRGYSRM  183
            Y+++ GYS+M
Sbjct  472  YDNNFGYSKM  481



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI LPP A++ A+  GK 
Sbjct  349  FTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQILLPPGALQAAKQAGKV  408

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEA GISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFND FM Q
Sbjct  409  PDVFYCLKLLEAAGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDAFMTQ  468

Query  212  YEDHRGYSRM  183
            Y+++ GYSRM
Sbjct  469  YDNNFGYSRM  478



>tpg|DAA59363.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA59364.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=399

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK+ DV+
Sbjct  277  SKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAARRAGKSADVF  336

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFKKFND FM+QYE  
Sbjct  337  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKFNDSFMEQYE--  394

Query  200  RGYSRM  183
             GYSR+
Sbjct  395  -GYSRL  399



>ref|XP_009151206.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Brassica 
rapa]
Length=155

 Score =   214 bits (544),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK 
Sbjct  42   FVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKV  101

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  231
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFN
Sbjct  102  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPLIMESFKKFN  155



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 3/126 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK IL+SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP RAI+TA+  GK PDV+
Sbjct  357  SKSILDSLRRRAQIMTDGFNSCQNVVCNFTEGAMYSFPQIRLPKRAIDTAKSAGKEPDVF  416

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FM+QY+D 
Sbjct  417  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMEQYQD-  475

Query  200  RGYSRM  183
              YSR+
Sbjct  476  --YSRL  479



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++  SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAIE A+ LGK 
Sbjct  352  YISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIEAAKQLGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++
Sbjct  412  PDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKFNDAFMEE  471

Query  212  Y  210
            Y
Sbjct  472  Y  472



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 1/127 (1%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AIE A+  GK PDV+
Sbjct  356  SKRILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIEAAKQAGKVPDVF  415

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY D+
Sbjct  416  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYGDN  475

Query  200  R-GYSRM  183
              GYSRM
Sbjct  476  NFGYSRM  482



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAI+ A+ L KA
Sbjct  352  FARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIDAAKKLEKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP+IM SFKKFNDEFM +
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPSIMASFKKFNDEFMAR  471

Query  212  YE  207
            YE
Sbjct  472  YE  473



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 115/129 (89%), Gaps = 3/129 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLP RAI+ A   GKA DV+
Sbjct  366  SKAILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAIDAANRAGKAADVF  425

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMD+Y+ +
Sbjct  426  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMDEYDGY  485

Query  200  RG---YSRM  183
             G   YSRM
Sbjct  486  GGGSSYSRM  494



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK+ DV+
Sbjct  356  SKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAARRAGKSADVF  415

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFKKFND FM+QYE  
Sbjct  416  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKFNDSFMEQYE--  473

Query  200  RGYSRM  183
             GYSR+
Sbjct  474  -GYSRL  478



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RAR+MTDGFNSC+NVV NFTEGAMYSFPQIRLP  A++ A+  GK 
Sbjct  352  FARESKGILESLRRRARLMTDGFNSCKNVVRNFTEGAMYSFPQIRLPTGALQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQ  471

Query  212  YEDHRGYSRM  183
            Y+++ GYS+M
Sbjct  472  YDNNFGYSKM  481



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE A+  GKA DV+
Sbjct  357  SKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEAAKRAGKAADVF  416

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKFND FM+QYE  
Sbjct  417  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKFNDSFMEQYE--  474

Query  200  RGYSRM  183
             GYSRM
Sbjct  475  -GYSRM  479



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGIL+SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIETA+  GK 
Sbjct  352  YHRESKGILDSLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIETAKRAGKE  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MPAIM SFKKFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPAIMASFKKFNDEFMEQ  471

Query  212  Y  210
            Y
Sbjct  472  Y  472



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE A+  GKA DV+
Sbjct  357  SKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEAAKRAGKAADVF  416

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKFND FM+QYE  
Sbjct  417  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKFNDSFMEQYE--  474

Query  200  RGYSRM  183
             GYSRM
Sbjct  475  -GYSRM  479



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP AI+ A+ L KA
Sbjct  355  FARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPGAIDAAKKLEKA  414

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP+IM SFKKFNDEFM Q
Sbjct  415  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPVEEEMPSIMASFKKFNDEFMAQ  474

Query  212  YE  207
            YE
Sbjct  475  YE  476



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA IMT GFNSCRNV+CNFTEGAMYSFPQI+LP  AI+ A+ LGKA
Sbjct  352  FVRESKGILESLRRRAHIMTGGFNSCRNVLCNFTEGAMYSFPQIQLPRGAIDAAKKLGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKFND+FM Q
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKFNDDFMKQ  471

Query  212  YE  207
            YE
Sbjct  472  YE  473



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIETA+  GK 
Sbjct  352  YHRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIETAKRAGKE  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP IM SF+KFNDEFM+Q
Sbjct  412  ADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPGIMASFRKFNDEFMEQ  471

Query  212  Y  210
            Y
Sbjct  472  Y  472



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQI+LP   I+ A+ LGK 
Sbjct  352  FVRESKGILESLRRRAHLMTDGFNSCRNVVCNFTEGAMYSFPQIQLPRGVIDAAKKLGKT  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YC+KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKFND+FM+Q
Sbjct  412  PDVFYCIKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKFNDDFMEQ  471

Query  212  YE  207
            YE
Sbjct  472  YE  473



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++  SK ILESLR+RA +MTDGFN+CRNV+CNFTEGAMYSFPQI+LPP+AI  A+  GKA
Sbjct  352  FVAESKAILESLRRRAHLMTDGFNNCRNVICNFTEGAMYSFPQIKLPPKAIAAAKEAGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLEATG+STVPGSGFGQKEGVFHLRTTILP EE+MP IM  FK FND+FM +
Sbjct  412  PDVFYCLKLLEATGMSTVPGSGFGQKEGVFHLRTTILPPEEEMPEIMNVFKIFNDDFMAK  471

Query  212  YEDHRGYSRM  183
            YE++  +SR+
Sbjct  472  YENY-SWSRL  480



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE A+  GKA DV+
Sbjct  357  SKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEAAKRAGKAADVF  416

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEF  222
            YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKFND F
Sbjct  417  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKFNDSF  469



>ref|XP_011034252.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Populus euphratica]
Length=382

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 3/132 (2%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQI  PP+AI+ A+  GK 
Sbjct  252  FIRESKGILESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIX-PPKAIDAAKRAGKV  310

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEG--VFHLRTTILPAEEDMPAIMESFKKFNDEFM  219
            PDV+YCLKLLEATGISTVP  G        VFHLRTTILPAEEDMP IM+SFKKFNDEFM
Sbjct  311  PDVFYCLKLLEATGISTVPQIGLIVIRSCRVFHLRTTILPAEEDMPEIMDSFKKFNDEFM  370

Query  218  DQYEDHRGYSRM  183
            ++YE H GYSR+
Sbjct  371  ERYEGHGGYSRL  382



>ref|XP_010230121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Brachypodium distachyon]
Length=164

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +   SK IL+SLR+RA+IMTDGFNSC+NVVCNFTEGAMYS+ QI LP RAI+TA+  GK 
Sbjct  44   FATESKSILDSLRRRAQIMTDGFNSCQNVVCNFTEGAMYSYFQICLPKRAIDTAKSAGKE  103

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  231
            PDV+YCLKLLEAT ISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFN
Sbjct  104  PDVFYCLKLLEATRISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMLSFKKFN  157



>gb|AFK42206.1| unknown [Lotus japonicus]
Length=305

 Score =   198 bits (504),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPPRAIE A+   KA
Sbjct  196  FVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPRAIEAAKQARKA  255

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  243
            PDVYYCLKLLEATGISTVPGSGFGQK+G FHLRTTILP EE+MPAIM  F
Sbjct  256  PDVYYCLKLLEATGISTVPGSGFGQKDGYFHLRTTILPLEEEMPAIMGEF  305



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+   S  I++SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  AI  A+  GK
Sbjct  352  LYAAESAAIMQSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPKAAIAAARQAGK  411

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+DMPAIMESFK FN +FM 
Sbjct  412  APDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPAIMESFKMFNADFMA  471

Query  215  QYEDHR  198
            QY D +
Sbjct  472  QYSDSK  477



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK I  SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  A+  A+  GKAPDV+
Sbjct  357  SKAISLSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPQAAVAAAKKAGKAPDVF  416

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+DMP IMESFKKFN +FM QY D 
Sbjct  417  YCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPGIMESFKKFNQDFMAQYADA  476

Query  200  R  198
            +
Sbjct  477  K  477



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+   S+ I  SLRKRA IMTDGFN+C N+VCNFTEGAMYSFPQ++LP  AI  A+  GK
Sbjct  352  LYKAESEAISLSLRKRAHIMTDGFNACENIVCNFTEGAMYSFPQVKLPQAAIAAAKKAGK  411

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E DMP IMESFKKFN +FM 
Sbjct  412  APDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSERDMPGIMESFKKFNADFMA  471

Query  215  QYEDHR  198
            Q+ D +
Sbjct  472  QHSDTK  477



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK I+ES+R+RA IMTDGFN C +VVCNFTEGAMYSFP+I+L   A++ A   GKA DV+
Sbjct  356  SKAIIESMRRRAHIMTDGFNKCEDVVCNFTEGAMYSFPRIKLSKAAMDAAAQAGKAADVF  415

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
            YCLKLLEATGISTVPGSGFGQKEG  HLRTTILP E+DMP IM  F+KF+ +FM QY D+
Sbjct  416  YCLKLLEATGISTVPGSGFGQKEGTLHLRTTILPLEQDMPGIMAKFQKFHADFMAQYSDY  475

