BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051P06

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGY49286.1|  putative membrane bound NAC transcription factor 1      281   9e-88   Nicotiana benthamiana
ref|NP_001274765.1|  uncharacterized LOC102593794                       280   4e-87   Solanum tuberosum [potatoes]
ref|XP_009608176.1|  PREDICTED: uncharacterized protein LOC104102223    280   4e-87   Nicotiana tomentosiformis
ref|XP_009759914.1|  PREDICTED: uncharacterized protein LOC104212382    280   6e-87   Nicotiana sylvestris
ref|XP_010318064.1|  PREDICTED: uncharacterized protein LOC101253566    279   1e-86   
gb|AAM47025.1|  nam-like protein 1                                      275   1e-85   Petunia x hybrida [garden petunia]
ref|XP_011075874.1|  PREDICTED: NAC domain-containing protein 45        262   2e-80   Sesamum indicum [beniseed]
ref|XP_009760821.1|  PREDICTED: NAC domain-containing protein 74-...    253   4e-79   Nicotiana sylvestris
ref|XP_006347316.1|  PREDICTED: uncharacterized protein LOC102605066    258   2e-78   Solanum tuberosum [potatoes]
ref|XP_004241429.1|  PREDICTED: uncharacterized protein LOC101257973    255   6e-78   
ref|XP_009760820.1|  PREDICTED: uncharacterized protein LOC104213...    256   6e-78   Nicotiana sylvestris
ref|XP_009596681.1|  PREDICTED: NAC domain-containing protein 74-...    255   1e-77   Nicotiana tomentosiformis
gb|EYU45332.1|  hypothetical protein MIMGU_mgv1a003123mg                253   7e-77   Erythranthe guttata [common monkey flower]
gb|EPS67213.1|  hypothetical protein M569_07559                         251   4e-75   Genlisea aurea
emb|CDP04976.1|  unnamed protein product                                248   6e-75   Coffea canephora [robusta coffee]
gb|AGT96630.1|  NAC transcription factor                                229   1e-70   Suaeda liaotungensis
gb|AGV29473.1|  putative NAC domain class transcription factor          226   4e-67   Tamarix hispida
ref|XP_002317040.2|  hypothetical protein POPTR_0011s15230g             227   1e-66   
ref|XP_006377880.1|  hypothetical protein POPTR_0011s15230g             226   2e-66   
ref|XP_010671303.1|  PREDICTED: NAC domain-containing protein 86-...    224   3e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010671302.1|  PREDICTED: uncharacterized protein LOC104888...    224   8e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|AGL39710.1|  NAC transcription factor 054                            221   2e-65   Jatropha curcas
emb|CAN73478.1|  hypothetical protein VITISV_037597                     209   9e-65   Vitis vinifera
ref|XP_010045303.1|  PREDICTED: uncharacterized protein LOC104434047    220   1e-64   Eucalyptus grandis [rose gum]
gb|AGV29497.1|  putative NAC domain class transcription factor          209   3e-64   Tamarix hispida
ref|XP_002521312.1|  transcription factor, putative                     219   4e-64   
ref|XP_003615517.1|  NAC domain protein                                 219   4e-64   Medicago truncatula
ref|XP_006377878.1|  hypothetical protein POPTR_0011s15230g             220   4e-64   
ref|XP_006377879.1|  hypothetical protein POPTR_0011s15230g             220   4e-64   
ref|XP_006441281.1|  hypothetical protein CICLE_v10019368mg             216   1e-63   
ref|XP_006441278.1|  hypothetical protein CICLE_v10019368mg             216   1e-63   
gb|AIA57510.1|  NAC domain-containing protein                           215   2e-63   Boehmeria nivea [Chinese silk-plant]
ref|NP_001280863.1|  uncharacterized LOC103439966                       216   3e-63   Malus domestica [apple tree]
ref|XP_003615518.1|  NAC domain protein                                 212   3e-63   
ref|XP_006441280.1|  hypothetical protein CICLE_v10019368mg             217   3e-63   Citrus clementina [clementine]
ref|XP_006441279.1|  hypothetical protein CICLE_v10019368mg             217   3e-63   Citrus clementina [clementine]
gb|KCW72635.1|  hypothetical protein EUGRSUZ_E01095                     217   3e-63   Eucalyptus grandis [rose gum]
gb|KDO44488.1|  hypothetical protein CISIN_1g007393mg                   216   4e-63   Citrus sinensis [apfelsine]
ref|XP_009361256.1|  PREDICTED: NAC domain-containing protein 74-...    215   4e-63   Pyrus x bretschneideri [bai li]
gb|KDO44489.1|  hypothetical protein CISIN_1g007393mg                   216   4e-63   Citrus sinensis [apfelsine]
ref|XP_006478081.1|  PREDICTED: NAC domain-containing protein 69-...    216   5e-63   Citrus sinensis [apfelsine]
ref|XP_006478082.1|  PREDICTED: NAC domain-containing protein 69-...    216   5e-63   Citrus sinensis [apfelsine]
ref|XP_006478080.1|  PREDICTED: NAC domain-containing protein 69-...    216   5e-63   Citrus sinensis [apfelsine]
ref|XP_008381552.1|  PREDICTED: uncharacterized protein LOC103444404    215   7e-63   Malus domestica [apple tree]
ref|XP_010056056.1|  PREDICTED: uncharacterized protein LOC104444143    216   7e-63   Eucalyptus grandis [rose gum]
gb|KJB52429.1|  hypothetical protein B456_008G261400                    218   7e-63   Gossypium raimondii
ref|NP_001280864.1|  uncharacterized LOC103438687                       218   2e-62   Malus domestica [apple tree]
ref|XP_002321956.2|  hypothetical protein POPTR_0015s00640g             214   2e-62   
ref|XP_010103069.1|  NAC domain-containing protein 78                   214   2e-62   Morus notabilis
ref|XP_002300524.2|  hypothetical protein POPTR_0001s45700g             214   3e-62   
ref|XP_007039234.1|  NAC domain class transcription factor, putat...    211   3e-62   
gb|AGL39711.1|  NAC transcription factor 055                            214   4e-62   Jatropha curcas
ref|XP_011004351.1|  PREDICTED: uncharacterized protein LOC105110...    215   4e-62   Populus euphratica
ref|XP_008462914.1|  PREDICTED: NAC domain-containing protein 74        213   4e-62   Cucumis melo [Oriental melon]
ref|XP_011004356.1|  PREDICTED: uncharacterized protein LOC105110...    214   4e-62   Populus euphratica
ref|XP_009351898.1|  PREDICTED: uncharacterized protein LOC103943342    213   4e-62   Pyrus x bretschneideri [bai li]
ref|XP_007039233.1|  NAC domain class transcription factor, putat...    213   4e-62   
ref|XP_011004352.1|  PREDICTED: uncharacterized protein LOC105110...    214   6e-62   Populus euphratica
ref|XP_011038026.1|  PREDICTED: uncharacterized protein LOC105135051    214   6e-62   Populus euphratica
ref|XP_011004350.1|  PREDICTED: uncharacterized protein LOC105110...    215   6e-62   Populus euphratica
ref|XP_011004357.1|  PREDICTED: uncharacterized protein LOC105110...    214   6e-62   Populus euphratica
ref|XP_011004354.1|  PREDICTED: uncharacterized protein LOC105110...    214   6e-62   Populus euphratica
ref|XP_011004355.1|  PREDICTED: uncharacterized protein LOC105110...    214   7e-62   Populus euphratica
gb|AFK41148.1|  unknown                                                 214   7e-62   Medicago truncatula
ref|XP_008234624.1|  PREDICTED: NAC domain-containing protein 7-like    212   7e-62   Prunus mume [ume]
ref|XP_007039299.1|  NAC domain-containing protein 78, putative i...    213   1e-61   
ref|XP_008245853.1|  PREDICTED: uncharacterized protein LOC103344010    215   1e-61   Prunus mume [ume]
ref|XP_004156529.1|  PREDICTED: NAC domain-containing protein 74-...    212   2e-61   
ref|XP_004137298.1|  PREDICTED: NAC domain-containing protein 74-...    212   2e-61   
ref|XP_007039300.1|  NAC domain-containing protein 78, putative i...    212   3e-61   
ref|XP_002518952.1|  transcription factor, putative                     211   4e-61   
ref|XP_007210371.1|  hypothetical protein PRUPE_ppa001291mg             214   5e-61   Prunus persica
emb|CAN73792.1|  hypothetical protein VITISV_034893                     213   5e-61   Vitis vinifera
ref|XP_010662939.1|  PREDICTED: NAC domain-containing protein 77        210   5e-61   Vitis vinifera
ref|XP_011003272.1|  PREDICTED: NAC domain-containing protein 45-...    210   6e-61   Populus euphratica
gb|AES72662.2|  M20/M25/M40 family peptidase                            203   7e-61   Medicago truncatula
ref|XP_008360722.1|  PREDICTED: uncharacterized protein LOC103424418    213   7e-61   Malus domestica [apple tree]
ref|XP_007136363.1|  hypothetical protein PHAVU_009G039000g             210   7e-61   Phaseolus vulgaris [French bean]
ref|XP_011003273.1|  PREDICTED: NAC domain-containing protein 45-...    210   8e-61   Populus euphratica
ref|XP_011470170.1|  PREDICTED: NAC domain-containing protein 86        209   1e-60   Fragaria vesca subsp. vesca
ref|XP_010525539.1|  PREDICTED: NAC domain-containing protein 67-...    207   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_009360232.1|  PREDICTED: uncharacterized protein LOC103950728    213   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_010104895.1|  NAC domain-containing protein 78                   212   1e-60   
gb|KHG02383.1|  NAC domain-containing 74                                213   1e-60   Gossypium arboreum [tree cotton]
gb|AIA57515.1|  NAC domain-containing protein                           210   1e-60   Boehmeria nivea [Chinese silk-plant]
ref|XP_011070419.1|  PREDICTED: NAC domain-containing protein 4-like    209   2e-60   Sesamum indicum [beniseed]
gb|KJB52428.1|  hypothetical protein B456_008G261400                    212   2e-60   Gossypium raimondii
ref|XP_010660382.1|  PREDICTED: uncharacterized protein LOC104877280    209   2e-60   Vitis vinifera
ref|NP_001276287.1|  NAC domain protein                                 209   2e-60   Glycine max [soybeans]
gb|KJB52425.1|  hypothetical protein B456_008G261400                    210   2e-60   Gossypium raimondii
gb|KJB52427.1|  hypothetical protein B456_008G261400                    211   3e-60   Gossypium raimondii
gb|KJB52426.1|  hypothetical protein B456_008G261400                    211   3e-60   Gossypium raimondii
gb|KDO76787.1|  hypothetical protein CISIN_1g009388mg                   207   3e-60   Citrus sinensis [apfelsine]
gb|KJB39512.1|  hypothetical protein B456_007G017500                    204   3e-60   Gossypium raimondii
gb|KJB18878.1|  hypothetical protein B456_003G073300                    207   4e-60   Gossypium raimondii
ref|XP_010519577.1|  PREDICTED: NAC domain-containing protein 67-...    206   4e-60   Tarenaya hassleriana [spider flower]
gb|KHN46203.1|  NAC domain-containing protein 78                        208   4e-60   Glycine soja [wild soybean]
ref|XP_007141360.1|  hypothetical protein PHAVU_008G189100g             207   5e-60   Phaseolus vulgaris [French bean]
ref|XP_006596412.1|  PREDICTED: NAC domain-containing protein 12-...    208   5e-60   Glycine max [soybeans]
ref|XP_003602412.1|  NAC domain-containing protein                      208   5e-60   Medicago truncatula
gb|KHN40025.1|  NAC domain-containing protein 78                        207   6e-60   Glycine soja [wild soybean]
ref|XP_003602413.1|  NAC domain-containing protein                      208   6e-60   
ref|XP_010529684.1|  PREDICTED: NAC domain-containing protein 86        208   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_010533527.1|  PREDICTED: uncharacterized protein LOC104809290    208   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_002317831.2|  hypothetical protein POPTR_0012s00760g             207   7e-60   
ref|XP_006306958.1|  hypothetical protein CARUB_v10008529mg             208   7e-60   Capsella rubella
ref|XP_006306957.1|  hypothetical protein CARUB_v10008529mg             208   7e-60   Capsella rubella
ref|XP_006306959.1|  hypothetical protein CARUB_v10008529mg             208   8e-60   Capsella rubella
ref|XP_004514021.1|  PREDICTED: uncharacterized protein LOC101501154    207   8e-60   Cicer arietinum [garbanzo]
ref|XP_004309509.1|  PREDICTED: uncharacterized protein LOC101295292    209   8e-60   Fragaria vesca subsp. vesca
ref|XP_010499854.1|  PREDICTED: NAC domain-containing protein 86-...    208   8e-60   
ref|XP_010499852.1|  PREDICTED: NAC domain-containing protein 86-...    208   9e-60   
ref|XP_010499853.1|  PREDICTED: NAC domain-containing protein 86-...    208   1e-59   Camelina sativa [gold-of-pleasure]
gb|KJB24042.1|  hypothetical protein B456_004G125900                    204   1e-59   Gossypium raimondii
ref|XP_004502779.1|  PREDICTED: uncharacterized protein LOC101492664    207   1e-59   Cicer arietinum [garbanzo]