Query  200  RGYSRM  183
               SR+
Sbjct  476  SVSSRL  481



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            + GI+ S+R+RAR+MTDGFN+C  + CN+TEGAMYSFP++ LPP+A++ A+  GKAPD +
Sbjct  406  AAGIIASMRRRARMMTDGFNACEGITCNYTEGAMYSFPRLNLPPKALQAAKKAGKAPDTW  465

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
            YCLKLL+ATG+ TVPGSGFGQ+EG FHLRTTILP E+ +  ++ SF+KF+  FMD+Y
Sbjct  466  YCLKLLDATGVLTVPGSGFGQEEGTFHLRTTILPQEDKIKDVIASFQKFHASFMDEY  522



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++R SKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A+ETA+  GKA
Sbjct  352  FVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKALETAKQAGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFH  300
             DVYYCLKLLEATGISTVPGSGFGQKEG  H
Sbjct  412  ADVYYCLKLLEATGISTVPGSGFGQKEGYVH  442



>emb|CDX91589.1| BnaC02g15710D [Brassica napus]
 emb|CDX88411.1| BnaC06g38550D [Brassica napus]
 emb|CDX86159.1| BnaA06g28760D [Brassica napus]
Length=131

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  536  RKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEA  357
            R+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKL EA
Sbjct  46   RRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLFEA  105

Query  356  TGISTVPGSGFGQKEGVFHLR  294
            TGISTVPGSGFGQKEGVFHLR
Sbjct  106  TGISTVPGSGFGQKEGVFHLR  126



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +LR SKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A+ETA+  GKA
Sbjct  352  YLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALETAKQAGKA  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEG  309
            PDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEG  439



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            ++ +     L SLR+RA ++TDGFNS   V CNFTEGAMYSFPQI+LPP+A+E A+  GK
Sbjct  400  MYTKEKAAELASLRRRAHMVTDGFNSLDGVTCNFTEGAMYSFPQIKLPPKALEAAKAAGK  459

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            A DV+YCLKLLE+TGISTVPGSGFGQ++G FHLRTTILP EE M + +E F+KF+ +FM 
Sbjct  460  AGDVFYCLKLLESTGISTVPGSGFGQEDGTFHLRTTILPREEVMSSFVEKFEKFHKDFMK  519

Query  215  QY  210
            QY
Sbjct  520  QY  521



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LW++  +G L SL +RA+++ DGFNS + V CN TEGAMY+FP++ LPPRA+E A+  G+
Sbjct  499  LWIQEQQGELASLNRRAKMVVDGFNSLQGVSCNATEGAMYAFPRLSLPPRALEAARKAGR  558

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +YCL+LLEATGI  VPGSGFGQ EG FHLRTTILP EE M   ++ F+ F+  FM 
Sbjct  559  APDAFYCLRLLEATGIVAVPGSGFGQAEGSFHLRTTILPREERMAEFVQKFRTFHQSFMA  618

Query  215  QY  210
            ++
Sbjct  619  EF  620



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            SK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ A+  GKAPDVY
Sbjct  356  SKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDVAKSAGKAPDVY  415

Query  380  YCLKLLEATGISTVPGSGFGQKEG  309
            YCLKLLEATGISTVPGSGFGQKEG
Sbjct  416  YCLKLLEATGISTVPGSGFGQKEG  439



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R SKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK 
Sbjct  352  FARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKV  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEG  309
            PDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  412  PDVFYCLKLLEATGISTVPGSGFGQKEG  439



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+++   GI +SL+KRA ++    NS   V CN +EGAMY+FPQIRLP +A+E AQ +GK
Sbjct  408  LYIKERDGIYDSLKKRANLLNKALNSLEGVTCNPSEGAMYAFPQIRLPKKAVEYAQSIGK  467

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD YYC++LLE TGI  VPGSGFGQK+G +H RTT LP+EE +  + E    F+ +FM+
Sbjct  468  APDAYYCIQLLEHTGICVVPGSGFGQKDGTYHFRTTFLPSEEAIEGVCERIADFHKQFMN  527

Query  215  QYE  207
            +Y+
Sbjct  528  KYK  530



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 7/152 (5%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R  + +L+SLR+RAR +TD FNSC  +VC  TEGAMYSFP+I LPP A+  A+  GK+
Sbjct  398  YAREKQDLLDSLRRRARAITDAFNSCEGIVCQETEGAMYSFPKITLPPAAMAAAKAAGKS  457

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+YCLKLLE TGISTVPGSGF Q++G FH RTTILP E     I++ F  F+  FM +
Sbjct  458  PDVFYCLKLLETTGISTVPGSGFKQRDGTFHFRTTILPPESKFQDIIQRFLAFHSAFMAE  517

Query  212  YE-------DHRGYSRM*QIADNMKQLLKSHK  138
            Y+       D R   R  Q    +  ++ +H+
Sbjct  518  YKGSTGRGTDSRDVKRAEQQESEVNWMIPAHR  549



>gb|AFK38994.1| unknown [Lotus japonicus]
Length=136

 Score =   144 bits (363),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++   + IL SL +RA+I+ DGFN    V CN  EGAMY FPQIRLP +AI+ A+    A
Sbjct  14   FMAEKENILSSLARRAKILEDGFNKLEGVTCNQAEGAMYLFPQIRLPQKAIKAAEAANTA  73

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+  F +F+++FM++
Sbjct  74   PDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRFTEFHEKFMNE  133

Query  212  YED  204
            + D
Sbjct  134  FRD  136



>gb|AFK36743.1| unknown [Lotus japonicus]
Length=171

 Score =   145 bits (365),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++   + IL SL +RA+I+ DGFN    V CN  EGAMY FPQIRLP +AI+ A+    A
Sbjct  49   FMAEKENILSSLARRAKILEDGFNKLEGVTCNKAEGAMYLFPQIRLPQKAIKAAEAANTA  108

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+  F +F+++FM++
Sbjct  109  PDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRFTEFHEKFMNE  168

Query  212  YED  204
            + D
Sbjct  169  FRD  171



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  548  LESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLK  369
            L SLR+RA ++TDGFN+   V CNFTEGAMYSFPQI+LP +A+E A+  GKA DV+YCLK
Sbjct  408  LVSLRRRAHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEAAKAAGKAGDVFYCLK  467

Query  368  LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
            LLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F KF+ +FM QY
Sbjct  468  LLEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTHFVEKFDKFHKDFMKQY  520



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  548  LESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLK  369
            L SLR+R  ++TDGFN+   V CNFTEGAMYSFPQI+LP +A+E A+  GKA DV+YCLK
Sbjct  408  LVSLRRRRHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEAAKAAGKAGDVFYCLK  467

Query  368  LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
            LLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F KF+ +FM QY
Sbjct  468  LLEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTTFVEKFDKFHKDFMKQY  520



>gb|EEE58449.1| hypothetical protein OsJ_09677 [Oryza sativa Japonica Group]
Length=254

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+      IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AIE A+ + K
Sbjct  131  LYEEEKDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEAARAVNK  190

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F++EFM 
Sbjct  191  APDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREFHEEFMS  250

Query  215  QYED  204
            QY D
Sbjct  251  QYRD  254



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -3

Query  587  GRRILWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQ  408
            G   L++    GIL+SL +RA+ M   FNS   + CN TEGAMY FPQI LP +AIE A+
Sbjct  355  GSYDLYMEEKDGILKSLARRAKAMESAFNSIDGITCNKTEGAMYLFPQIYLPHKAIEAAR  414

Query  407  GLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFND  228
             + KAPD +Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F++
Sbjct  415  AVNKAPDAFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMIARFREFHE  474

Query  227  EFMDQYED  204
            EFM QY D
Sbjct  475  EFMAQYRD  482



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -3

Query  548  LESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLK  369
            L SLR+RA +MTD FN      CNFTEGAMYSFP++ LP +AI+ A+  GK PD +YCL 
Sbjct  373  LASLRRRAHVMTDAFNGLEGASCNFTEGAMYSFPRLHLPAKAIQAAKEAGKDPDTFYCLA  432

Query  368  LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            LL  TGI TVPGSGFGQ EG FHLRTTILP E+ M   ++  + F+  FM +Y+D
Sbjct  433  LLADTGIVTVPGSGFGQVEGTFHLRTTILPQEDVMHEFVDKLRTFHKSFMAKYKD  487



>ref|NP_001060284.1| Os07g0617800 [Oryza sativa Japonica Group]
 dbj|BAF22198.1| Os07g0617800 [Oryza sativa Japonica Group]
Length=329

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G A
Sbjct  207  FMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAAGTA  266

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+
Sbjct  267  PDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDE  326

Query  212  YED  204
            + D
Sbjct  327  FRD  329



>gb|KIY92376.1| hypothetical protein MNEG_15586 [Monoraphidium neglectum]
Length=157

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LW +  +G L SLR+RA ++TDGFNS   V CNFTEGAMY+FP++ LPP+A+  A+  GK
Sbjct  46   LWRQEREGELASLRRRAHMVTDGFNSLEGVTCNFTEGAMYAFPRLHLPPKAVAAAKAAGK  105

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFK  240
            APDV+YCL+LLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   ++ FK
Sbjct  106  APDVFYCLRLLEATGISTVPGSGFGQEEGTFHLRTTILPREEKMAEFVQLFK  157



>ref|NP_001064504.1| Os10g0390500 [Oryza sativa Japonica Group]
 dbj|BAA77260.1| alanine aminotransferase [Oryza sativa]
 dbj|BAA77261.1| alanine aminotransferase [Oryza sativa]
 gb|ABB47494.1| Alanine aminotransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26418.1| Os10g0390500 [Oryza sativa Japonica Group]
 gb|ACA50484.1| alanine aminotransferase [Oryza sativa Japonica Group]
 gb|EEC66876.1| hypothetical protein OsI_33417 [Oryza sativa Indica Group]
 gb|EEE50893.1| hypothetical protein OsJ_31385 [Oryza sativa Japonica Group]
Length=483

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +AI+ A+   KAPD +Y 
Sbjct  367  GILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKAPDAFYA  426

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  427  LRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAAYRD  483



>tpg|DAA41461.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
 tpg|DAA41462.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
Length=330

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ  G APD YY 
Sbjct  213  GILSSLGRRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPRKAIGAAQAAGTAPDAYYA  272

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  201
             +LLEATGI  VPGSGFGQ  G +H+R+TILP E+ +P I+  FK+F+D+FMD++ D+
Sbjct  273  KRLLEATGIVFVPGSGFGQVPGTWHIRSTILPQEDKIPGIVSRFKEFHDKFMDEFRDY  330



>gb|AAK52114.1|AC079936_10 Putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=484

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +AI+ A+   KAPD +Y 
Sbjct  368  GILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKAPDAFYA  427

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  428  LRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAAYRD  484



>ref|XP_006661735.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=483

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL+SL +RA+ + D FN+   + CN TEGAMY FPQ+ LP +AIE A+   KAPD +Y 
Sbjct  367  GILQSLARRAKALEDAFNNLEGITCNKTEGAMYLFPQLLLPRKAIEAAKAANKAPDAFYA  426

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            L+LLE+TGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  427  LRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIITRFKTFHESFMAAYRD  483



>gb|ETK83815.1| hypothetical protein L915_11053 [Phytophthora parasitica]
Length=200

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +     G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G A
Sbjct  79   YAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMA  138

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+  FMD+
Sbjct  139  PDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDK  198

Query  212  Y  210
            Y
Sbjct  199  Y  199



>ref|XP_006657961.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oryza 
brachyantha]
Length=453

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G  PD YY 
Sbjct  337  GILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKAIGAAQAAGTVPDAYYA  396

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+Y D
Sbjct  397  RRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDEYRD  453



>tpg|DAA63613.1| TPA: hypothetical protein ZEAMMB73_743428 [Zea mays]
Length=329

 Score =   141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ +G A
Sbjct  207  FMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTA  266

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD+
Sbjct  267  PDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDE  326

Query  212  YED  204
            + D
Sbjct  327  FRD  329



>gb|EEC74641.1| hypothetical protein OsI_10280 [Oryza sativa Indica Group]
Length=494

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+      IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AIE A+ + K
Sbjct  371  LYEEERDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEAARAVNK  430

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F++EFM 
Sbjct  431  APDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREFHEEFMS  490

Query  215  QYED  204
            QY D
Sbjct  491  QYRD  494



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G  
Sbjct  369  FMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKAIGAAQAAGTV  428

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+
Sbjct  429  PDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDE  488

Query  212  YED  204
            Y D
Sbjct  489  YRD  491



>gb|ETL90369.1| hypothetical protein L917_10859 [Phytophthora parasitica]
Length=170

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +     G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G A
Sbjct  49   YAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMA  108

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF+  FMD+
Sbjct  109  PDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDK  168

Query  212  Y  210
            Y
Sbjct  169  Y  169



>dbj|BAC79866.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC79995.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=486

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G A
Sbjct  364  FMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAAGTA  423

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+
Sbjct  424  PDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDE  483

Query  212  YED  204
            + D
Sbjct  484  FRD  486



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G A
Sbjct  424  FMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAAGTA  483

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+
Sbjct  484  PDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDE  543

Query  212  YED  204
            + D
Sbjct  544  FRD  546



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G A
Sbjct  424  FMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAAGTA  483

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+
Sbjct  484  PDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDE  543

Query  212  YED  204
            + D
Sbjct  544  FRD  546



>emb|CDJ93113.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=505

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            WL+    +L SL++RA ++ + + S   + CN  +GAMY+FPQ+ LPPRA+E A+ L   
Sbjct  384  WLKEKNAVLASLKERATLVKEAYGSIEGIKCNEVQGAMYAFPQLMLPPRAVEKARSLNME  443

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +Y ++LLE+TG+  VPGSGFGQKEG +H RTTILP  E M  ++E FK F+ +FM++
Sbjct  444  PDFFYAMQLLESTGVCIVPGSGFGQKEGTYHFRTTILPQTEMMKDMLERFKSFHTKFMEE  503

Query  212  YE  207
            Y+
Sbjct  504  YK  505



>gb|ETL37230.1| hypothetical protein L916_10951 [Phytophthora parasitica]
 gb|ETM43674.1| hypothetical protein L914_10886 [Phytophthora parasitica]
Length=200

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +     G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G A
Sbjct  79   YAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMA  138

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF+  FMD+
Sbjct  139  PDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDK  198

Query  212  Y  210
            Y
Sbjct  199  Y  199



>ref|XP_002463187.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
 gb|EER99708.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
Length=541

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ  G APD YY 
Sbjct  425  GILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAAGTAPDAYYA  484

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  485  KRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRFKEFHEKFMDEFRD  541



>gb|AAV64199.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ +G A
Sbjct  394  FMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTA  453

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD+
Sbjct  454  PDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDE  513

Query  212  YED  204
            + D
Sbjct  514  FRD  516



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ +G A
Sbjct  419  FMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTA  478

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD+
Sbjct  479  PDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDE  538

Query  212  YED  204
            + D
Sbjct  539  FRD  541



>gb|AAV64237.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ +G A
Sbjct  394  FMSERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTA  453

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD+
Sbjct  454  PDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDE  513

Query  212  YED  204
            + D
Sbjct  514  FRD  516



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +++    I +SL++RA ++    N    V CN  EGAMY+FPQIRLP RAIE A+  GKA
Sbjct  478  YVKERDTIFDSLKRRANLLAAALNGLEGVTCNQPEGAMYAFPQIRLPARAIEEAKANGKA  537

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+E+ +  +      F+  FM +
Sbjct  538  PDAYYCIQLLEATGICVVPGSGFGQKDGTYHFRTTFLPSEQAIQGVCTRIADFHKNFMAK  597

Query  212  YE  207
            Y+
Sbjct  598  YK  599



>gb|KHN77825.1| Alanine aminotransferase 1 [Toxocara canis]
Length=552

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LWL+     L+SL++RAR++ + + S   + CN  +GAMY+FPQI LPP+A++ A+ L +
Sbjct  430  LWLKEKTATLDSLKERARLVKEAYGSIEGIKCNPVQGAMYAFPQIMLPPKAVQKAKSLNQ  489

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            A D +Y ++LLEATG+  VPGSGFGQK+G +H RTTILP    M  ++E FK F+ +FM 
Sbjct  490  AADFFYAMQLLEATGVCVVPGSGFGQKDGTYHFRTTILPQPPLMKEMLERFKGFHTKFMK  549

Query  215  QY  210
            +Y
Sbjct  550  EY  551



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+L    GIL SL++RA+ + D  NS   V CN  EGAMY FP+I LP +AI  A+    
Sbjct  418  LYLSEKDGILSSLKRRAKTLEDALNSLEGVTCNRAEGAMYLFPRIELPQKAIHAAEAAKT  477

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA+++   +F+ +FMD
Sbjct  478  APDAFYCKRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVVDRLTEFHKKFMD  537

Query  215  QYED  204
            ++ D
Sbjct  538  EFRD  541



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -3

Query  560  SKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  381
            ++ I ES+++RA  +T  FN+   V CN TEGAMY+FP++ LPP+A+E A+  GKAPD +
Sbjct  368  TRAIHESMQRRAAKVTAAFNALPGVTCNPTEGAMYAFPRLHLPPKAVEAARAAGKAPDTF  427

Query  380  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
            YCL LL+ TGI TVPG+GFGQ +G +H+RTTILP E+ +      F +F+ +FMD+Y
Sbjct  428  YCLALLDYTGIVTVPGTGFGQVDGTWHMRTTILPQEDVLDDFCNRFAEFHQQFMDKY  484



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+L+    I ESL+KRA ++T+  N+   V CN +EGAMY+FPQIRLP +A+E A  +GK
Sbjct  412  LYLKERDNIYESLKKRANLLTNALNNLEGVTCNPSEGAMYAFPQIRLPAKAVEYANSIGK  471

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+EE +  + +    F+  FM+
Sbjct  472  APDAYYCIQLLEATGICVVPGSGFGQKDGTWHFRTTFLPSEEAIEGVCKRIADFHQSFMN  531

Query  215  QYE  207
            +Y+
Sbjct  532  KYK  534



>emb|CEF68484.1| Alanine aminotransferase 1 [Strongyloides ratti]
Length=481

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            W      +L SL++RA ++ + +     + CN  +GAMY+FP++ LP +AIE A+ LG+ 
Sbjct  360  WNSEKNAVLASLKERATLVKEAYEKLEGITCNPVQGAMYAFPRVHLPTKAIEKAKSLGQE  419

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +Y + LLE TGI  VPGSGFGQ+EG +H RTTILP  E M  +ME F KF++EFM +
Sbjct  420  PDFFYAMSLLEETGICVVPGSGFGQREGTYHFRTTILPQPELMKEMMERFTKFHNEFMKK  479

Query  212  YE  207
            YE
Sbjct  480  YE  481



>gb|ETP13560.1| hypothetical protein F441_11279 [Phytophthora parasitica CJ01A1]
Length=499

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +     G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G A
Sbjct  378  YAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMA  437

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+  FMD+
Sbjct  438  PDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDK  497

Query  212  Y  210
            Y
Sbjct  498  Y  498



>ref|XP_004342401.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR20285.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
Length=514