ref|XP_006439176.1|  hypothetical protein CICLE_v10019282mg             207   1e-59   Citrus clementina [clementine]
gb|KFK45050.1|  hypothetical protein AALP_AA1G337500                    207   1e-59   Arabis alpina [alpine rockcress]
gb|KJB37428.1|  hypothetical protein B456_006G203800                    202   1e-59   Gossypium raimondii
ref|XP_006287681.1|  hypothetical protein CARUB_v10000892mg             202   2e-59   
gb|KFK45049.1|  hypothetical protein AALP_AA1G337500                    207   2e-59   Arabis alpina [alpine rockcress]
ref|XP_006476249.1|  PREDICTED: uncharacterized protein LOC102621962    207   2e-59   Citrus sinensis [apfelsine]
gb|AAF31292.1|AC006424_21  CDS                                          206   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KHF99264.1|  NAC domain-containing 78 -like protein                  207   2e-59   Gossypium arboreum [tree cotton]
gb|KJB18876.1|  hypothetical protein B456_003G073300                    207   2e-59   Gossypium raimondii
gb|KJB39511.1|  hypothetical protein B456_007G017500                    205   2e-59   Gossypium raimondii
gb|KHG05224.1|  NAC domain-containing 78 -like protein                  205   2e-59   Gossypium arboreum [tree cotton]
ref|XP_011081340.1|  PREDICTED: uncharacterized protein LOC105164...    206   2e-59   
ref|XP_011081339.1|  PREDICTED: uncharacterized protein LOC105164...    206   2e-59   Sesamum indicum [beniseed]
gb|KJB24041.1|  hypothetical protein B456_004G125900                    204   2e-59   Gossypium raimondii
ref|XP_006287682.1|  hypothetical protein CARUB_v10000892mg             203   2e-59   Capsella rubella
gb|KHG07501.1|  NAC domain-containing 78 -like protein                  206   2e-59   Gossypium arboreum [tree cotton]
ref|XP_010241065.1|  PREDICTED: uncharacterized protein LOC104585...    206   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010241066.1|  PREDICTED: uncharacterized protein LOC104585...    206   2e-59   
ref|XP_003602411.1|  IAA-amino acid hydrolase ILR1-like protein         202   2e-59   
gb|AIU39715.1|  NAC transcription factor 14                             207   3e-59   Brassica napus [oilseed rape]
gb|KFK27735.1|  hypothetical protein AALP_AA8G422400                    203   3e-59   Arabis alpina [alpine rockcress]
ref|XP_010493709.1|  PREDICTED: NAC domain-containing protein 74        203   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002867065.1|  predicted protein                                  204   3e-59   
ref|XP_009151462.1|  PREDICTED: uncharacterized protein LOC103874777    206   3e-59   Brassica rapa
emb|CDY66161.1|  BnaCnng49700D                                          206   3e-59   Brassica napus [oilseed rape]
ref|XP_002874210.1|  tip                                                203   3e-59   Arabidopsis lyrata subsp. lyrata
ref|NP_973954.1|  protein NAC 014                                       206   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174582.3|  protein NAC 014                                       206   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432258.1|  PREDICTED: NAC domain-containing protein 1-l...    204   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010421284.1|  PREDICTED: NAC domain-containing protein 74-...    203   4e-59   Camelina sativa [gold-of-pleasure]
ref|NP_567986.3|  NAC transcription factor-like 9                       204   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478725.1|  PREDICTED: uncharacterized protein LOC104757...    206   4e-59   
ref|XP_006415127.1|  hypothetical protein EUTSA_v10007021mg             206   4e-59   Eutrema salsugineum [saltwater cress]
ref|XP_010478726.1|  PREDICTED: uncharacterized protein LOC104757...    206   4e-59   
ref|NP_197847.3|  TCV-interacting protein                               202   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001119122.1|  NAC transcription factor-like 9                    204   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190927.1|  NAC transcription factor-like 9                    204   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432259.1|  PREDICTED: NAC domain-containing protein 1-l...    204   5e-59   
ref|XP_010446907.1|  PREDICTED: NAC domain-containing protein 86-...    204   5e-59   Camelina sativa [gold-of-pleasure]
gb|KJB37424.1|  hypothetical protein B456_006G203800                    202   6e-59   Gossypium raimondii
ref|XP_003526771.1|  PREDICTED: uncharacterized protein LOC100808469    205   6e-59   Glycine max [soybeans]
gb|KHN19577.1|  NAC domain-containing protein 78                        205   6e-59   Glycine soja [wild soybean]
gb|KHG14091.1|  NAC domain-containing 78 -like protein                  204   7e-59   Gossypium arboreum [tree cotton]
ref|XP_010437454.1|  PREDICTED: uncharacterized protein LOC104721220    203   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002893753.1|  ANAC014                                            206   7e-59   
gb|KJB37426.1|  hypothetical protein B456_006G203800                    202   7e-59   Gossypium raimondii
gb|AHJ79190.1|  NAC domain protein NAC49                                205   7e-59   Gossypium hirsutum [American cotton]
ref|XP_006286077.1|  hypothetical protein CARUB_v10007613mg             203   7e-59   Capsella rubella
ref|XP_010456676.1|  PREDICTED: NAC domain-containing protein 2-like    203   9e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006394715.1|  hypothetical protein EUTSA_v10004105mg             202   9e-59   Eutrema salsugineum [saltwater cress]
gb|AHJ79172.1|  NAC domain protein NAC31                                203   9e-59   Gossypium hirsutum [American cotton]
gb|KJB37423.1|  hypothetical protein B456_006G203800                    203   1e-58   Gossypium raimondii
ref|XP_006291082.1|  hypothetical protein CARUB_v10017199mg             201   1e-58   Capsella rubella
ref|XP_006394714.1|  hypothetical protein EUTSA_v10004105mg             202   1e-58   
ref|XP_010542182.1|  PREDICTED: uncharacterized protein LOC104815470    205   1e-58   Tarenaya hassleriana [spider flower]
ref|XP_010515305.1|  PREDICTED: NAC domain-containing protein 19-...    201   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010426468.1|  PREDICTED: NAC domain-containing protein 74        201   2e-58   Camelina sativa [gold-of-pleasure]
gb|ACU23644.1|  unknown                                                 204   2e-58   Glycine max [soybeans]
ref|XP_010503613.1|  PREDICTED: NAC domain-containing protein 19-...    201   2e-58   Camelina sativa [gold-of-pleasure]
ref|NP_001276211.1|  uncharacterized LOC100777071                       204   2e-58   
ref|XP_008811393.1|  PREDICTED: NAC domain-containing protein 74-...    196   3e-58   
emb|CDY05939.1|  BnaC08g21160D                                          200   4e-58   
gb|EYU35608.1|  hypothetical protein MIMGU_mgv1a022295mg                199   5e-58   Erythranthe guttata [common monkey flower]
ref|XP_011043746.1|  PREDICTED: uncharacterized protein LOC105139114    202   5e-58   Populus euphratica
ref|XP_009111639.1|  PREDICTED: NAC domain-containing protein 2 i...    199   7e-58   Brassica rapa
ref|XP_009111638.1|  PREDICTED: NAC domain-containing protein 74 ...    199   7e-58   Brassica rapa
gb|AIS36139.1|  NAC transcription factor 91-1                           199   7e-58   Brassica napus [oilseed rape]
ref|XP_010461128.1|  PREDICTED: NAC domain-containing protein 86        202   1e-57   
emb|CDX86970.1|  BnaC03g52400D                                          195   1e-57   
ref|XP_008783552.1|  PREDICTED: uncharacterized protein LOC103702771    202   3e-57   Phoenix dactylifera
gb|KFK34231.1|  hypothetical protein AALP_AA5G118000                    198   3e-57   Arabis alpina [alpine rockcress]
emb|CDP12257.1|  unnamed protein product                                200   3e-57   Coffea canephora [robusta coffee]
emb|CDY08139.1|  BnaA06g15870D                                          197   3e-57   Brassica napus [oilseed rape]
ref|XP_009391051.1|  PREDICTED: uncharacterized protein LOC103977...    202   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009149732.1|  PREDICTED: NAC transcription factor 29             197   4e-57   Brassica rapa
ref|XP_009391053.1|  PREDICTED: uncharacterized protein LOC103977...    202   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006404132.1|  hypothetical protein EUTSA_v10010340mg             197   5e-57   Eutrema salsugineum [saltwater cress]
ref|XP_002877683.1|  ANAC062                                            197   5e-57   Arabidopsis lyrata subsp. lyrata
gb|AIS36140.1|  NAC transcription factor 91-2                           197   7e-57   Brassica napus [oilseed rape]
emb|CDX80455.1|  BnaC07g29890D                                          196   8e-57   
ref|XP_009389904.1|  PREDICTED: uncharacterized protein LOC103976...    200   8e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002445085.1|  hypothetical protein SORBIDRAFT_07g003900          200   9e-57   Sorghum bicolor [broomcorn]
ref|XP_004972796.1|  PREDICTED: uncharacterized protein LOC101763561    200   1e-56   Setaria italica
ref|XP_009150983.1|  PREDICTED: protein ATAF2-like isoform X2           196   2e-56   Brassica rapa
ref|XP_009150982.1|  PREDICTED: protein ATAF2-like isoform X1           196   2e-56   Brassica rapa
ref|XP_010941180.1|  PREDICTED: uncharacterized protein LOC105059...    200   2e-56   
ref|XP_010941181.1|  PREDICTED: uncharacterized protein LOC105059...    200   2e-56   Elaeis guineensis
ref|XP_009385839.1|  PREDICTED: uncharacterized protein LOC103973...    199   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385838.1|  PREDICTED: uncharacterized protein LOC103973...    199   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788721.1|  PREDICTED: uncharacterized protein LOC103706...    199   3e-56   Phoenix dactylifera
emb|CDX88115.1|  BnaA06g27060D                                          194   3e-56   
ref|XP_008788722.1|  PREDICTED: uncharacterized protein LOC103706...    199   3e-56   Phoenix dactylifera
ref|NP_190522.1|  transcription factor NTL6                             195   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389911.1|  PREDICTED: uncharacterized protein LOC103976...    198   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010919012.1|  PREDICTED: uncharacterized protein LOC105043...    197   5e-56   Elaeis guineensis
emb|CDX87118.1|  BnaC09g04330D                                          199   6e-56   
ref|NP_001061034.1|  Os08g0157900                                       198   7e-56   
ref|XP_010919011.1|  PREDICTED: uncharacterized protein LOC105043...    197   9e-56   Elaeis guineensis
ref|XP_010234378.1|  PREDICTED: uncharacterized protein LOC100838012    198   1e-55   Brachypodium distachyon [annual false brome]
ref|XP_006659850.1|  PREDICTED: uncharacterized protein LOC102700454    196   3e-55   Oryza brachyantha
gb|EMT07892.1|  NAC domain-containing protein 78                        196   5e-55   
gb|EEC82928.1|  hypothetical protein OsI_27885                          196   7e-55   Oryza sativa Indica Group [Indian rice]
gb|EMS48745.1|  NAC domain-containing protein 78                        196   7e-55   Triticum urartu
dbj|BAJ97142.1|  predicted protein                                      195   8e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010934040.1|  PREDICTED: uncharacterized protein LOC105054...    195   1e-54   Elaeis guineensis
ref|XP_010934041.1|  PREDICTED: uncharacterized protein LOC105054...    195   1e-54   Elaeis guineensis
ref|XP_009150140.1|  PREDICTED: NAC transcription factor 29-like        189   2e-54   Brassica rapa
ref|XP_008808290.1|  PREDICTED: uncharacterized protein LOC103720389    193   2e-54   Phoenix dactylifera
emb|CBI38740.3|  unnamed protein product                                187   3e-54   Vitis vinifera
ref|XP_009397631.1|  PREDICTED: uncharacterized protein LOC103982434    191   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846443.1|  hypothetical protein AMTR_s00018p00070180          180   2e-53   
ref|XP_009383033.1|  PREDICTED: NAC domain-containing protein 67-...    186   2e-53   
ref|XP_009390804.1|  PREDICTED: NAC transcription factor 29-like        185   3e-53   
gb|KDO61523.1|  hypothetical protein CISIN_1g036998mg                   182   3e-53   Citrus sinensis [apfelsine]