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+ + + GI ESL++RA  +T+ FN    V CN  EGAMY FP++RLP +A+  A    K
Sbjct  391  LYHQETTGIFESLKRRALRLTEAFNKLEGVTCNEAEGAMYLFPRVRLPAKAVHEAVKQKK  450

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PD +YCL LL+ TGI  VPGSGFGQK+G +H RTT LP E+ + A+ +S  KF+ +FM 
Sbjct  451  TPDSFYCLALLDQTGICVVPGSGFGQKDGTYHFRTTFLPPEDKIDAVAKSIAKFHHDFMQ  510

Query  215  QYED  204
            +Y D
Sbjct  511  KYRD  514



>gb|ETP41623.1| hypothetical protein F442_11247 [Phytophthora parasitica P10297]
Length=499

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +     G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G A
Sbjct  378  YAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMA  437

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+  FMD+
Sbjct  438  PDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDK  497

Query  212  Y  210
            Y
Sbjct  498  Y  498



>ref|XP_008907369.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETN06993.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETO72425.1| hypothetical protein F444_11432 [Phytophthora parasitica P1976]
Length=499

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +     G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G A
Sbjct  378  YAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMA  437

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+  FMD+
Sbjct  438  PDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDK  497

Query  212  Y  210
            Y
Sbjct  498  Y  498



>gb|EYC32542.1| hypothetical protein Y032_0003g1641 [Ancylostoma ceylanicum]
Length=499

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LWL+    +L+SL++RA ++ + + S   + CN  +GAMY+FPQI++P +AIE A+ L +
Sbjct  377  LWLKEKTAVLDSLKQRATLVKEAYGSIEGIRCNEVQGAMYAFPQIQIPQKAIEKARSLNQ  436

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PD +Y ++LLE+TG+  VPGSGFGQKEG +H RTTILP  E M  ++  FK F+ +F+ 
Sbjct  437  EPDFFYAMQLLESTGVCIVPGSGFGQKEGTYHFRTTILPQPELMKDMLNRFKSFHTKFLQ  496

Query  215  QYE  207
            +Y+
Sbjct  497  EYK  499



>gb|EYC32543.1| hypothetical protein Y032_0003g1641 [Ancylostoma ceylanicum]
Length=529

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LWL+    +L+SL++RA ++ + + S   + CN  +GAMY+FPQI++P +AIE A+ L +
Sbjct  407  LWLKEKTAVLDSLKQRATLVKEAYGSIEGIRCNEVQGAMYAFPQIQIPQKAIEKARSLNQ  466

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PD +Y ++LLE+TG+  VPGSGFGQKEG +H RTTILP  E M  ++  FK F+ +F+ 
Sbjct  467  EPDFFYAMQLLESTGVCIVPGSGFGQKEGTYHFRTTILPQPELMKDMLNRFKSFHTKFLQ  526

Query  215  QYE  207
            +Y+
Sbjct  527  EYK  529



>ref|XP_002887430.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63689.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL S+ KRA+ + DG NS   V CN  EGAMY FP+I LP +AIE A+    A
Sbjct  413  YMAERDGILSSMAKRAKTLEDGLNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTA  472

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD+
Sbjct  473  PDAFYCKRLLNATGVVVVPGSGFGQAPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDE  532

Query  212  YED  204
            + D
Sbjct  533  FRD  535



>dbj|GAM23260.1| hypothetical protein SAMD00019534_064350 [Acytostelium subglobosum 
LB1]
Length=531

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++     I  SL++RA ++    NS   V CN  EGAMY+FPQIRLPP+A+E A+  GK 
Sbjct  410  YIEERDAIYNSLKRRANLLATALNSLEGVTCNAPEGAMYAFPQIRLPPKAVEEAKQNGKQ  469

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC++LLEATGI  VPGSGFGQ++G +H RTT LP+E+ +  + +    F+  FM +
Sbjct  470  PDAHYCIQLLEATGICVVPGSGFGQRDGTYHFRTTFLPSEQAIEGVCKKVADFHKAFMAK  529

Query  212  YE  207
            Y+
Sbjct  530  YK  531



>gb|KIY93453.1| alanine transaminase [Monoraphidium neglectum]
Length=105

 Score =   130 bits (326),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -3

Query  521  IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGIST  342
            ++TDGFNS   V C  T+GAMYSFPQI LPP+AI  A+  GKAPDV+YCL+LLEATGIST
Sbjct  1    MVTDGFNSLEGVTCTVTQGAMYSFPQILLPPKAIAAAKAAGKAPDVFYCLELLEATGIST  60

Query  341  VPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
            VPGSGFGQ EG FHLRTTILP EE M   ++ F+ F++ FM+QY
Sbjct  61   VPGSGFGQSEGTFHLRTTILPREERMAEFVQKFRDFHESFMEQY  104



>ref|XP_002430266.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
 gb|EEB17528.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
Length=485

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+    + +L  L+KRA+++ D FNS     CN  +GAMY+FPQ++LPP+A+E A+  GK
Sbjct  363  LYKEEREQVLSELKKRAKMVADTFNSIPGFSCNEVQGAMYAFPQMQLPPKAVEAAKKEGK  422

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +Y L+LLE TGI  VPGSGFGQ+ G  H RTTILP  + + A++++FK F+ +F+ 
Sbjct  423  APDTFYALQLLENTGICIVPGSGFGQQPGTHHFRTTILPQTDKLKAMLDTFKTFHKKFLK  482

Query  215  QY  210
            +Y
Sbjct  483  EY  484



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A+ +  A
Sbjct  404  FIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAAKAVNVA  463

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F++ FM++
Sbjct  464  PDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISHLKAFHESFMEE  523

Query  212  YED  204
            + D
Sbjct  524  FHD  526



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = -3

Query  551  ILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCL  372
            IL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AI+ A+ +  APD YY  
Sbjct  415  ILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIKAAEAVKTAPDAYYAH  474

Query  371  KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            +LL+ATGI  VPGSGFGQ  G +H+R+TILP E+ +PAI+   K F++ FMD++ D
Sbjct  475  RLLDATGIVVVPGSGFGQVPGTWHIRSTILPQEDKIPAILSRLKAFHEAFMDEFRD  530



>emb|CDJ93112.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=416

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            WL+    +L SL++RA ++ + + S   + CN  +GAMY+FPQI LP RAIE A+ L   
Sbjct  295  WLKEKTAVLASLKERATLVKEAYGSIDGIKCNEVQGAMYAFPQIMLPRRAIEKARSLNME  354

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +Y ++LLEATG+  VPGSGFGQKEG +H RTTILP    M  ++E FK F+ +FM +
Sbjct  355  PDFFYAMQLLEATGVCIVPGSGFGQKEGTWHFRTTILPQTAMMKDMLERFKSFHTKFMKE  414

Query  212  YE  207
            Y+
Sbjct  415  YK  416



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP +AIE A+   KAPD +Y 
Sbjct  366  GILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYA  425

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F  F++ FM +Y D
Sbjct  426  LRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSEYRD  482



>ref|XP_002906656.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66057.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=499

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +     G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G A
Sbjct  378  YAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMA  437

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC ++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+ +FMD 
Sbjct  438  PDAFYCTQMLDDTGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEMTSKFHAKFMDT  497

Query  212  Y  210
            Y
Sbjct  498  Y  498



>gb|ETI43749.1| hypothetical protein F443_11362 [Phytophthora parasitica P1569]
Length=499

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +     G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G A
Sbjct  378  YAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMA  437

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF+  FMD+
Sbjct  438  PDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDK  497

Query  212  Y  210
            Y
Sbjct  498  Y  498



>gb|EHJ76295.1| putative alanine aminotransferase [Danaus plexippus]
Length=477

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LWLR  + +L SLR+RA+++TDG N+ +   CN  +GAMY+FP + LPP+A+  A+   +
Sbjct  355  LWLREKESVLASLRERAKMITDGLNAGQGFKCNIVQGAMYAFPTVILPPKAVAAAEDAKQ  414

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PDV+Y  +LLE TGI  VPGSGFGQ  G  H+R TILP  +D+  ++ S K F+  F++
Sbjct  415  PPDVFYAYRLLEETGICVVPGSGFGQAPGTHHIRMTILPKTDDLRTMIHSIKTFHQSFIE  474

Query  215  QY  210
            +Y
Sbjct  475  RY  476



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A+ +  A
Sbjct  404  FIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAAKVVNAA  463

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F++ FM++
Sbjct  464  PDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRLKAFHESFMEE  523

Query  212  YED  204
            + D
Sbjct  524  FHD  526



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -3

Query  551  ILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCL  372
            IL SL +RA+ + D FN+   + CN  EGAMY FP+I LP +AI+ A    KAPD +Y L
Sbjct  366  ILTSLARRAKALEDAFNNLEGITCNKAEGAMYLFPRINLPQKAIDAANAANKAPDAFYAL  425

Query  371  KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            +LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  FK F++ FM ++ D
Sbjct  426  RLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFKVFHEAFMAEHRD  481



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP +AIE A+   KAPD +Y 
Sbjct  384  GILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYA  443

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F  F++ FM +Y D
Sbjct  444  LRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSEYRD  500



>ref|XP_003055208.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60460.1| predicted protein [Micromonas pusilla CCMP1545]
Length=477

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+ +    IL SL++RA  + +G N+   V C   EGAMY+FP+I LP + ++ A+G G 
Sbjct  354  LYKQEKDDILSSLKRRAVTLVNGLNALEGVSCQEAEGAMYAFPKIDLPAKFLKEAEGSGM  413

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD  YC++LLEATGI  VPGSGFGQ EG +H RTT LPAE D+  +++   KF+ +FMD
Sbjct  414  APDALYCMRLLEATGIVVVPGSGFGQVEGTWHFRTTFLPAEADIEGVVQKMTKFHGDFMD  473

Query  215  QYED  204
             Y +
Sbjct  474  AYRN  477



>gb|ADB91976.1| alanine aminotransferase [Branchiostoma belcheri]
Length=500

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +++    +L SL +RA+++ + FNS   V CN  +GAMY FP+I LP RA+E A+ LG++
Sbjct  378  FIKEKTAVLTSLAERAKLVAETFNSIEGVTCNTVQGAMYPFPRIHLPRRAVEKAKSLGQS  437

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +Y L+LLE  GI  VPGSGFGQ+EG +H RTTILP  + +   M++F  F+++F+ +
Sbjct  438  PDGFYALQLLEQAGICVVPGSGFGQREGTYHFRTTILPQPDKLKIFMDAFTAFHNKFLQE  497

Query  212  YED  204
            Y D
Sbjct  498  YAD  500



>gb|ENN78579.1| hypothetical protein YQE_04947, partial [Dendroctonus ponderosae]
 gb|ERL91463.1| hypothetical protein D910_08793 [Dendroctonus ponderosae]
Length=525

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + +  + +L+SL+ RA+++ D FNS     CN  +GAMY+FPQI LP +AIE A+  GK 
Sbjct  404  FTKEKQAVLDSLKVRAKMVADTFNSMEGFSCNTVQGAMYAFPQITLPAKAIEAAKKEGKQ  463

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+Y  +LLE TGI  VPGSGFGQK+G +H RTTILP  + + +++E F +F+ +F+ +
Sbjct  464  PDVFYAFELLENTGICIVPGSGFGQKQGTYHFRTTILPQPDKLKSMLEKFAEFHSQFIKK  523

Query  212  Y  210
            Y
Sbjct  524  Y  524



>ref|XP_005775483.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
 gb|EOD23054.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
Length=541

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -3

Query  551  ILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCL  372
            IL S+++RA ++ DG N+   V CN  +GAMY+FP I LPP+AI  A+  GK PD +Y L
Sbjct  427  ILASMKRRATMLVDGLNALEGVTCNQPQGAMYAFPSITLPPKAIAAAKDAGKVPDTFYAL  486

Query  371  KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
             LLEATGI  VPGSGFGQKEG +H RTT LP E +M  +++    F+ +FM +Y
Sbjct  487  ALLEATGIVVVPGSGFGQKEGTWHFRTTFLPPESEMTDVVDRMTAFHADFMGKY  540



>dbj|BAN21041.1| alanine aminotransferase [Riptortus pedestris]
Length=522

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +++  +G+L SL +RAR++T+ FNS   + CN  +GAMY+FP+I LP +AI+ A+ L + 
Sbjct  401  FIKEKQGVLSSLAERARMVTETFNSVEGMSCNTVQGAMYAFPRIHLPQKAIDKAKSLNQD  460

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            P V+Y  +LLE TGI  VPGSGFGQ EG +H RTTILP  E + +++++FK F+ +F+ +
Sbjct  461  PSVFYAFQLLEETGICIVPGSGFGQVEGTYHFRTTILPQPEQLKSMLKTFKTFHQKFVQE  520

Query  212  YE  207
            Y+
Sbjct  521  YK  522



>gb|KFK41472.1| hypothetical protein AALP_AA2G135300 [Arabis alpina]
Length=545

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  419  ETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFK  240
            + A+  GK PDV+YCLKLLEATGISTV GSGFGQKEGVFHLRTTIL AEE+MP IMESFK
Sbjct  467  KAAKQAGKVPDVFYCLKLLEATGISTVSGSGFGQKEGVFHLRTTILRAEEEMPEIMESFK  526

Query  239  KFNDEFMDQYEDHRGYSRM  183
            KFNDEFM QY D+ GYSRM
Sbjct  527  KFNDEFMSQYGDNSGYSRM  545



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AI+ A+ +  A
Sbjct  365  FIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIDAAKAVIAA  424

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD  Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   K F++ FMD+
Sbjct  425  PDTLYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPQEDKIPAIISRLKAFHEAFMDE  484

Query  212  YED  204
            + D
Sbjct  485  FRD  487



>ref|XP_010939850.1| PREDICTED: alanine aminotransferase 2 isoform X3 [Elaeis guineensis]
Length=329

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A  +  APD +Y 
Sbjct  213  GILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYA  272

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  273  RRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  329



>ref|XP_008620886.1| alanine transaminase [Saprolegnia diclina VS20]
 gb|EQC25667.1| alanine transaminase [Saprolegnia diclina VS20]
Length=489

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L++    GIL SL++RA  +   FN    V CN  EGAMY+FP+I +P +A+E A   G 
Sbjct  367  LYIAQRDGILSSLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKAVEEATKRGV  426

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +Y + LL+ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E   KF+ EFMD
Sbjct  427  APDAFYAMALLDATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKTAKFHAEFMD  486

Query  215  QY  210
             Y
Sbjct  487  LY  488



>ref|XP_003724792.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 2-like 
[Strongylocentrotus purpuratus]
Length=552

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +L+  K +L++L  +A+++ DGFNS   V CN   GAMYSFP I LP +AI+ A+ +GK 
Sbjct  421  FLQEKKNVLDTLALKAKVVADGFNSLEGVTCNTVMGAMYSFPNITLPQKAIDKAKEMGKQ  480

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD++Y    LE  G+  VPGSGFGQ++G +H R TILP+ E +  +M+ FKKF+  FM++
Sbjct  481  PDLFYAEHFLEEAGVCVVPGSGFGQRDGTYHFRMTILPSVELIHDVMDRFKKFHANFMEK  540

Query  212  YED  204
            Y D
Sbjct  541  YGD  543



>ref|XP_002499950.1| alanine aminotransferase [Micromonas sp. RCC299]
 gb|ACO61208.1| alanine aminotransferase [Micromonas sp. RCC299]
Length=463

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+      IL SL++RA  +  G N+   V CN  +GAMY+FP++ LP + +  A   GK
Sbjct  340  LYAAERDAILSSLKRRALKLVSGLNALEGVTCNEAQGAMYAFPKVSLPEKFVAEATASGK  399

Query  395  -APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM  219
             APD  YC+KLLEATGI  VPGSGFGQ EG +H RTT LP+EED+  ++E   KF+ EFM
Sbjct  400  MAPDALYCMKLLEATGIVVVPGSGFGQVEGTWHFRTTFLPSEEDIGGVVEKLAKFHAEFM  459

Query  218  DQY  210
            D Y
Sbjct  460  DTY  462



>ref|XP_007024768.1| Alanine aminotransferase 2 [Theobroma cacao]
 gb|EOY27390.1| Alanine aminotransferase 2 [Theobroma cacao]
Length=539

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL +L +RA+ + D FN    V CN  EGAMY FP+I LP +AI+ AQ    APD +YC
Sbjct  423  GILSALARRAKTLEDAFNKLEGVTCNKAEGAMYLFPRIHLPEKAIKAAQVAKTAPDAFYC  482

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP EE +PAI+     F+  FMD++ D
Sbjct  483  RRLLSATGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTHLTDFHKSFMDEFRD  539



>gb|EMT23015.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=508

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ +   F+    + CN  EGAMY FPQI LP +AIE A+   KAPD +Y 
Sbjct  392  GILASLARRAKALEVAFSKLEGITCNKAEGAMYLFPQICLPQKAIEAAKAANKAPDAFYA  451

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  F  F++ FM +Y D
Sbjct  452  LRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFTVFHETFMAEYRD  508



>gb|KJB68682.1| hypothetical protein B456_011G0552001 [Gossypium raimondii]
Length=329

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ A+ +  A
Sbjct  207  YIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKAAEEVKTA  266

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F+  FMD+
Sbjct  267  PDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDE  326

Query  212  YED  204
            + D
Sbjct  327  FRD  329



>gb|KJB68683.1| hypothetical protein B456_011G0552001, partial [Gossypium raimondii]
Length=331

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ A+ +  A
Sbjct  209  YIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKAAEEVKTA  268

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F+  FMD+
Sbjct  269  PDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDE  328

Query  212  YED  204
            + D
Sbjct  329  FRD  331



>gb|EMS46317.1| Alanine aminotransferase 2 [Triticum urartu]
Length=519

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ +   F+    + CN  EGAMY FPQI LP +AIE A+   KAPD +Y 
Sbjct  403  GILASLARRAKALEIAFSKLEGITCNKAEGAMYLFPQICLPQKAIEAAKAANKAPDAFYA  462

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  F  F++ FM +Y D
Sbjct  463  LRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFTVFHETFMAEYRD  519



>gb|ERG84738.1| alanine aminotransferase 2-like protein [Ascaris suum]
Length=565

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LW +   GIL+S+++RAR++ + + +   + CN  +GAMY+F +I LP +AIE A+    
Sbjct  443  LWYKEKTGILKSMKERARLVKEAYGALDGIECNPVQGAMYAFAKINLPKKAIEEAKKQNV  502

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD  Y +K+LEATGI TVPGSGFGQKEG +H RTTILP  + M  +++ FK F+ +FM+
Sbjct  503  APDFLYGMKMLEATGICTVPGSGFGQKEGTYHFRTTILPQTDLMKEMLDRFKPFHADFMN  562

Query  215  QYE  207
             Y+
Sbjct  563  TYK  565



>ref|XP_010096539.1| Alanine aminotransferase 2 [Morus notabilis]
 gb|EXB64659.1| Alanine aminotransferase 2 [Morus notabilis]
Length=537