ref|XP_003546832.1|  PREDICTED: NAC domain-containing protein 68-...    184   5e-53   Glycine max [soybeans]
ref|XP_003532905.1|  PREDICTED: NAC domain-containing protein 74-...    184   6e-53   Glycine max [soybeans]
ref|XP_006846446.1|  hypothetical protein AMTR_s00018p00071850          188   9e-53   Amborella trichopoda
ref|XP_009389125.1|  PREDICTED: NAC domain-containing protein 19-...    184   9e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007149170.1|  hypothetical protein PHAVU_005G047300g             183   1e-52   Phaseolus vulgaris [French bean]
ref|XP_010661534.1|  PREDICTED: uncharacterized protein LOC100252...    188   1e-52   Vitis vinifera
ref|XP_002268892.1|  PREDICTED: NAC transcription factor NAM-B1-l...    187   1e-52   Vitis vinifera
ref|XP_006422300.1|  hypothetical protein CICLE_v10005341mg             182   3e-52   Citrus clementina [clementine]
ref|XP_010661535.1|  PREDICTED: uncharacterized protein LOC100252...    187   3e-52   Vitis vinifera
ref|XP_008371963.1|  PREDICTED: protein BEARSKIN1-like                  181   4e-52   Malus domestica [apple tree]
ref|XP_004293835.1|  PREDICTED: NAC domain-containing protein 86        181   7e-52   Fragaria vesca subsp. vesca
gb|AGL39702.1|  NAC transcription factor 046                            180   7e-52   Jatropha curcas
ref|XP_009363322.1|  PREDICTED: NAC domain-containing protein 19-...    181   8e-52   Pyrus x bretschneideri [bai li]
ref|XP_004157040.1|  PREDICTED: uncharacterized protein LOC101224912    186   9e-52   
ref|XP_004148915.1|  PREDICTED: uncharacterized protein LOC101209310    186   9e-52   Cucumis sativus [cucumbers]
ref|XP_003595952.1|  NAC domain protein                                 181   9e-52   Medicago truncatula
ref|XP_009340546.1|  PREDICTED: NAC transcription factor 29-like        181   9e-52   
ref|XP_010092473.1|  NAC domain-containing protein 78                   181   1e-51   Morus notabilis
gb|AGL39704.1|  NAC transcription factor 048                            177   1e-51   Jatropha curcas
ref|XP_004171745.1|  PREDICTED: NAC domain-containing protein 74-...    174   1e-51   
ref|XP_007022771.1|  NAC domain containing protein 20                   180   1e-51   
ref|XP_008463166.1|  PREDICTED: uncharacterized protein LOC103501372    186   1e-51   Cucumis melo [Oriental melon]
ref|XP_008383208.1|  PREDICTED: NAC transcription factor 29-like        180   1e-51   
ref|XP_009340131.1|  PREDICTED: NAC transcription factor 29-like        180   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_010690417.1|  PREDICTED: NAC domain-containing protein 86-...    180   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009145987.1|  PREDICTED: NAC domain-containing protein 78        177   2e-51   Brassica rapa
emb|CDX92153.1|  BnaA05g22540D                                          176   2e-51   
ref|XP_007214075.1|  hypothetical protein PRUPE_ppa017765mg             180   2e-51   Prunus persica
ref|XP_004488556.1|  PREDICTED: NAC domain-containing protein 78-...    180   2e-51   Cicer arietinum [garbanzo]
gb|KJB26959.1|  hypothetical protein B456_004G268400                    179   2e-51   Gossypium raimondii
ref|XP_010505816.1|  PREDICTED: NAC domain-containing protein 86-...    177   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010487668.1|  PREDICTED: NAC domain-containing protein 86-...    176   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010465831.1|  PREDICTED: NAC domain-containing protein 86-...    176   3e-51   Camelina sativa [gold-of-pleasure]
gb|AIU39717.1|  NAC transcription factor 57                             176   3e-51   Brassica napus [oilseed rape]
gb|EYU22270.1|  hypothetical protein MIMGU_mgv1a022636mg                175   3e-51   Erythranthe guttata [common monkey flower]
ref|XP_006298357.1|  hypothetical protein CARUB_v10014426mg             177   3e-51   
ref|XP_006406699.1|  hypothetical protein EUTSA_v10021408mg             176   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_004137396.1|  PREDICTED: NAC domain-containing protein 74-...    176   3e-51   Cucumis sativus [cucumbers]
ref|XP_008439242.1|  PREDICTED: protein BEARSKIN1                       176   3e-51   Cucumis melo [Oriental melon]
emb|CBI24139.3|  unnamed protein product                                177   4e-51   Vitis vinifera
emb|CDX95832.1|  BnaC05g35830D                                          176   4e-51   
ref|XP_009413063.1|  PREDICTED: uncharacterized protein LOC103994...    180   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_188400.1|  NAC domain containing protein 57                      176   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883083.1|  predicted protein                                  176   4e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_009790484.1|  PREDICTED: NAC domain-containing protein 74 ...    176   4e-51   Nicotiana sylvestris
ref|XP_009621551.1|  PREDICTED: NAC domain-containing protein 74 ...    176   5e-51   Nicotiana tomentosiformis
ref|XP_009790485.1|  PREDICTED: NAC domain-containing protein 74 ...    176   5e-51   Nicotiana sylvestris
ref|XP_007010878.1|  NAC domain containing protein 57                   176   5e-51   Theobroma cacao [chocolate]
ref|XP_009621552.1|  PREDICTED: NAC domain-containing protein 74 ...    176   5e-51   Nicotiana tomentosiformis
ref|XP_010934906.1|  PREDICTED: uncharacterized protein LOC105054...    184   5e-51   Elaeis guineensis
ref|XP_010645088.1|  PREDICTED: NAC domain-containing protein 45        178   6e-51   
ref|XP_008813657.1|  PREDICTED: NAC domain-containing protein 74-...    180   6e-51   
ref|XP_010934905.1|  PREDICTED: uncharacterized protein LOC105054...    184   6e-51   
ref|XP_010934904.1|  PREDICTED: uncharacterized protein LOC105054...    184   6e-51   
ref|XP_011072043.1|  PREDICTED: NAC domain-containing protein 86        175   7e-51   
ref|XP_011095829.1|  PREDICTED: NAC transcription factor 29             178   7e-51   
gb|KJB81442.1|  hypothetical protein B456_013G146300                    177   7e-51   
ref|XP_006847701.1|  hypothetical protein AMTR_s00149p00068500          179   7e-51   
ref|XP_008225989.1|  PREDICTED: protein BEARSKIN1                       178   7e-51   
ref|NP_001169185.1|  putative NAC domain transcription factor sup...    184   8e-51   
ref|XP_008662159.1|  PREDICTED: putative NAC domain transcription...    184   8e-51   
ref|XP_009386284.1|  PREDICTED: NAC domain-containing protein 78-...    177   9e-51   
ref|XP_008662160.1|  PREDICTED: putative NAC domain transcription...    184   9e-51   
gb|KFK39102.1|  hypothetical protein AALP_AA3G201200                    175   1e-50   
gb|AHJ79162.1|  NAC domain protein NAC21                                177   1e-50   
ref|NP_001056531.1|  Os06g0101800                                       178   1e-50   
ref|XP_008662161.1|  PREDICTED: putative NAC domain transcription...    183   1e-50   
gb|EMT23614.1|  NAC domain-containing protein 78                        182   1e-50   
ref|XP_004299481.1|  PREDICTED: NAC domain-containing protein 86        175   2e-50   
ref|XP_010908788.1|  PREDICTED: NAC domain-containing protein 86-...    180   2e-50   
gb|KJB08197.1|  hypothetical protein B456_001G070700                    174   2e-50   
ref|XP_004135638.1|  PREDICTED: NAC transcription factor ONAC010-...    172   2e-50   
ref|XP_006364397.1|  PREDICTED: NAC domain-containing protein 74-...    174   2e-50   
gb|AIB05550.1|  NAC transcription factor                                174   2e-50   
ref|XP_008653037.1|  PREDICTED: NAC domain-containing protein 74-...    174   2e-50   
ref|XP_010501258.1|  PREDICTED: NAC domain-containing protein 86-...    176   2e-50   
ref|XP_006649289.1|  PREDICTED: uncharacterized protein LOC102717876    182   2e-50   
ref|XP_002525485.1|  transcription factor, putative                     174   2e-50   
ref|XP_010480185.1|  PREDICTED: NAC domain-containing protein 86-...    176   2e-50   
gb|KGN46789.1|  hypothetical protein Csa_6G135450                       177   2e-50   
ref|XP_004140020.1|  PREDICTED: NAC domain-containing protein 43-...    177   2e-50   
ref|NP_001173241.1|  Os03g0119966                                       182   2e-50   
gb|EAY88306.1|  hypothetical protein OsI_09763                          182   2e-50   
ref|NP_001288459.1|  uncharacterized LOC103630963                       182   3e-50   
ref|XP_010462486.1|  PREDICTED: NAC domain-containing protein 86-...    176   3e-50   
emb|CDY71253.1|  BnaCnng72050D                                          172   3e-50   
gb|EAY99297.1|  hypothetical protein OsI_21263                          182   3e-50   
gb|EEE64934.1|  hypothetical protein OsJ_19800                          182   3e-50   
ref|XP_002468623.1|  hypothetical protein SORBIDRAFT_01g049240          182   3e-50   
ref|XP_002460635.1|  hypothetical protein SORBIDRAFT_02g032220          174   3e-50   
ref|XP_010037008.1|  PREDICTED: NAC domain-containing protein 74        173   3e-50   
ref|XP_004985948.1|  PREDICTED: uncharacterized protein LOC101753...    182   3e-50   
emb|CDO98612.1|  unnamed protein product                                173   4e-50   
ref|XP_004957582.1|  PREDICTED: NAC domain-containing protein 78-...    173   4e-50   
tpg|DAA42981.1|  TPA: putative NAC domain transcription factor su...    182   4e-50   
ref|XP_010551125.1|  PREDICTED: NAC domain-containing protein 86        173   4e-50   
ref|XP_008778272.1|  PREDICTED: uncharacterized protein LOC103698082    182   4e-50   
ref|XP_003562178.1|  PREDICTED: uncharacterized protein LOC100843938    182   4e-50   
ref|XP_004985947.1|  PREDICTED: uncharacterized protein LOC101753...    182   4e-50   
gb|KDO57313.1|  hypothetical protein CISIN_1g0079381mg                  177   4e-50   
gb|EMT33279.1|  NAC domain-containing protein 74                        172   4e-50   
ref|XP_006350487.1|  PREDICTED: NAC domain-containing protein 78-...    177   5e-50   
ref|XP_004157266.1|  PREDICTED: NAC transcription factor ONAC010-...    172   5e-50   
ref|XP_011013575.1|  PREDICTED: NAC domain-containing protein 74-...    176   5e-50   
ref|XP_011000782.1|  PREDICTED: NAC domain-containing protein 86-...    174   5e-50   
ref|XP_003549188.1|  PREDICTED: NAC domain-containing protein 74-...    173   5e-50   
ref|XP_010529123.1|  PREDICTED: NAC domain-containing protein 86-...    174   5e-50   
gb|EMS58788.1|  NAC domain-containing protein 74                        173   5e-50   
emb|CDY63046.1|  BnaA06g40380D                                          174   5e-50   
ref|XP_008456283.1|  PREDICTED: NAC domain-containing protein 76        177   5e-50   
ref|XP_002316156.1|  hypothetical protein POPTR_0010s18180g             176   6e-50   
ref|XP_011000781.1|  PREDICTED: NAC domain-containing protein 86-...    174   6e-50   
emb|CDX77674.1|  BnaC07g19280D                                          174   6e-50   
ref|XP_004235381.1|  PREDICTED: NAC domain-containing protein 86 ...    173   6e-50   
ref|XP_011000780.1|  PREDICTED: NAC domain-containing protein 86-...    174   6e-50   
ref|XP_011014226.1|  PREDICTED: NAC transcription factor 29-like        176   7e-50   
ref|XP_002527580.1|  transcription factor, putative                     176   7e-50   
ref|XP_010318339.1|  PREDICTED: NAC domain-containing protein 86 ...    173   7e-50   
ref|XP_009598688.1|  PREDICTED: protein BEARSKIN1-like isoform X2       176   7e-50   
ref|XP_002318332.2|  no apical meristem family protein                  172   7e-50   
ref|XP_003534099.1|  PREDICTED: NAC domain-containing protein 74-...    172   7e-50   
ref|XP_008393487.1|  PREDICTED: protein BEARSKIN1 isoform X1            173   7e-50   
ref|XP_009101506.1|  PREDICTED: NAC transcription factor 29-like        174   8e-50   
ref|XP_010270697.1|  PREDICTED: NAC domain-containing protein 45 ...    181   8e-50   
ref|XP_007152594.1|  hypothetical protein PHAVU_004G143100g             172   8e-50   
gb|EYU38937.1|  hypothetical protein MIMGU_mgv1a0250772mg               176   8e-50   
ref|XP_010270698.1|  PREDICTED: NAC domain-containing protein 45 ...    181   8e-50   
ref|XP_011047783.1|  PREDICTED: NAC domain-containing protein 86 ...    172   9e-50   
ref|XP_002311281.1|  hypothetical protein POPTR_0008s08100g             175   9e-50   