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D FN+   + CN  EGAMY FP+I LP +AI+ A+ + +APD +YC
Sbjct  421  GILSSLARRAKTLEDAFNNLEGITCNKAEGAMYLFPRINLPQKAIKAAEAVKEAPDAFYC  480

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F+  FMD++ D
Sbjct  481  HRLLNATGIVFVPGSGFGQAPGTWHFRCTILPQEDKIPAIVSRLTDFHKGFMDEFRD  537



>ref|XP_005443445.1| PREDICTED: alanine aminotransferase 2-like [Falco cherrug]
Length=422

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L++   K +L +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA+  A+  G+
Sbjct  300  LFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAAAKAQGQ  359

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F  +F+ 
Sbjct  360  APDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSFYTKFVK  419

Query  215  QY  210
            +Y
Sbjct  420  EY  421



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP +AIE A+ +  APD +Y 
Sbjct  407  GILSSLARRAKALEDAFNGLEEVTCNKAEGAMYLFPRLHLPKKAIEAAKAVKAAPDAFYA  466

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   K F++ FM+++ D
Sbjct  467  RRLLDATGIVVVPGSGFGQVPGTWHVRCTILPHEDKIPAIISRLKAFHEAFMEEFRD  523



>gb|KHN39571.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=536

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -3

Query  557  KGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYY  378
            + ILESL +RA+ + D FN    V CN  EGAMY FPQIRL  +AI+ A     APD +Y
Sbjct  419  ENILESLARRAKTLEDAFNKLEGVTCNKAEGAMYLFPQIRLSQKAIKAAGDANTAPDNFY  478

Query  377  CLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            C +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+    +F+++FMD++ D
Sbjct  479  CKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPPEEKIPAIVTRLTEFHEKFMDEFRD  536



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + +    I +SL++RA ++++ FN+   V C   EGA+Y+FP++RLP  A++ A+     
Sbjct  355  YEQECDAIFQSLKRRAEMISNAFNALPGVSCQNVEGALYAFPRVRLPEAAVKEAEKKDMG  414

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD++YCL+LL ATGI  VPGSGFGQ+EG FH RTTILPAEE MP +++ F  F+ +F+ +
Sbjct  415  PDLFYCLELLHATGICAVPGSGFGQEEGTFHFRTTILPAEEQMPRVIDLFTSFHKDFLQR  474

Query  212  Y  210
            +
Sbjct  475  F  475



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 79/124 (64%), Gaps = 0/124 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+     GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP +AI+ A+    
Sbjct  421  LYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKAIKAAEAANT  480

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F+  FMD
Sbjct  481  APDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKSFMD  540

Query  215  QYED  204
            ++ D
Sbjct  541  EFRD  544



>ref|NP_001185380.1| alanine aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35307.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=553

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE A+    A
Sbjct  431  YMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTA  490

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD+
Sbjct  491  PDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDE  550

Query  212  YED  204
            + +
Sbjct  551  FRN  553



>gb|AAK59591.2| putative alanine aminotransferase [Arabidopsis thaliana]
Length=532

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE A+    A
Sbjct  410  YMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTA  469

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD+
Sbjct  470  PDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDE  529

Query  212  YED  204
            + +
Sbjct  530  FRN  532



>ref|NP_565040.2| alanine aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9LDV4.1|ALAT2_ARATH RecName: Full=Alanine aminotransferase 2, mitochondrial; Short=AtAlaAT2; 
Short=AtAlaATm; AltName: Full=Alanine-2-oxoglutarate 
aminotransferase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82781.1|AF275371_1 alanine aminotransferase [Arabidopsis thaliana]
 gb|AAG52580.1|AC016529_11 putative alanine aminotransferase; 79592-76658 [Arabidopsis thaliana]
 gb|AEE35305.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=540

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE A+    A
Sbjct  418  YMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTA  477

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD+
Sbjct  478  PDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDE  537

Query  212  YED  204
            + +
Sbjct  538  FRN  540



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 79/124 (64%), Gaps = 0/124 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+     GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP +AI+ A+    
Sbjct  421  LYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKAIKAAEAANT  480

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F+  FMD
Sbjct  481  APDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKSFMD  540

Query  215  QYED  204
            ++ D
Sbjct  541  EFRD  544



>ref|XP_005230442.1| PREDICTED: alanine aminotransferase 2-like [Falco peregrinus]
Length=436

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L++   K +L +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA+  A+  G+
Sbjct  314  LFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAAAKAQGQ  373

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F  +F+ 
Sbjct  374  APDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSFYTKFIK  433

Query  215  QY  210
            +Y
Sbjct  434  EY  435



>gb|KHN72520.1| Alanine aminotransferase 2 [Toxocara canis]
Length=462

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LW +   GIL+S+ +RAR++ + + +   + CN  +GAMY+F +I LP +AIE A+    
Sbjct  340  LWYKEKTGILKSMAERARMVKEAYGALEGIECNPVQGAMYAFAKINLPQKAIEEAKRRNV  399

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PD +Y +++LEATGI TVPGSGFGQKEG +H RTTILP    M  ++E FK F+D+FM 
Sbjct  400  QPDFFYGMEMLEATGICTVPGSGFGQKEGTYHFRTTILPQTNLMKEMLERFKPFHDKFMK  459

Query  215  QYE  207
            +Y+
Sbjct  460  KYK  462



>ref|XP_010428116.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Camelina 
sativa]
Length=549

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +AIE A+    A
Sbjct  427  YMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTA  486

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+E    F+  FMD+
Sbjct  487  PDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVERLTAFHKSFMDE  546

Query  212  YED  204
            + D
Sbjct  547  FRD  549



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A  +  APD +Y 
Sbjct  359  GILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYA  418

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  419  RRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  475



>ref|XP_008560719.1| PREDICTED: alanine aminotransferase 1 [Microplitis demolitor]
Length=577

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +++    +LESL +R+R++ D  NS      N   GAMY FP+I LPP+AIE A+  G+A
Sbjct  456  FIKEKTAVLESLAERSRLVVDTLNSIPGFKSNPAMGAMYVFPRINLPPKAIEAAKAAGQA  515

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+Y  KLLE+TGI  +PGSGFGQK G +H+RTTILP +E +  ++ S K+F+ +FM +
Sbjct  516  PDVFYAFKLLESTGICVIPGSGFGQKPGTYHIRTTILPQKEMIKTMLNSLKEFHLKFMKE  575

Query  212  Y  210
            Y
Sbjct  576  Y  576



>gb|KGB32667.1| Alanine aminotransferase 2 [Schistosoma haematobium]
Length=493

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+++    +L +L+ +A I     NS  N+ CN  +GAMY+FP+I LPP+AI+ A+  G+
Sbjct  371  LFVKERDDVLSALKDKADITYSALNSMPNMSCNPVQGAMYAFPRIHLPPKAIQEAKRRGE  430

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +YCL+LLE  GI  VPGSGFGQ+EG +H RTTILP+ E M  +M+  ++F+  FM 
Sbjct  431  APDFFYCLQLLEEKGICVVPGSGFGQQEGTYHFRTTILPSVEKMKYVMKQVEEFHISFMK  490

Query  215  QY  210
            +Y
Sbjct  491  KY  492



>gb|EHJ78976.1| putative Alanine aminotransferase [Danaus plexippus]
Length=477

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LWLR    +LESL  RAR++++  N+     CN  +GA+Y+FP+I LPP+A+  A+   +
Sbjct  355  LWLREKTAVLESLNARARLVSESLNAIEGYKCNVVQGALYAFPRINLPPKAVAAAEEANQ  414

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PDV+Y  +LLE TGI  VPGSGFGQ  G +H RTTILP  + +  I+E+ + F+  F+ 
Sbjct  415  LPDVFYAYRLLEETGICVVPGSGFGQVPGTYHYRTTILPEYDQLRTILETIRTFHQRFIA  474

Query  215  QY  210
            QY
Sbjct  475  QY  476



>ref|XP_002166762.2| PREDICTED: alanine aminotransferase 2-like [Hydra vulgaris]
Length=444

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+++    +L SL+KRAR++ +  N    V CN  +GAMY+FPQI LP +AI+ A+ L +
Sbjct  322  LFVQEKFSVLSSLKKRARLVYETLNKIEGVTCNEVQGAMYAFPQIHLPQKAIDHAKSLDQ  381

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            A D +YC++ LE TGI  VPGSGF QKEG +H R TILP E+ +   +E FK+F+ +F++
Sbjct  382  AADFFYCMQFLEQTGICVVPGSGFRQKEGTYHFRLTILPPEDQLKVFLEKFKEFHIKFLE  441

Query  215  QYE  207
             Y+
Sbjct  442  IYK  444



>gb|KFM79416.1| Alanine aminotransferase 2, partial [Stegodyphus mimosarum]
Length=313

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+++    +L+SL++RA ++   FNS + + CN   GAMY+FPQI LP +AIE A+ LG+
Sbjct  191  LYIKEKTAVLQSLKERAVLVAKTFNSMKGIKCNEVAGAMYAFPQITLPKKAIEKAKSLGQ  250

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +Y ++LLE TGI  VPGSGFGQ  G  H RTTILP  E +  +++  +++++ F+ 
Sbjct  251  APDFFYAMQLLENTGICVVPGSGFGQVPGTHHFRTTILPQTEKLKVMLKRLEEYHENFLA  310

Query  215  QY  210
            +Y
Sbjct  311  EY  312



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -3

Query  551  ILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCL  372
            IL SL  RA+ + +  N    V CN  EGAMY FPQIRLP +AIE A+    APD +YC 
Sbjct  416  ILSSLATRAKSLEEALNKLEGVTCNKAEGAMYLFPQIRLPKKAIEAAEAENTAPDAFYCK  475

Query  371  KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+++FMD++ D
Sbjct  476  RLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTEFHEKFMDEFRD  531



>gb|AHJ25706.1| GPT2, partial [Panthera tigris altaica]
Length=224

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+ R  + +L +L K+A++  D FN    + CN  +GAMY+FP+I +P +A+E AQ    
Sbjct  102  LFHREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPSKAVEAAQAHKM  161

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD++YC+KLLE TGI  VPGSGFGQ+EG +H R TILP  E +  +++  K F+ +F++
Sbjct  162  APDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHIKFLE  221

Query  215  QY  210
            +Y
Sbjct  222  KY  223



>ref|XP_002681562.1| alanine aminotransferase [Naegleria gruberi]
 gb|EFC48818.1| alanine aminotransferase [Naegleria gruberi]
Length=492

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++     IL SL++RA  +    NS   V C   EGAMY+FPQI LP +AI+ A+ +G A
Sbjct  371  YVAERDNILNSLKRRAEKLVKMLNSLEGVSCQPVEGAMYAFPQITLPEKAIQKAKEMGVA  430

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD+ Y L+LLE TGI  VPGSGF QK G +H RTTILP+EE +  ++++  KF+D+FM Q
Sbjct  431  PDLMYVLELLEETGICVVPGSGFQQKPGTYHFRTTILPSEEQIEGVVQTLAKFHDKFMKQ  490

Query  212  YE  207
            Y+
Sbjct  491  YK  492



>emb|CCD81366.1| putative alanine aminotransferase [Schistosoma mansoni]
Length=481

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+++    +L +L+ +A I     NS  N+ CN  +GAMY+FP+I LPP+AI+ A+  G+
Sbjct  359  LFVKERDDVLSALKDKADITYSALNSMPNMSCNPVQGAMYAFPRIHLPPKAIQEAKRRGE  418

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +YCL+LLE  GI  VPGSGFGQ+EG +H RTTILP+ E M  +M+  ++F+  FM 
Sbjct  419  APDFFYCLQLLEEKGICVVPGSGFGQQEGTYHFRTTILPSIEKMKYVMKQIEEFHISFMK  478

Query  215  QY  210
            +Y
Sbjct  479  KY  480



>gb|AIT69935.1| alanine transaminase [Dumontia simplex]
Length=497

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+      I ESLR++A  M+DG N+   V CN +EGAMY FP+I +PP A+  A+ LG 
Sbjct  374  LYNSEVTNIYESLRRKAIAMSDGLNAFEGVRCNPSEGAMYLFPRITIPPAAVTEAKNLGL  433

Query  395  A-PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM  219
            A  DV YCL++LEATGI  VPGSGFGQ++G +H RTT LP+E+++P +++   +F+ +FM
Sbjct  434  ASADVMYCLEMLEATGICVVPGSGFGQRKGTYHFRTTFLPSEKEIPGVIDRMHRFHQQFM  493

Query  218  DQY  210
             +Y
Sbjct  494  LKY  496



>ref|XP_008462239.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
melo]
Length=488

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ A+    APD +YC
Sbjct  372  GILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKAAEAANTAPDTFYC  431

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F+  FM++Y D
Sbjct  432  RQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDFHKAFMNEYRD  488



>gb|KHG30536.1| Alanine aminotransferase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=482

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ A+ +  A
Sbjct  360  YIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKAAEEVKTA  419

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F+  FMD+
Sbjct  420  PDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDE  479

Query  212  YED  204
            + D
Sbjct  480  FRD  482



>gb|KFB49063.1| AGAP000901-PA-like protein [Anopheles sinensis]
Length=546

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+ +    +LESLR+RA ++   FNS     CN  +GAMY+FPQIRLPP+A+E A+  GK
Sbjct  424  LFAKEKAAVLESLRERAELVARTFNSIEGFSCNPVQGAMYAFPQIRLPPKALEAAKADGK  483

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
              D +Y  +LLE TGI  VPGSGFGQ+ G +H RTTILP  E +  ++  FK F+++F+ 
Sbjct  484  PADTFYAFQLLEETGICIVPGSGFGQRPGTYHFRTTILPQPEKLKEMLGLFKSFHEKFLA  543

Query  215  QYE  207
            +Y+
Sbjct  544  KYK  546



>ref|XP_006634237.1| PREDICTED: alanine aminotransferase 2-like [Lepisosteus oculatus]
Length=489

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +++    +L SL +RAR++    NS   + CN  +GAMYSFP+I +P RAI+ AQ +G+A
Sbjct  368  FIKERTAVLSSLAERARLVEQLLNSIPGISCNPVQGAMYSFPRINIPERAIKEAQAMGQA  427

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD++YCL+LLE TGI  VPGSGFGQK+G +H R TILP  E +  ++   K+F+  F  +
Sbjct  428  PDMFYCLRLLEETGICLVPGSGFGQKDGTYHFRMTILPPTEKLEVLLSKLKEFHQRFTRE  487

Query  212  Y  210
            Y
Sbjct  488  Y  488



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A  +  APD +Y 
Sbjct  402  GILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYA  461

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  462  RRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  518



>ref|XP_007135364.1| hypothetical protein PHAVU_010G123200g [Phaseolus vulgaris]
 gb|ESW07358.1| hypothetical protein PHAVU_010G123200g [Phaseolus vulgaris]
Length=541

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++     ILESL +RA+ + D FN    V CN  EGAMY FPQIRL  +AI+ A     +
Sbjct  419  YMAEKGNILESLARRAKTLEDAFNKLEGVTCNKAEGAMYLFPQIRLSQKAIKAAGDENTS  478

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+    +F+++FMD+
Sbjct  479  PDNFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRLTEFHEKFMDE  538

Query  212  YED  204
            + D
Sbjct  539  FRD  541



>gb|KDO24164.1| hypothetical protein SPRG_10592 [Saprolegnia parasitica CBS 223.65]
Length=489

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L++    GIL SL++RA  +   FN    V CN  EGAMY+FP+I +P +A+  A   G 
Sbjct  367  LYVAQRDGILSSLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKAVAEATKRGV  426

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD +Y + LL+ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E   KF+ EFMD
Sbjct  427  APDAFYAMALLDATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKTAKFHAEFMD  486

Query  215  QY  210
             Y
Sbjct  487  LY  488



>ref|XP_010235387.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Brachypodium 
distachyon]
Length=514

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ  G +PD YY 
Sbjct  337  GILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAAGASPDAYYA  396

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
            L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+Y +
Sbjct  397  LRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRFKEFHEKFMDEYRE  453



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP +AIE A+ +  APD +Y 
Sbjct  414  GILSSLARRAKALEDAFNGLVGVTCNKAEGAMYLFPRLHLPQKAIEAAKAVNAAPDAFYA  473

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F++ FM ++ D
Sbjct  474  RRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIARLKAFHESFMGEFRD  530



>gb|ADE77246.1| unknown [Picea sitchensis]
Length=329

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 80/124 (65%), Gaps = 0/124 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            ++     GIL SL +RA+ + D  N    V CN  EGAMY FP+I LP +AI+ A+ +  
Sbjct  206  MFFAERDGILSSLARRAKTLVDALNQLEGVTCNEAEGAMYVFPRIHLPQQAIKAAEAVNM  265

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PD +Y  +LLEATGI TVPGSGFGQ  G +H R+TILP E+ +P I+     F+ +FM+
Sbjct  266  VPDAFYSQRLLEATGIVTVPGSGFGQVPGTWHFRSTILPPEDKIPTIVSRMTTFHQKFME  325

Query  215  QYED  204
            ++ D
Sbjct  326  EFHD  329



>gb|ETN63742.1| alanine aminotransferase [Anopheles darlingi]
Length=489

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R  + +L+SLR RA ++ + FNS     CN  +GAMY+FPQIRLPP+A+E A+  GK 
Sbjct  368  FTREKQNVLDSLRDRAELVANTFNSIEGFSCNPVQGAMYAFPQIRLPPKALEAAKKDGKP  427

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             D +Y  +LLE TGI  VPGSGFGQ+ G +H RTTILP  E +  ++  FK F+++F+ +
Sbjct  428  ADTFYAFRLLEETGICIVPGSGFGQRPGTYHFRTTILPQTEKLKEMLGLFKTFHEKFLQK  487

Query  212  YE  207
            Y+
Sbjct  488  YK  489



>gb|EHJ74142.1| putative alanine aminotransferase [Danaus plexippus]
Length=513

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            LW++    IL SL+ RA+++ + FN+     CN  +GAMY+FP+I LPP+AI+ A+    
Sbjct  391  LWIKEKTDILTSLKDRAKLIAETFNTFEGFKCNVVQGAMYAFPRITLPPKAIQAAKEKNM  450

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APDV+Y  +LLE TG+  VPGSGFGQ  G FH RTTILP  + +  ++E+F+ F+ +F  
Sbjct  451  APDVFYAFRLLEETGVCIVPGSGFGQAPGTFHFRTTILPQPDLLNTMLENFRNFHKKFTQ  510

Query  215  QY  210
            +Y
Sbjct  511  EY  512



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + R  K + ESL++R++ +    NS +N+ C    GAMY+FP I LPP A++ A+  G  
Sbjct  352  YEREMKDLFESLKRRSQKLHAALNSMKNITCTEIGGAMYAFPSIHLPPSAVQAAKEAGMT  411

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +Y ++LL+ATGI  VPGSGF QK+G FH RTT LP+E  M  +++  +KFN  FMD+
Sbjct  412  PDTFYAVELLDATGICVVPGSGFRQKQGSFHFRTTFLPSESKMDDVIDKLRKFNQSFMDK  471

Query  212  Y  210
            Y
Sbjct  472  Y  472



>ref|XP_008460348.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Cucumis melo]
Length=513