ref|XP_006441340.1|  hypothetical protein CICLE_v10024520mg             172   9e-50   
ref|NP_197228.1|  NAC domain containing protein 86                      178   9e-50   
ref|XP_011047785.1|  PREDICTED: NAC domain-containing protein 86 ...    172   9e-50   
ref|XP_009400096.1|  PREDICTED: NAC domain-containing protein 72-...    175   9e-50   
ref|XP_009355961.1|  PREDICTED: protein BEARSKIN1                       173   1e-49   
ref|XP_008393488.1|  PREDICTED: protein BEARSKIN1 isoform X2            173   1e-49   
ref|XP_009130344.1|  PREDICTED: protein BEARSKIN1 isoform X2            178   1e-49   
ref|XP_010908787.1|  PREDICTED: NAC domain-containing protein 86-...    181   1e-49   
gb|KJB37104.1|  hypothetical protein B456_006G189600                    172   1e-49   
ref|XP_009588904.1|  PREDICTED: protein BEARSKIN1-like                  179   1e-49   
ref|XP_006374257.1|  no apical meristem family protein                  172   1e-49   
gb|KJB37103.1|  hypothetical protein B456_006G189600                    172   1e-49   
emb|CDY43143.1|  BnaA05g32430D                                          178   1e-49   
ref|XP_010069496.1|  PREDICTED: NAC domain-containing protein 74-...    172   1e-49   
ref|XP_004515256.1|  PREDICTED: NAC domain-containing protein 78-...    172   1e-49   
ref|XP_009130343.1|  PREDICTED: protein BEARSKIN1 isoform X1            178   1e-49   
ref|XP_010663931.1|  PREDICTED: NAC domain-containing protein 86 ...    171   2e-49   
ref|XP_009413062.1|  PREDICTED: uncharacterized protein LOC103994...    179   2e-49   
ref|XP_002460636.1|  hypothetical protein SORBIDRAFT_02g032230          171   2e-49   
ref|XP_010694972.1|  PREDICTED: NAC domain-containing protein 86-...    172   2e-49   
ref|NP_001146336.1|  putative NAC domain transcription factor sup...    180   2e-49   
ref|XP_009765145.1|  PREDICTED: NAC domain-containing protein 78-...    179   2e-49   
gb|KEH26851.1|  NAC transcription factor-like protein                   171   2e-49   
ref|XP_010663930.1|  PREDICTED: NAC domain-containing protein 86 ...    171   2e-49   
emb|CDX67739.1|  BnaA07g17790D                                          173   2e-49   
ref|XP_010238477.1|  PREDICTED: NAC domain-containing protein 86-...    171   2e-49   
gb|AIA57517.1|  NAC domain-containing protein                           173   2e-49   
ref|XP_010420434.1|  PREDICTED: NAC domain-containing protein 86-...    177   3e-49   
ref|XP_010420435.1|  PREDICTED: NAC domain-containing protein 86-...    177   3e-49   
ref|XP_006398354.1|  hypothetical protein EUTSA_v10001200mg             172   3e-49   
ref|XP_006855594.1|  hypothetical protein AMTR_s00044p00058960          180   3e-49   
gb|EPS65413.1|  hypothetical protein M569_09365                         174   3e-49   
ref|XP_010270699.1|  PREDICTED: NAC domain-containing protein 45        171   3e-49   
ref|XP_009385171.1|  PREDICTED: uncharacterized protein LOC103972538    179   3e-49   
ref|XP_009382805.1|  PREDICTED: uncharacterized protein LOC103970...    179   3e-49   
ref|XP_008653036.1|  PREDICTED: NAC domain-containing protein 74-...    170   3e-49   
ref|XP_010492671.1|  PREDICTED: NAC domain-containing protein 86-...    177   3e-49   
ref|XP_009382806.1|  PREDICTED: uncharacterized protein LOC103970...    179   3e-49   
ref|XP_009104136.1|  PREDICTED: NAC transcription factor 29-like        173   3e-49   
ref|XP_009382804.1|  PREDICTED: uncharacterized protein LOC103970...    179   3e-49   
ref|XP_006855883.1|  hypothetical protein AMTR_s00037p00144010          174   3e-49   
ref|XP_006408330.1|  hypothetical protein EUTSA_v10022055mg             177   3e-49   
ref|XP_009382803.1|  PREDICTED: uncharacterized protein LOC103970...    179   3e-49   
emb|CDY28745.1|  BnaCnng06310D                                          177   3e-49   
ref|XP_009392206.1|  PREDICTED: NAC domain-containing protein 74        171   3e-49   
gb|KFK37763.1|  hypothetical protein AALP_AA3G026600                    175   4e-49   
ref|XP_009401257.1|  PREDICTED: NAC domain-containing protein 72-...    174   4e-49   
gb|EYU27595.1|  hypothetical protein MIMGU_mgv1a026788mg                173   4e-49   
ref|XP_010315723.1|  PREDICTED: NAC domain-containing protein 86-...    178   4e-49   
ref|XP_010940742.1|  PREDICTED: NAC domain-containing protein 86-...    177   5e-49   
ref|XP_009131585.1|  PREDICTED: protein SOMBRERO-like                   177   5e-49   
ref|XP_006290189.1|  hypothetical protein CARUB_v10003869mg             177   5e-49   
ref|XP_010055345.1|  PREDICTED: NAC domain-containing protein 78        173   5e-49   
ref|XP_002267333.1|  PREDICTED: NAC domain-containing protein 86        179   5e-49   
ref|XP_006430405.1|  hypothetical protein CICLE_v10011293mg             178   5e-49   
emb|CBI27341.3|  unnamed protein product                                178   6e-49   
ref|XP_002280894.2|  PREDICTED: NAC domain-containing protein 86        174   6e-49   
ref|XP_006481957.1|  PREDICTED: protein FEZ-like                        178   6e-49   
emb|CAN78113.1|  hypothetical protein VITISV_004432                     174   6e-49   
ref|XP_011096933.1|  PREDICTED: NAC domain-containing protein 45        178   6e-49   
ref|XP_010544346.1|  PREDICTED: NAC domain-containing protein 86-...    173   7e-49   
ref|XP_010453910.1|  PREDICTED: NAC domain-containing protein 86-...    176   7e-49   
gb|AGV29483.1|  putative NAC domain class transcription factor          170   8e-49   
ref|XP_008343143.1|  PREDICTED: uncharacterized protein LOC103405...    178   8e-49   
ref|XP_002865174.1|  ANAC096                                            171   8e-49   
ref|XP_008343142.1|  PREDICTED: uncharacterized protein LOC103405...    178   9e-49   
gb|KFK35527.1|  hypothetical protein AALP_AA4G002300                    172   9e-49   
ref|XP_006661516.1|  PREDICTED: NAC domain-containing protein 74-...    170   1e-48   
gb|KJB22460.1|  hypothetical protein B456_004G048200                    177   1e-48   
ref|XP_009598687.1|  PREDICTED: uncharacterized protein LOC104094...    177   1e-48   
emb|CDY16943.1|  BnaC09g40700D                                          176   1e-48   
ref|XP_006414166.1|  hypothetical protein EUTSA_v10027064mg             171   1e-48   
gb|ABK24128.1|  unknown                                                 166   1e-48   
ref|XP_008381390.1|  PREDICTED: uncharacterized protein LOC103444...    178   1e-48   
ref|XP_009136888.1|  PREDICTED: NAC domain-containing protein 78        171   1e-48   
emb|CDX70745.1|  BnaC03g08290D                                          176   1e-48   
ref|XP_008381391.1|  PREDICTED: uncharacterized protein LOC103444...    178   1e-48   
ref|XP_010105605.1|  NAC domain-containing protein 78                   175   1e-48   
ref|XP_010507160.1|  PREDICTED: NAC domain-containing protein 45        175   1e-48   
ref|XP_010275272.1|  PREDICTED: NAC domain-containing protein 45-...    173   1e-48   
ref|XP_002884362.1|  predicted protein                                  175   1e-48   
ref|XP_010494839.1|  PREDICTED: NAC domain-containing protein 86-...    171   1e-48   
ref|XP_006400258.1|  hypothetical protein EUTSA_v10013344mg             176   1e-48   
ref|NP_186970.2|  NAC domain containing protein 45                      175   2e-48   
ref|XP_009370573.1|  PREDICTED: uncharacterized protein LOC103959...    177   2e-48   
ref|XP_001765136.1|  predicted protein                                  167   2e-48   
gb|AFN55265.1|  NAC domain protein                                      169   2e-48   
ref|XP_002526579.1|  hypothetical protein RCOM_1603380                  177   2e-48   
ref|XP_009370574.1|  PREDICTED: uncharacterized protein LOC103959...    177   2e-48   
ref|XP_006297561.1|  hypothetical protein CARUB_v10013584mg             175   2e-48   
ref|XP_008227899.1|  PREDICTED: uncharacterized protein LOC103327366    177   2e-48   
emb|CDY01508.1|  BnaC07g34980D                                          170   2e-48   
ref|XP_011469065.1|  PREDICTED: NAC domain-containing protein 86 ...    177   2e-48   
ref|XP_010485657.1|  PREDICTED: NAC domain-containing protein 45-...    175   2e-48   
ref|XP_009760809.1|  PREDICTED: protein ATAF2-like                      171   2e-48   
ref|XP_010463767.1|  PREDICTED: NAC domain-containing protein 45        175   2e-48   
ref|XP_004289565.1|  PREDICTED: NAC domain-containing protein 86 ...    177   2e-48   
ref|XP_010940228.1|  PREDICTED: NAC domain-containing protein 45-...    169   2e-48   
ref|XP_010316554.1|  PREDICTED: NAC domain-containing protein 86 ...    174   2e-48   
ref|XP_007032209.1|  NAC domain protein, IPR003441, putative isof...    177   2e-48   
ref|XP_009774486.1|  PREDICTED: NAC domain-containing protein 67-...    173   2e-48   
ref|XP_006660950.1|  PREDICTED: NAC domain-containing protein 74-...    168   2e-48   
ref|XP_002961864.1|  hypothetical protein SELMODRAFT_68150              165   2e-48   
ref|XP_007215001.1|  hypothetical protein PRUPE_ppa002384mg             177   2e-48   
ref|XP_006409228.1|  hypothetical protein EUTSA_v10023058mg             175   2e-48   
ref|XP_010099671.1|  NAC domain-containing protein 74                   169   2e-48   
ref|XP_009119137.1|  PREDICTED: protein BEARSKIN1-like                  175   2e-48   
ref|XP_009367106.1|  PREDICTED: uncharacterized protein LOC103956792    177   2e-48   
ref|XP_004490776.1|  PREDICTED: uncharacterized protein LOC101514...    177   2e-48   
ref|XP_010559290.1|  PREDICTED: NAC domain-containing protein 86-...    171   2e-48   
ref|XP_003600640.1|  NAC domain protein                                 177   2e-48   
ref|XP_006282042.1|  hypothetical protein CARUB_v10028284mg             170   3e-48   
ref|XP_009624151.1|  PREDICTED: NAC domain-containing protein 72-...    171   3e-48   
ref|XP_010935330.1|  PREDICTED: NAC domain-containing protein 86        168   3e-48   
ref|XP_010260796.1|  PREDICTED: NAC transcription factor 29             172   3e-48   
ref|XP_008804874.1|  PREDICTED: NAC domain-containing protein 74        168   3e-48   
ref|XP_009128881.1|  PREDICTED: NAC domain-containing protein 74-...    170   3e-48   
gb|AIM47114.1|  putative NAC transcription factor                       171   3e-48   
gb|EAZ10017.1|  hypothetical protein OsI_32320                          168   3e-48   
emb|CDY59580.1|  BnaA02g36760D                                          170   3e-48   
ref|XP_010441567.1|  PREDICTED: NAC domain-containing protein 86-...    170   3e-48   
ref|NP_001063877.1|  Os09g0552900                                       167   3e-48   
ref|XP_003544352.1|  PREDICTED: protein FEZ-like                        176   3e-48   
emb|CDX90431.1|  BnaA03g43500D                                          169   4e-48   
ref|XP_007039543.1|  NAC domain protein, IPR003441                      171   4e-48   
ref|XP_007141968.1|  hypothetical protein PHAVU_008G241200g             176   4e-48   
gb|EMS58787.1|  NAC domain-containing protein 78                        171   4e-48   
ref|XP_010434593.1|  PREDICTED: NAC domain-containing protein 86-...    169   4e-48   
ref|XP_010481437.1|  PREDICTED: NAC domain-containing protein 86-...    170   4e-48   
gb|EPS57631.1|  hypothetical protein M569_17186                         165   4e-48   
ref|XP_010481438.1|  PREDICTED: NAC domain-containing protein 86-...    169   4e-48   
gb|KHN24171.1|  NAC domain-containing protein 74                        176   4e-48   
ref|XP_003616168.1|  NAC domain protein                                 176   4e-48   
ref|XP_003537430.2|  PREDICTED: uncharacterized protein LOC100808596    176   4e-48   
ref|XP_010651862.1|  PREDICTED: NAC domain-containing protein 89 ...    169   4e-48   
gb|EMS48623.1|  NAC domain-containing protein 78                        171   4e-48   
emb|CDP01698.1|  unnamed protein product                                176   5e-48   
gb|KGN66118.1|  hypothetical protein Csa_1G572390                       174   5e-48   
ref|XP_011038331.1|  PREDICTED: NAC domain-containing protein 86        176   5e-48   
emb|CDY49932.1|  BnaCnng18420D                                          174   5e-48   
gb|KHN08773.1|  NAC domain-containing protein 74                        176   5e-48   
ref|XP_010104346.1|  NAC domain-containing protein 74                   171   5e-48   