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC
Sbjct  397  GILSSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYC  456

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  457  RRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  513



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC
Sbjct  412  GILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYC  471

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  472  RRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  528



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC
Sbjct  419  GILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYC  478

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  479  RRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  535



>ref|XP_004166923.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like, partial 
[Cucumis sativus]
Length=493

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC
Sbjct  377  GILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYC  436

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  437  RRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  493



>ref|XP_010415979.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +AIE A+    A
Sbjct  426  YMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRISLPQKAIEAAEAEKTA  485

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI++    F+  FMD+
Sbjct  486  PDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVDRLTAFHKSFMDE  545

Query  212  YED  204
            + D
Sbjct  546  FRD  548



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC
Sbjct  414  GILSSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYC  473

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  474  RRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  530



>ref|XP_001660470.1| AAEL009872-PA [Aedes aegypti]
 gb|EAT38206.1| AAEL009872-PA [Aedes aegypti]
Length=544

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +++    +L SL+ RA ++   FNS     CN  +GAMY FPQIRLP +AIE A+  G+A
Sbjct  423  FMKEKNAVLASLKVRAEMVASTFNSIEGFSCNPVQGAMYCFPQIRLPEKAIEAAKKAGQA  482

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PDV+Y  +LLE TGI  VPGSGFGQ+ G +H RTTILP    +  +++ F+ F+++F+ Q
Sbjct  483  PDVFYAFQLLEQTGICIVPGSGFGQRPGTYHFRTTILPQPAKLKEMLDMFRAFHEKFLKQ  542

Query  212  YE  207
            Y+
Sbjct  543  YK  544



>gb|ELK29365.1| Alanine aminotransferase 2 [Myotis davidii]
Length=416

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            +LR  + +L +L ++A++  D FN    + CN  +GAMY+FP+I LPPRA+E AQ    A
Sbjct  295  FLREKESVLSNLAEKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIVLPPRAVEAAQAHNMA  354

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD++YC+KLLE TG+  VPGSGFGQ+EG +H R TILP  E +  +++  K F+ +F+ +
Sbjct  355  PDMFYCMKLLEETGVCVVPGSGFGQREGTYHFRMTILPPMEKLKTVLQRVKDFHIQFLGE  414

Query  212  Y  210
            +
Sbjct  415  F  415



>gb|AHW58022.1| alanine aminotransferase 1 [Sogatella furcifera]
Length=540

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+ +  + +L+SL  RA+++ D FNS     CN  +GAMY+FPQI+LP +AIE A+ L +
Sbjct  418  LFKKEKQAVLDSLAVRAKMVADTFNSFDGFSCNPVQGAMYAFPQIKLPQKAIEKAKSLKQ  477

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             P V+Y  +LLE TGI  VPG+GFGQK G +H RTTILP  E + +++  FK+F++ FM 
Sbjct  478  CPSVFYAFQLLENTGICIVPGAGFGQKPGTYHFRTTILPQPEKLKSMLLKFKEFHESFMK  537

Query  215  QY  210
            +Y
Sbjct  538  EY  539



>ref|XP_001660471.1| AAEL009875-PA [Aedes aegypti]
 gb|EAT38207.1| AAEL009875-PA [Aedes aegypti]
Length=422

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+++    +L SL++RA+++ D FNS     CN  +GAMY+FP+I+LP +AI+ A+  G+
Sbjct  300  LFIKEKNAVLTSLKERAKLVADAFNSFEGFSCNPVQGAMYAFPRIQLPEKAIQAARKAGQ  359

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PDV+Y  +LLE TGI  VPGSGFGQK+G +H+R+TILP  E +  +++  + +++ F+ 
Sbjct  360  LPDVFYVYQLLEQTGICVVPGSGFGQKDGTYHIRSTILPQPEKLKHMLDVLRLYHENFLR  419

Query  215  QYE  207
            QY+
Sbjct  420  QYQ  422



>ref|XP_010235383.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Brachypodium 
distachyon]
Length=599

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            ++    GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ  G +
Sbjct  416  FMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAAGAS  475

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
            PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+
Sbjct  476  PDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRFKEFHEKFMDE  535

Query  212  YED  204
            Y +
Sbjct  536  YRE  538



>ref|XP_009059448.1| hypothetical protein LOTGIDRAFT_192553, partial [Lottia gigantea]
 gb|ESO89980.1| hypothetical protein LOTGIDRAFT_192553, partial [Lottia gigantea]
Length=484

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+ +    +L+SL ++A ++TD FNS   + CN  +GAMY+FP+I LP +AIE A+   K
Sbjct  363  LFKKEKDEVLKSLAEKATLVTDTFNSIEGIKCNQVQGAMYAFPRIFLPDKAIEEAKKNDK  422

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            +PD +YC +LLE TGI TVPGSGF Q++G FH RTTILP  + + ++++ FK+F+  FM 
Sbjct  423  SPDAFYCFQLLEETGICTVPGSGFRQRDGTFHFRTTILPPIDTLKSVLKDFKEFHVNFMK  482

Query  215  QY  210
            +Y
Sbjct  483  KY  484



>gb|KDR12685.1| Alanine aminotransferase 2 [Zootermopsis nevadensis]
Length=538

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -3

Query  572  WLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKA  393
            + +  K +L SL +RA+++ + FNS   V CN  +GAMY+FP++ LP +AIE A+ LG+ 
Sbjct  417  FTKEKKAVLNSLAERAKMVAETFNSIEGVSCNEVQGAMYAFPKLDLPKKAIEKAESLGQC  476

Query  392  PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQ  213
             DV+Y  +LLE TGI  VPGSGFGQK G FH RTTILP  + +  ++  FK+F+ +F+ Q
Sbjct  477  ADVFYAFQLLENTGICIVPGSGFGQKAGTFHFRTTILPQPDKLKIMLNKFKEFHLKFLTQ  536

Query  212  YE  207
            Y+
Sbjct  537  YK  538



>ref|XP_003228933.1| PREDICTED: alanine aminotransferase 1-like [Anolis carolinensis]
Length=506

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+ +  + IL +L K+A +    FN+   + CN  +GAMY+FP+++LPPRA++ A+  G+
Sbjct  367  LFSQEKQAILSTLAKKAHLTEQTFNNTPGMHCNPVQGAMYAFPRMQLPPRAVQEAKAQGQ  426

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
            APD+++CL+LLE TGI  VPGSGFGQKEG FH R TILP  E +  +++   +F+ +F  
Sbjct  427  APDMFFCLRLLEETGICVVPGSGFGQKEGTFHFRMTILPPMEKLEVVLQKVSQFHAKFTQ  486

Query  215  QYEDHRGY  192
            +Y   + +
Sbjct  487  EYSQPQNH  494



>ref|XP_001660472.1| AAEL009875-PB [Aedes aegypti]
 gb|EAT38208.1| AAEL009875-PB [Aedes aegypti]
Length=463

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  575  LWLRNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  396
            L+++    +L SL++RA+++ D FNS     CN  +GAMY+FP+I+LP +AI+ A+  G+
Sbjct  341  LFIKEKNAVLTSLKERAKLVADAFNSFEGFSCNPVQGAMYAFPRIQLPEKAIQAARKAGQ  400

Query  395  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  216
             PDV+Y  +LLE TGI  VPGSGFGQK+G +H+R+TILP  E +  +++  + +++ F+ 
Sbjct  401  LPDVFYVYQLLEQTGICVVPGSGFGQKDGTYHIRSTILPQPEKLKHMLDVLRLYHENFLR  460

Query  215  QYE  207
            QY+
Sbjct  461  QYQ  463



>ref|XP_002826439.1| PREDICTED: alanine aminotransferase 2 [Pongo abelii]
Length=201

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = -3

Query  566  RNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPD  387
            R  + +L +L K+A++  D FN    + CN  +GAMY+FP+I +P +A+E AQ    APD
Sbjct  82   REKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPD  141

Query  386  VYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
            ++YC+KLLE TGI  VPGSGFGQ+EG +H R TILP  E +  +++  K F+  F+++Y
Sbjct  142  MFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKY  200



>emb|CDQ55985.1| unnamed protein product [Oncorhynchus mykiss]
Length=177

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = -3

Query  566  RNSKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPD  387
            +    +L +L ++A++     N    + CN  +GAMY+FP+I +PPRA+E A+ LG +PD
Sbjct  51   KEKSAVLGALAEKAQVTEQTLNMVPGIKCNPVQGAMYAFPRIFIPPRAVEEAKSLGMSPD  110

Query  386  VYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  210
            + YCL+LLE TGI  VPGSGFGQ+EG +H R TILP  E +  ++E  + F+ +F+ +Y
Sbjct  111  MMYCLRLLEETGICLVPGSGFGQREGTYHFRMTILPTTEKLKVLLEKLRDFHIKFLKEY  169



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ A+     PD +YC
Sbjct  372  GILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKAAEAANTVPDTFYC  431

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F+  FM++Y D
Sbjct  432  RQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDFHKAFMNEYRD  488



>ref|XP_011036545.1| PREDICTED: alanine aminotransferase 2-like [Populus euphratica]
Length=533

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -3

Query  554  GILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYC  375
            GIL SL +RA+ +   FN+   V CN  EGAMY FP IRLP +AI+TA+    APD +YC
Sbjct  417  GILSSLARRAKTLEVAFNNLEGVTCNKAEGAMYLFPCIRLPEKAIKTAEAAKTAPDNFYC  476

Query  374  LKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  204
             +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++    +F+  FMD++ D
Sbjct  477  RRLLNATGIVFVPGSGFGQLPGTWHFRCTILPQEDKIPAVVSRLTEFHKSFMDEFRD  533



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160