>gb|AGY49286.1| putative membrane bound NAC transcription factor 1 [Nicotiana 
benthamiana]
Length=630

 Score =   281 bits (720),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            +AVL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G+++EVSVIREVDICK EP
Sbjct  11   VAVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEP  70

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLPDMS VES+DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I+++KGAK+GM
Sbjct  71   WDLPDMSVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIATKKGAKIGM  130

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRTHWVIHEYR T+   DG+
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGS  164



>ref|NP_001274765.1| uncharacterized LOC102593794 [Solanum tuberosum]
 gb|AGY49284.1| putative membrane bound NAC transcription factor 1 [Solanum tuberosum]
Length=639

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            +AVL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G++++VSVIREVDICK EP
Sbjct  11   IAVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSQVSVIREVDICKLEP  70

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLPD+S VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I ++KGAK+GM
Sbjct  71   WDLPDLSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAKIGM  130

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRTHWVIHEYR TE   DG+
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATEKSLDGS  164



>ref|XP_009608176.1| PREDICTED: uncharacterized protein LOC104102223 [Nicotiana tomentosiformis]
Length=636

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            +AVL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G+++EVSVIREVDICK EP
Sbjct  11   IAVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEP  70

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLPDMS VES+DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I ++KGAK+GM
Sbjct  71   WDLPDMSVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAKIGM  130

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRTHWVIHEYR T+   DG+
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGS  164



>ref|XP_009759914.1| PREDICTED: uncharacterized protein LOC104212382 [Nicotiana sylvestris]
Length=640

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            ++VL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G+++EVSVIREVDICK EP
Sbjct  11   ISVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEP  70

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLPDMS VES DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I+++KGAK+GM
Sbjct  71   WDLPDMSVVESKDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIATKKGAKIGM  130

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRTHWVIHEYR T+   DG+
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGS  164



>ref|XP_010318064.1| PREDICTED: uncharacterized protein LOC101253566 [Solanum lycopersicum]
Length=644

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            +AVL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G++++VSVIREVDICK EP
Sbjct  11   IAVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSQVSVIREVDICKLEP  70

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLPD+S VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I ++KG+K+GM
Sbjct  71   WDLPDLSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGSKIGM  130

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRTHWVIHEYR TE   DG+
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATEKSLDGS  164



>gb|AAM47025.1| nam-like protein 1 [Petunia x hybrida]
Length=585

 Score =   275 bits (703),  Expect = 1e-85, Method: Composition-based stats.
 Identities = 124/163 (76%), Positives = 137/163 (84%), Gaps = 9/163 (6%)
 Frame = +1

Query  103  MAVLKVERPTG---------LPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIR  255
            MAVL  E P           +PPL+SLPVGYRFRPTDEELV+HYL++KI G++ EVSVIR
Sbjct  1    MAVLPGENPIAVHNNKEMGKIPPLNSLPVGYRFRPTDEELVNHYLRLKINGADNEVSVIR  60

Query  256  EVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTIS  435
            EVDICK EPWDLP  S VES+DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I 
Sbjct  61   EVDICKLEPWDLPIWSVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIV  120

Query  436  SRKGAKVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            ++KGAK+GMKKTLVYY+GRAPEGKRTHWVIHEYR T+   DGT
Sbjct  121  TKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGT  163



>ref|XP_011075874.1| PREDICTED: NAC domain-containing protein 45 [Sesamum indicum]
Length=623

 Score =   262 bits (670),  Expect = 2e-80, Method: Composition-based stats.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ +LPVGYRFRPTDEEL+DHYL++KI G   EVSVIRE+D+CK EPWDLPD+S +ES D
Sbjct  5    PVKALPVGYRFRPTDEELIDHYLRLKINGRHKEVSVIREIDVCKWEPWDLPDLSVIESTD  64

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
            NEWFFFCPKDRKYQNGQRLNRATE+GYWKATGKDR I+SRKGAK+GMKKTLV+Y GRAP+
Sbjct  65   NEWFFFCPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGAKIGMKKTLVFYTGRAPD  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WVIHEYR T+   DGT
Sbjct  125  GKRTNWVIHEYRATDKSLDGT  145



>ref|XP_009760821.1| PREDICTED: NAC domain-containing protein 74-like isoform X2 [Nicotiana 
sylvestris]
Length=418

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            +A L V +  G+PPL++LPVGYRFRPTDEELV+HYL++KI G   +V+VIREVDICK EP
Sbjct  10   IAGLPVGKHLGVPPLNTLPVGYRFRPTDEELVNHYLRLKINGCHDKVAVIREVDICKFEP  69

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
             DLPD+S VES DN+WFFFCP DRKYQNGQRLNRATE+GYWKATGKDR I ++KGAK+GM
Sbjct  70   SDLPDLSVVESKDNDWFFFCPIDRKYQNGQRLNRATEQGYWKATGKDRNIVTKKGAKIGM  129

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRT+WVIHEYR T+   DG+
Sbjct  130  KKTLVYYIGRAPEGKRTNWVIHEYRATDKSLDGS  163



>ref|XP_006347316.1| PREDICTED: uncharacterized protein LOC102605066 [Solanum tuberosum]
Length=630

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            M V  V     +PPL++LP+GYRFRPTDEEL++HYL +KI G   +V VIRE+DICK EP
Sbjct  1    MTVPPVGNQVEVPPLNTLPIGYRFRPTDEELINHYLCLKINGCHNQVDVIREIDICKFEP  60

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLPD+S VES+DNEW +FCP DRKYQNGQRLNRATERGYWKATGKDR I++RKGAK+GM
Sbjct  61   WDLPDLSVVESNDNEWLYFCPIDRKYQNGQRLNRATERGYWKATGKDRNIATRKGAKIGM  120

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRT+WVIHEYR T+   DG+
Sbjct  121  KKTLVYYIGRAPEGKRTNWVIHEYRATDKSLDGS  154



>ref|XP_004241429.1| PREDICTED: uncharacterized protein LOC101257973 [Solanum lycopersicum]
Length=595

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  136  LPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES  315
            +PPL++LP+GYRFRPTDEEL++HYL +KI G   +V VIRE+DICK EPWDLPD+S VES
Sbjct  13   VPPLNTLPIGYRFRPTDEELINHYLCLKINGCHDQVGVIREIDICKFEPWDLPDLSVVES  72

Query  316  HDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRA  495
            +DNEWF+FCP DRKYQNGQRLNRATERGYWKATGKDR I++RKGAK+GMKKTLVYY GRA
Sbjct  73   NDNEWFYFCPIDRKYQNGQRLNRATERGYWKATGKDRNIATRKGAKIGMKKTLVYYNGRA  132

Query  496  PEGKRTHWVIHEYRTTENKFDGT  564
            PEGKRT+WVIHEYR T+   DG+
Sbjct  133  PEGKRTNWVIHEYRATDKSLDGS  155



>ref|XP_009760820.1| PREDICTED: uncharacterized protein LOC104213101 isoform X1 [Nicotiana 
sylvestris]
Length=645

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            +A L V +  G+PPL++LPVGYRFRPTDEELV+HYL++KI G   +V+VIREVDICK EP
Sbjct  10   IAGLPVGKHLGVPPLNTLPVGYRFRPTDEELVNHYLRLKINGCHDKVAVIREVDICKFEP  69

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
             DLPD+S VES DN+WFFFCP DRKYQNGQRLNRATE+GYWKATGKDR I ++KGAK+GM
Sbjct  70   SDLPDLSVVESKDNDWFFFCPIDRKYQNGQRLNRATEQGYWKATGKDRNIVTKKGAKIGM  129

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRT+WVIHEYR T+   DG+
Sbjct  130  KKTLVYYIGRAPEGKRTNWVIHEYRATDKSLDGS  163



>ref|XP_009596681.1| PREDICTED: NAC domain-containing protein 74-like [Nicotiana tomentosiformis]
Length=638

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            +AVL   +   +PPL++LPVGYRFRPTDEELV+HYL++KI G + +V VIREVDICK EP
Sbjct  10   IAVLPGGKQLEVPPLNTLPVGYRFRPTDEELVNHYLRLKINGCDDKVGVIREVDICKFEP  69

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
             DLPD+S VES DN+WFFFCP DRKYQNGQRLNRATERGYWKATGKDR I ++KGAK+GM
Sbjct  70   SDLPDLSVVESKDNDWFFFCPIDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAKIGM  129

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLVYY+GRAPEGKRT+WVIHEYR T+   DG+
Sbjct  130  KKTLVYYIGRAPEGKRTNWVIHEYRATDKSLDGS  163



>gb|EYU45332.1| hypothetical protein MIMGU_mgv1a003123mg [Erythranthe guttata]
Length=606

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P  +LPVGYRFRPTDEEL+DHYL++KI   + +VSVIRE+D+CK EPWDLPDMS +ES D
Sbjct  5    PAKALPVGYRFRPTDEELIDHYLRLKINRHDKDVSVIREIDVCKWEPWDLPDMSVIESFD  64

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
            NEWFFFCPKDRKYQNGQRLNRATE+GYWKATGKDR I+SRKGAK+GMKKTLV+Y GRAP+
Sbjct  65   NEWFFFCPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGAKIGMKKTLVFYTGRAPD  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WVIHEYR T+   DGT
Sbjct  125  GKRTNWVIHEYRATDKSLDGT  145



>gb|EPS67213.1| hypothetical protein M569_07559 [Genlisea aurea]
Length=790

 Score =   251 bits (642),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 7/154 (5%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL         P  ++PVGYRFRPTDEEL+DHYL++KI G E EV VIRE+D+CK EP
Sbjct  1    MAVLPA-------PARTMPVGYRFRPTDEELIDHYLRLKINGHEREVCVIREIDVCKWEP  53

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLPD+S +ES DNEWFFF PKDRKYQNGQRLNRATE+GYWKATGKDR I+SRKG+K+GM
Sbjct  54   WDLPDLSVIESSDNEWFFFSPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGSKIGM  113

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLV+Y GRAPEGKRT+WVIHEYR T+   DGT
Sbjct  114  KKTLVFYTGRAPEGKRTNWVIHEYRATDKSLDGT  147



>emb|CDP04976.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+  LPVGYRFRPTDEEL+DHYL++KI G + +VS+IREVDICK EPWDLPD+S ++S+D
Sbjct  6    PVKQLPVGYRFRPTDEELIDHYLRLKINGLDKDVSIIREVDICKKEPWDLPDLSPIKSYD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
            NEWFFFCPKDRKYQNGQRLNRAT +GYWKATGKDR I +RKG K+GMKKTLV+Y+GRAP+
Sbjct  66   NEWFFFCPKDRKYQNGQRLNRATMKGYWKATGKDRNIRARKGTKIGMKKTLVFYIGRAPD  125

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WVIHEYR T  + DGT
Sbjct  126  GKRTNWVIHEYRATNKELDGT  146



>gb|AGT96630.1| NAC transcription factor [Suaeda liaotungensis]
Length=336

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  103  MAVLKVERPTGLP-PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  279
            M  L +  P  L  P  +LP+G+RF+PTD EL+DHYL++KI G E +V+ I+EVDICK E
Sbjct  1    MGALIIREPGALSTPFETLPLGFRFKPTDVELIDHYLRLKINGKEDDVACIKEVDICKVE  60

Query  280  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVG  459
            PWDLPD+S ++++D+EWF+FCP+DRKY NGQR NRATE GYWKATGKDRTI SRK  ++G
Sbjct  61   PWDLPDLSAIQTNDHEWFYFCPRDRKYPNGQRSNRATEAGYWKATGKDRTIKSRKLGEIG  120

Query  460  MKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            MKKTLV+Y GRAP+G+RTHWVIHEYRTT  + DG+
Sbjct  121  MKKTLVFYTGRAPKGQRTHWVIHEYRTTLEELDGS  155



>gb|AGV29473.1| putative NAC domain class transcription factor [Tamarix hispida]
Length=547

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P  +LP+G+RF+PTD EL+DHYL++KI G+  +VSVIREVD+CK EPWDLPD+S ++S D
Sbjct  5    PFQNLPLGFRFKPTDVELIDHYLRLKIKGNHRDVSVIREVDVCKVEPWDLPDLSMIKSPD  64

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
            +EWFFFC +DRKY NGQR NRATE+GYWKATGKDR I SRK   +GMKKTLV+Y GRAP+
Sbjct  65   HEWFFFCARDRKYPNGQRSNRATEKGYWKATGKDRRIVSRKMGLIGMKKTLVFYRGRAPK  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRTHWVIHEYRTT ++ DGT
Sbjct  125  GKRTHWVIHEYRTTLDELDGT  145



>ref|XP_002317040.2| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|EEE97652.2| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=667

 Score =   227 bits (578),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 99/145 (68%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYR TE   DGT
Sbjct  126  RAPNGKRTNWVMHEYRPTEKDLDGT  150



>ref|XP_006377880.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55677.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=697

 Score =   226 bits (577),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 99/145 (68%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYR TE   DGT
Sbjct  126  RAPNGKRTNWVMHEYRPTEKDLDGT  150



>ref|XP_010671303.1| PREDICTED: NAC domain-containing protein 86-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=608

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = +1

Query  103  MAVLKVERPTGLP----PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDIC  270
            M  L VE+   +     P   LP+G+RF+PTD EL+DHYL++KI G + EV+ I EVDIC
Sbjct  1    MGALAVEKSGKMEALAMPFERLPLGFRFKPTDVELIDHYLRLKINGKDKEVACITEVDIC  60

Query  271  KHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA  450
            + EPWDLP +SF++S D+EWFFFCP+DRKY NGQR NRATE GYWKATGKDR+I SRK  
Sbjct  61   RVEPWDLPGLSFIKSMDHEWFFFCPRDRKYPNGQRSNRATEAGYWKATGKDRSIKSRKMG  120

Query  451  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
             +GMKKTLV+Y GRAP+G+RTHWVIHEYRTT  + DG+
Sbjct  121  LIGMKKTLVFYKGRAPKGQRTHWVIHEYRTTLQELDGS  158



>ref|XP_010671302.1| PREDICTED: uncharacterized protein LOC104888129 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=637

 Score =   224 bits (571),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = +1

Query  103  MAVLKVERPTGLP----PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDIC  270
            M  L VE+   +     P   LP+G+RF+PTD EL+DHYL++KI G + EV+ I EVDIC
Sbjct  1    MGALAVEKSGKMEALAMPFERLPLGFRFKPTDVELIDHYLRLKINGKDKEVACITEVDIC  60

Query  271  KHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA  450
            + EPWDLP +SF++S D+EWFFFCP+DRKY NGQR NRATE GYWKATGKDR+I SRK  
Sbjct  61   RVEPWDLPGLSFIKSMDHEWFFFCPRDRKYPNGQRSNRATEAGYWKATGKDRSIKSRKMG  120

Query  451  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
             +GMKKTLV+Y GRAP+G+RTHWVIHEYRTT  + DG+
Sbjct  121  LIGMKKTLVFYKGRAPKGQRTHWVIHEYRTTLQELDGS  158



>gb|AGL39710.1| NAC transcription factor 054 [Jatropha curcas]
 gb|KDP37577.1| hypothetical protein JCGZ_08268 [Jatropha curcas]
Length=573

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELV++YL++KI G++ EV VIRE+D+CK EPWDLPD+S ++++D 
Sbjct  6    LNSLPLGFRFRPTDEELVNYYLRLKINGNDREVRVIRELDVCKWEPWDLPDLSNIQTNDQ  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP DRKY NG RLNRAT +GYWKATGKDR I S     +GMKKTLV+Y GRAP G
Sbjct  66   EWFFFCPLDRKYPNGHRLNRATSKGYWKATGKDRKIKSGNNL-IGMKKTLVFYTGRAPRG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRTHWVIHEYR TE++ DGT
Sbjct  125  KRTHWVIHEYRATEDELDGT  144



>emb|CAN73478.1| hypothetical protein VITISV_037597 [Vitis vinifera]
Length=181

 Score =   209 bits (531),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEEL++HYLK+KI G  +EV VIRE+D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELINHYLKLKIEGRHSEVEVIRELDVCKWEPWDLPGLSMIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-GAKVGMKKTLVYYLG  489
            + D EWFFFCP+DRKY NG+R NRAT+ GYWKATGKDRTI SRK  A +GMKKTLV+Y G
Sbjct  62   ADDPEWFFFCPRDRKYPNGRRSNRATDAGYWKATGKDRTIKSRKSSASIGMKKTLVFYKG  121

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W+ HEYR  ++  D +
Sbjct  122  RAPKGQRTNWIFHEYRVIDSASDSS  146



>ref|XP_010045303.1| PREDICTED: uncharacterized protein LOC104434047 [Eucalyptus grandis]
 gb|KCW88592.1| hypothetical protein EUGRSUZ_A00969 [Eucalyptus grandis]
Length=597

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            PL+SLP+G+RFRPTD+EL+DHYL++KI G + EV VIREVD+CK EPWDLPD+S +ES D
Sbjct  5    PLNSLPLGFRFRPTDQELIDHYLRLKINGRDREVRVIREVDVCKVEPWDLPDLSAIESRD  64

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I   +   +GMKKTLV+Y GRAP+
Sbjct  65   PEWFFFCPRDRKYPNGHRLNRATTAGYWKATGKDRKIKLGRDL-IGMKKTLVFYTGRAPK  123

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT  + DGT
Sbjct  124  GKRTYWVMHEYRTTLEELDGT  144



>gb|AGV29497.1| putative NAC domain class transcription factor, partial [Tamarix 
hispida]
Length=233

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P  +LP+G+RF+PTD EL+DHYL+ K+ G E +VSVI EVD+CK EPWDLP +S +ES D
Sbjct  5    PFQNLPLGFRFKPTDVELIDHYLRRKVNGYEKDVSVIGEVDVCKVEPWDLPALSKIESPD  64

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
            +EWFFFC +DRKY NGQR NRATE+GYWKATGKDR I+ +K   +GMKKTLV+Y GRAP+
Sbjct  65   HEWFFFCARDRKYPNGQRSNRATEKGYWKATGKDRRITKKKSL-IGMKKTLVFYQGRAPK  123

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKR++WVIHEYRTT  + DGT
Sbjct  124  GKRSNWVIHEYRTTLPELDGT  144



>ref|XP_002521312.1| transcription factor, putative [Ricinus communis]
 gb|EEF41086.1| transcription factor, putative [Ricinus communis]
Length=597

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELV+ YL++KI G++ +V VIRE+D+CK EPWDLPDMS ++++D 
Sbjct  6    LNSLPLGFRFRPTDEELVNFYLRLKINGNDKDVRVIRELDVCKWEPWDLPDMSIIKTNDQ  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP DRKY NG RLNRAT +GYWKATGKDR I S     +GMKKTLV+Y GRAP G
Sbjct  66   EWFFFCPLDRKYPNGHRLNRATSKGYWKATGKDRKIKS-GNTLIGMKKTLVFYTGRAPRG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RTHWVIHEYR TE+  DGT
Sbjct  125  TRTHWVIHEYRATEDDLDGT  144



>ref|XP_003615517.1| NAC domain protein [Medicago truncatula]
 gb|AES98475.1| NAC transcription factor-like protein [Medicago truncatula]
Length=630

 Score =   219 bits (559),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 3/141 (2%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+ LP+G+RFRPTDEELVD YL+MKI G+  EV VIREVD+CK EPWDLPD+S V + D 
Sbjct  22   LNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFEPWDLPDLSIVRNKDP  81

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  501
            EWFFFCP DRKY NG RLNRAT  GYWKATGKDR I S  GA  +GMKKTLV+Y GRAP+
Sbjct  82   EWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIKS--GATLIGMKKTLVFYAGRAPK  139

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            G+RTHW++HEYR T  + DGT
Sbjct  140  GQRTHWIMHEYRPTLKELDGT  160



>ref|XP_006377878.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55675.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=647

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYR TE   DGT
Sbjct  126  RAPNGKRTNWVMHEYRPTEKDLDGT  150



>ref|XP_006377879.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55676.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=672

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYR TE   DGT
Sbjct  126  RAPNGKRTNWVMHEYRPTEKDLDGT  150



>ref|XP_006441281.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54521.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=509

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKS-GNHLIGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATADDLDGT  144



>ref|XP_006441278.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54518.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=510

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATADDLDGT  144



>gb|AIA57510.1| NAC domain-containing protein [Boehmeria nivea]
Length=502

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 122/155 (79%), Gaps = 10/155 (6%)
 Frame = +1

Query  100  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  279
            EM+VL          L+SLP+G+RFRPTDEELVD+YL+ KI G + +VSVIRE+D+CK E
Sbjct  5    EMSVLS---------LNSLPLGFRFRPTDEELVDYYLRFKINGVDEQVSVIREIDVCKWE  55

Query  280  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVG  459
            PWDLPD+S++ + D+EWFFFCP+DRKY NG RLNRAT +GYWKATGKDR I S    ++G
Sbjct  56   PWDLPDLSYIPTRDHEWFFFCPQDRKYPNGNRLNRATSKGYWKATGKDRKIKSGT-REIG  114

Query  460  MKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            MKKTLV+Y GRAP+G RT+WV+HEYR T  +  GT
Sbjct  115  MKKTLVFYTGRAPKGTRTYWVMHEYRATLKELSGT  149



>ref|NP_001280863.1| uncharacterized LOC103439966 [Malus domestica]
 gb|ADL36794.1| NAC domain class transcription factor [Malus domestica]
Length=541

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            ++SLP+G+RFRPTD EL+D+YL+ KI G+  +V+VIRE+D+CK EPWDLPD+S +++ D 
Sbjct  6    MNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTTDP  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT RGYWKATGKDR I S K   +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQIKSDK-ILIGMKKTLVFHIGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T+ + DGT
Sbjct  125  KRTNWVMHEYRATQKELDGT  144



>ref|XP_003615518.1| NAC domain protein [Medicago truncatula]
Length=392

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 119/156 (76%), Gaps = 12/156 (8%)
 Frame = +1

Query  100  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  279
            E+AVL          L+ LP+G+RFRPTDEELVD YL+MKI G+  EV VIREVD+CK E
Sbjct  16   ELAVLS---------LNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFE  66

Query  280  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-V  456
            PWDLPD+S V + D EWFFFCP DRKY NG RLNRAT  GYWKATGKDR I S  GA  +
Sbjct  67   PWDLPDLSIVRNKDPEWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIKS--GATLI  124

Query  457  GMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            GMKKTLV+Y GRAP+G+RTHW++HEYR T  + DGT
Sbjct  125  GMKKTLVFYAGRAPKGQRTHWIMHEYRPTLKELDGT  160



>ref|XP_006441280.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54520.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=604

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATADDLDGT  144



>ref|XP_006441279.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54519.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=605

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATADDLDGT  144



>gb|KCW72635.1| hypothetical protein EUGRSUZ_E01095 [Eucalyptus grandis]
Length=628

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 120/149 (81%), Gaps = 5/149 (3%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G+  + +LP+G+RFRPTDEEL+ HYL++KI G  +EV VI E+D+CK EPWDLPD+S ++
Sbjct  2    GVLEMEALPLGFRFRPTDEELISHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPDLSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK--GAK---VGMKKTLV  477
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SRK  GA    +GMKKTLV
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSGGAAAGLIGMKKTLV  121

Query  478  YYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            +Y GRAP+G+RTHW++HEYR TE   DGT
Sbjct  122  FYRGRAPKGERTHWIMHEYRATEQDLDGT  150



>gb|KDO44488.1| hypothetical protein CISIN_1g007393mg [Citrus sinensis]
Length=604

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATTDDLDGT  144



>ref|XP_009361256.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Pyrus 
x bretschneideri]
Length=541

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            ++SLP+G+RFRPTD EL+D+YL+ KI G+  +V+VIRE+D+CK EPWDLPD+S +++ D 
Sbjct  6    MNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTTDP  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT +GYWKATGKDR I S K   +GMKKTLV++ GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDK-ILIGMKKTLVFHTGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYRTT+ + DGT
Sbjct  125  KRTNWVMHEYRTTQKELDGT  144



>gb|KDO44489.1| hypothetical protein CISIN_1g007393mg [Citrus sinensis]
Length=605

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATTDDLDGT  144



>ref|XP_006478081.1| PREDICTED: NAC domain-containing protein 69-like isoform X2 [Citrus 
sinensis]
Length=605

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATTDDLDGT  144



>ref|XP_006478082.1| PREDICTED: NAC domain-containing protein 69-like isoform X3 [Citrus 
sinensis]
Length=604

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATTDDLDGT  144



>ref|XP_006478080.1| PREDICTED: NAC domain-containing protein 69-like isoform X1 [Citrus 
sinensis]
Length=610

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T +  DGT
Sbjct  125  KRTNWVMHEYRATTDDLDGT  144



>ref|XP_008381552.1| PREDICTED: uncharacterized protein LOC103444404 [Malus domestica]
Length=554

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL+D+YL+ KI G+  +V+VIRE+D+CK EPWDLPD+S +++ D 
Sbjct  11   MDSLPLGFRFRPTDEELIDYYLRSKINGNHGQVAVIREIDVCKWEPWDLPDLSVIQTTDP  70

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            +WFFFCP+DRKY NG RLNRAT +GYWKATGKDR I S K   +GMKKTLV++ GRAP+G
Sbjct  71   QWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDK-ILIGMKKTLVFHTGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYRTT+ + DGT
Sbjct  130  KRTNWVMHEYRTTQKELDGT  149



>ref|XP_010056056.1| PREDICTED: uncharacterized protein LOC104444143 [Eucalyptus grandis]
 gb|KCW72636.1| hypothetical protein EUGRSUZ_E01095 [Eucalyptus grandis]
Length=656

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 120/149 (81%), Gaps = 5/149 (3%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G+  + +LP+G+RFRPTDEEL+ HYL++KI G  +EV VI E+D+CK EPWDLPD+S ++
Sbjct  2    GVLEMEALPLGFRFRPTDEELISHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPDLSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK--GAK---VGMKKTLV  477
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SRK  GA    +GMKKTLV
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSGGAAAGLIGMKKTLV  121

Query  478  YYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            +Y GRAP+G+RTHW++HEYR TE   DGT
Sbjct  122  FYRGRAPKGERTHWIMHEYRATEQDLDGT  150



>gb|KJB52429.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=782

 Score =   218 bits (555),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 91/138 (66%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D EW
Sbjct  8    TLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDLEW  67

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            FFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G+R
Sbjct  68   FFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKGER  126

Query  511  THWVIHEYRTTENKFDGT  564
            T+W++HEYR T  + DGT
Sbjct  127  TNWIMHEYRPTTKELDGT  144



>ref|NP_001280864.1| uncharacterized LOC103438687 [Malus domestica]
 gb|ADL36810.1| NAC domain class transcription factor [Malus domestica]
Length=850

 Score =   218 bits (554),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 7/147 (5%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+C+ EPWDLP +S ++S D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPKLSVIKSDDQ  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  483
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV+Y
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSNGQVGMKKTLVFY  125

Query  484  LGRAPEGKRTHWVIHEYRTTENKFDGT  564
             GRAP+G+RT W++HEYR T+ + DGT
Sbjct  126  RGRAPKGERTSWIMHEYRATQKELDGT  152



>ref|XP_002321956.2| hypothetical protein POPTR_0015s00640g [Populus trichocarpa]
 gb|EEF06083.2| hypothetical protein POPTR_0015s00640g [Populus trichocarpa]
Length=588

 Score =   214 bits (545),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 95/154 (62%), Positives = 117/154 (76%), Gaps = 8/154 (5%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL +         +SLP+G+RFRP+D+ELVD+YL++KI G +  V VIRE+D+CK EP
Sbjct  1    MAVLSMN-------FNSLPLGFRFRPSDKELVDYYLRLKINGDDDGVKVIREIDVCKWEP  53

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLPD+S +++ D EWFFFCP DRKY NG R NRAT  GYWKATG DR I S     +GM
Sbjct  54   WDLPDLSIIKNKDPEWFFFCPLDRKYPNGSRQNRATNAGYWKATGNDRKIKSGNNL-IGM  112

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLV+Y GRAP+GKRT+WV+HEYR TE + DGT
Sbjct  113  KKTLVFYTGRAPKGKRTNWVMHEYRATEEELDGT  146



>ref|XP_010103069.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB94718.1| NAC domain-containing protein 78 [Morus notabilis]
Length=602

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 121/155 (78%), Gaps = 9/155 (6%)
 Frame = +1

Query  100  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  279
            EMAVL          L+SLP+G+RFRPTDEELVD+YL++KI G    VSVIRE+D+CK E
Sbjct  5    EMAVLSS--------LNSLPLGFRFRPTDEELVDYYLRLKINGEVQLVSVIREIDVCKLE  56

Query  280  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVG  459
            PWDLPD+S + + D EWFFFCP+DRKY NG RLNRAT+ GYWKATG+DR I S    ++G
Sbjct  57   PWDLPDLSMIPTRDPEWFFFCPQDRKYPNGHRLNRATKAGYWKATGRDRKIKSGT-LQIG  115

Query  460  MKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            MKKTLV+Y GRAP+GKRT+WV+HEYR T  + DGT
Sbjct  116  MKKTLVFYTGRAPKGKRTNWVMHEYRPTLQELDGT  150



>ref|XP_002300524.2| hypothetical protein POPTR_0001s45700g [Populus trichocarpa]
 gb|EEE85329.2| hypothetical protein POPTR_0001s45700g [Populus trichocarpa]
Length=636

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 116/144 (81%), Gaps = 4/144 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+D+CK EPWDLP  S +++ D 
Sbjct  4    MDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDVCKWEPWDLPGQSVIKTDDP  63

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLGR  492
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SRK A     +GMKKTLV+Y GR
Sbjct  64   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRGR  123

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+GKRT+W++HEYR TE   DGT
Sbjct  124  APKGKRTNWIMHEYRPTEEDLDGT  147



>ref|XP_007039234.1| NAC domain class transcription factor, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23735.1| NAC domain class transcription factor, putative isoform 2 [Theobroma 
cacao]
Length=496

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 115/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEA-EVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLPVG+RFRPTDEEL+D YL+ KI G+   EV VIRE+D+CK EPWDLPD+S + + D
Sbjct  6    LNSLPVGFRFRPTDEELIDFYLRSKINGNRTDEVGVIREIDVCKWEPWDLPDLSAIATRD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S   + +GMKKTLV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSSLIGMKKTLVFYTGRAPR  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT ++ DGT
Sbjct  125  GKRTNWVMHEYRTTLDELDGT  145



>gb|AGL39711.1| NAC transcription factor 055 [Jatropha curcas]
 gb|KDP25178.1| hypothetical protein JCGZ_20334 [Jatropha curcas]
Length=605

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 13/158 (8%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL +E         SLP+G+RFRPTDEELV+HYL++KI G  +EV VI EVDICK EP
Sbjct  1    MAVLSME---------SLPLGFRFRPTDEELVNHYLRLKINGRNSEVEVIPEVDICKWEP  51

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA----  450
            WDLP++S +++ D EWFFFCP+DRKY NGQR NRAT+ GYWKATGKDRTI SRK      
Sbjct  52   WDLPELSVIKTDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIKSRKSGSNPI  111

Query  451  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
             +GMKKTLV+Y GRAP+G+RT+W++HEYR T    DG+
Sbjct  112  SIGMKKTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGS  149



>ref|XP_011004351.1| PREDICTED: uncharacterized protein LOC105110869 isoform X2 [Populus 
euphratica]
Length=678

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W++HEYR TE   +GT
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGT  150



>ref|XP_008462914.1| PREDICTED: NAC domain-containing protein 74 [Cucumis melo]
Length=597

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 118/141 (84%), Gaps = 3/141 (2%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEEL+D+YL+ KI G+  +VSVIREVD+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSIIKTKDP  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  501
            EWFFFCP+DRKY NG RL RAT  GYWKATGKDR I S  G K +GMKKTLV+Y GRAP+
Sbjct  66   EWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIKS--GTKLIGMKKTLVFYKGRAPK  123

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT  + DGT
Sbjct  124  GKRTNWVVHEYRTTLKELDGT  144



>ref|XP_011004356.1| PREDICTED: uncharacterized protein LOC105110869 isoform X6 [Populus 
euphratica]
Length=669

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W++HEYR TE   +GT
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGT  150



>ref|XP_009351898.1| PREDICTED: uncharacterized protein LOC103943342 [Pyrus x bretschneideri]
Length=546

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL+D+YL+ KI G+  +V+VIRE+D+CK EPWDLP +S +++ D 
Sbjct  11   MDSLPLGFRFRPTDEELIDYYLRSKINGNHGQVAVIREIDVCKWEPWDLPGLSVIQTTDP  70

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT +GYWKATGKDR I S K   +GMKKTLV++ GRAP+G
Sbjct  71   EWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDK-ILIGMKKTLVFHTGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYRTT+ + DGT
Sbjct  130  KRTNWVMHEYRTTQKELDGT  149



>ref|XP_007039233.1| NAC domain class transcription factor, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23734.1| NAC domain class transcription factor, putative isoform 1 [Theobroma 
cacao]
Length=576

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 115/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEA-EVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLPVG+RFRPTDEEL+D YL+ KI G+   EV VIRE+D+CK EPWDLPD+S + + D
Sbjct  6    LNSLPVGFRFRPTDEELIDFYLRSKINGNRTDEVGVIREIDVCKWEPWDLPDLSAIATRD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S   + +GMKKTLV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSSLIGMKKTLVFYTGRAPR  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT ++ DGT
Sbjct  125  GKRTNWVMHEYRTTLDELDGT  145



>ref|XP_011004352.1| PREDICTED: uncharacterized protein LOC105110869 isoform X3 [Populus 
euphratica]
Length=674

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W++HEYR TE   +GT
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGT  150



>ref|XP_011038026.1| PREDICTED: uncharacterized protein LOC105135051 [Populus euphratica]
Length=639

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 116/144 (81%), Gaps = 4/144 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  7    IDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDVCKREPWDLPGLSVIKTDDP  66

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLGR  492
            EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y GR
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRGR  126

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR TE   DGT
Sbjct  127  APKGERTNWIMHEYRPTEKDLDGT  150



>ref|XP_011004350.1| PREDICTED: uncharacterized protein LOC105110869 isoform X1 [Populus 
euphratica]
Length=699

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W++HEYR TE   +GT
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGT  150



>ref|XP_011004357.1| PREDICTED: uncharacterized protein LOC105110869 isoform X7 [Populus 
euphratica]
Length=647

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W++HEYR TE   +GT
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGT  150



>ref|XP_011004354.1| PREDICTED: uncharacterized protein LOC105110869 isoform X4 [Populus 
euphratica]
Length=674

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W++HEYR TE   +GT
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGT  150



>ref|XP_011004355.1| PREDICTED: uncharacterized protein LOC105110869 isoform X5 [Populus 
euphratica]
Length=672

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W++HEYR TE   +GT
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGT  150



>gb|AFK41148.1| unknown [Medicago truncatula]
Length=642

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 119/156 (76%), Gaps = 12/156 (8%)
 Frame = +1

Query  100  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  279
            E+AVL          L+ LP+G+RFRPTDEELVD YL+MKI G+  EV VIREVD+CK E
Sbjct  16   ELAVLS---------LNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFE  66

Query  280  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-V  456
            PWDLPD+S V + D EWFFFCP DRKY NG RLNRAT  GYWKATGKDR I S  GA  +
Sbjct  67   PWDLPDLSIVRNKDPEWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIKS--GATLI  124

Query  457  GMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            GMKKTLV+Y GRAP+G+RTHW++HEYR T  + DGT
Sbjct  125  GMKKTLVFYAGRAPKGQRTHWIMHEYRPTLKELDGT  160



>ref|XP_008234624.1| PREDICTED: NAC domain-containing protein 7-like [Prunus mume]
Length=548

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 122/156 (78%), Gaps = 10/156 (6%)
 Frame = +1

Query  97   VEMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKH  276
            V+M VL           ++LP+G+RFRPTDEEL+D+YL+ KI G+  +V+VIRE+D+CK 
Sbjct  4    VDMTVLST---------NTLPLGFRFRPTDEELIDYYLRSKINGNHKQVTVIREIDVCKW  54

Query  277  EPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKV  456
            EPWDLPD+S + + D EWFFFCP+DRKY NG RLNRAT RGYWKATGKDR I S     +
Sbjct  55   EPWDLPDLSVIRTTDPEWFFFCPQDRKYPNGHRLNRATGRGYWKATGKDRQIKS-ATILI  113

Query  457  GMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            GMKKTLV++ GRAP+GKRT+WV+HEYRTT+ + DGT
Sbjct  114  GMKKTLVFHTGRAPKGKRTNWVMHEYRTTQKELDGT  149



>ref|XP_007039299.1| NAC domain-containing protein 78, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23800.1| NAC domain-containing protein 78, putative isoform 1 [Theobroma 
cacao]
Length=655

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 122/154 (79%), Gaps = 10/154 (6%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL +E         +LP+G+RFRPTDEEL++HYLK+KI G  +EV VI E+D+CK EP
Sbjct  1    MAVLTME---------TLPLGFRFRPTDEELINHYLKLKINGRHSEVEVIPEIDVCKWEP  51

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLP +S ++S D EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GM
Sbjct  52   WDLPGLSVIKSDDPEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGM  110

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLV+Y GRAP+G+RT+W++HEYR T    DGT
Sbjct  111  KKTLVFYKGRAPKGQRTNWIMHEYRATAKDLDGT  144



>ref|XP_008245853.1| PREDICTED: uncharacterized protein LOC103344010, partial [Prunus 
mume]
Length=826

 Score =   215 bits (547),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 93/147 (63%), Positives = 115/147 (78%), Gaps = 7/147 (5%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYLK+KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MDSLPLGFRFRPTDEELINHYLKLKINGRNSEVQVIPEIDVCKWEPWDLPKLSVIKSDDQ  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  483
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV++
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSTGQVGMKKTLVFH  125

Query  484  LGRAPEGKRTHWVIHEYRTTENKFDGT  564
             GRAP G+RT W++HEYR T+   DGT
Sbjct  126  RGRAPRGERTSWIMHEYRATQKDLDGT  152



>ref|XP_004156529.1| PREDICTED: NAC domain-containing protein 74-like [Cucumis sativus]
 gb|KGN53626.1| hypothetical protein Csa_4G091920 [Cucumis sativus]
Length=606

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 3/141 (2%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEEL+D+YL+ KI G+  +VSVIREVD+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSIIKTKDP  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  501
            EWFFFCP+DRKY NG RL RAT  GYWKATGKDR I S  G K +GMKKTLV+Y GRAP+
Sbjct  66   EWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIKS--GTKLIGMKKTLVFYKGRAPK  123

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYR T  + DGT
Sbjct  124  GKRTNWVVHEYRATLKELDGT  144



>ref|XP_004137298.1| PREDICTED: NAC domain-containing protein 74-like [Cucumis sativus]
Length=596

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 3/141 (2%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEEL+D+YL+ KI G+  +VSVIREVD+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSIIKTKDP  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  501
            EWFFFCP+DRKY NG RL RAT  GYWKATGKDR I S  G K +GMKKTLV+Y GRAP+
Sbjct  66   EWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIKS--GTKLIGMKKTLVFYKGRAPK  123

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYR T  + DGT
Sbjct  124  GKRTNWVVHEYRATLKELDGT  144



>ref|XP_007039300.1| NAC domain-containing protein 78, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23801.1| NAC domain-containing protein 78, putative isoform 2 [Theobroma 
cacao]
Length=658

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = +1

Query  136  LPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES  315
            LP   S P+G+RFRPTDEEL++HYLK+KI G  +EV VI E+D+CK EPWDLP +S ++S
Sbjct  6    LPSDVSSPLGFRFRPTDEELINHYLKLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKS  65

Query  316  HDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRA  495
             D EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRA
Sbjct  66   DDPEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRA  124

Query  496  PEGKRTHWVIHEYRTTENKFDGT  564
            P+G+RT+W++HEYR T    DGT
Sbjct  125  PKGQRTNWIMHEYRATAKDLDGT  147



>ref|XP_002518952.1| transcription factor, putative [Ricinus communis]
 gb|EEF43485.1| transcription factor, putative [Ricinus communis]
Length=615

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 13/158 (8%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL +E         SLP+G+RFRPTDEEL++HYL++KI G ++EV VI EVD+CK EP
Sbjct  1    MAVLHME---------SLPLGFRFRPTDEELINHYLRLKINGRDSEVDVISEVDVCKWEP  51

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK---  453
            WDLP +S +++ D EWFFFCP+DRKY NGQR NRAT+ GYWKATGKDRTI +RK      
Sbjct  52   WDLPGLSVIKTDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRARKSGSNPI  111

Query  454  -VGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
             +GMKKTLV+Y GRAP+G+RT+W++HEYR T    DG+
Sbjct  112  CIGMKKTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGS  149



>ref|XP_007210371.1| hypothetical protein PRUPE_ppa001291mg [Prunus persica]
 gb|EMJ11570.1| hypothetical protein PRUPE_ppa001291mg [Prunus persica]
Length=862

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 115/147 (78%), Gaps = 7/147 (5%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYLK+KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MDSLPLGFRFRPTDEELINHYLKLKINGRNSEVQVIPEIDVCKWEPWDLPKLSVIKSDDQ  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  483
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV+Y
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSTGQVGMKKTLVFY  125

Query  484  LGRAPEGKRTHWVIHEYRTTENKFDGT  564
             GRAP G+RT W++HEYR T+   DGT
Sbjct  126  RGRAPRGERTSWIMHEYRATQKDLDGT  152



>emb|CAN73792.1| hypothetical protein VITISV_034893 [Vitis vinifera]
Length=720

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 17/194 (9%)
 Frame = +1

Query  4    FISVFLLKNTGRHIRI--SLPPS-----LFLSLCELCGVEMAVLKVERPTGLPPLHSLPV  162
            F+S   +++  RH+ +  SL PS     +  +L  L    MAVL           +SLP+
Sbjct  36   FLSALEVESDVRHLCVATSLGPSHNPFYIPSTLLLLNFPRMAVLS---------FNSLPL  86

Query  163  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC  342
            G+RFRPTDEEL+ HYL++KI+G++ EV VIRE+D+CK EPWDLPD+S + ++D EWFFFC
Sbjct  87   GFRFRPTDEELITHYLRLKISGNDEEVRVIREIDVCKWEPWDLPDLSEIRTNDMEWFFFC  146

Query  343  PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV  522
            P+DRKY NG RLNRAT  GYWKATG+DR I S K   VGMKKTLV++ GRAP GKRT WV
Sbjct  147  PRDRKYPNGHRLNRATAAGYWKATGRDRQIKS-KTRLVGMKKTLVFHTGRAPHGKRTVWV  205

Query  523  IHEYRTTENKFDGT  564
            +HEYR T  + DGT
Sbjct  206  MHEYRATAKELDGT  219



>ref|XP_010662939.1| PREDICTED: NAC domain-containing protein 77 [Vitis vinifera]
 emb|CBI23105.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
             +SLP+G+RFRPTDEEL+ HYL++KI+G++ EV VIRE+D+CK EPWDLPD+S + ++D 
Sbjct  6    FNSLPLGFRFRPTDEELITHYLRLKISGNDEEVRVIREIDVCKWEPWDLPDLSEIRTNDM  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATG+DR I S K   VGMKKTLV++ GRAP G
Sbjct  66   EWFFFCPRDRKYPNGHRLNRATAAGYWKATGRDRQIKS-KTRLVGMKKTLVFHTGRAPHG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT WV+HEYR T  + DGT
Sbjct  125  KRTVWVMHEYRATAKELDGT  144



>ref|XP_011003272.1| PREDICTED: NAC domain-containing protein 45-like isoform X1 [Populus 
euphratica]
Length=601

 Score =   210 bits (535),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 90/134 (67%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +1

Query  163  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC  342
            G+RFRP+DEELVD+YL++KI G +  V VIRE+D+CK EPWDLPD+S +++ D EWFFFC
Sbjct  14   GFRFRPSDEELVDYYLRLKINGDDDGVRVIREIDVCKWEPWDLPDLSIIKNKDPEWFFFC  73

Query  343  PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV  522
            P DRKY NG R NRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+GKRT+WV
Sbjct  74   PLDRKYPNGSRQNRATNAGYWKATGKDRKIKSGNNL-IGMKKTLVFYTGRAPKGKRTNWV  132

Query  523  IHEYRTTENKFDGT  564
            +HEYR TE + DGT
Sbjct  133  MHEYRATEEELDGT  146



>gb|AES72662.2| M20/M25/M40 family peptidase [Medicago truncatula]
Length=312

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLP+G+RFRPTDEEL+D+YL++KI G+  EV VIRE+D+CK EPWD+PD+S ++ +D 
Sbjct  105  LISLPLGFRFRPTDEELIDYYLRLKINGNGDEVQVIREIDVCKWEPWDMPDLSVIKDNDP  164

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DR+Y NG RLNR T  GYWKATGKDR I S     +GMKKTLV+Y+ RAP G
Sbjct  165  EWFFFCPQDRQYPNGNRLNRETNHGYWKATGKDRKIKSGT-ILIGMKKTLVFYISRAPNG  223

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +R++WV+HEYR T  + DGT
Sbjct  224  RRSNWVMHEYRPTLEELDGT  243



>ref|XP_008360722.1| PREDICTED: uncharacterized protein LOC103424418 [Malus domestica]
Length=859

 Score =   213 bits (542),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 7/147 (5%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+C+ EPWDLP +S ++S D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGHDSEVQVIPEIDVCRWEPWDLPKLSVIKSDDQ  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  483
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV+Y
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKFATNSNGQVGMKKTLVFY  125

Query  484  LGRAPEGKRTHWVIHEYRTTENKFDGT  564
             GRAP+G+RT W++HEYR T+ + DGT
Sbjct  126  RGRAPKGERTSWIMHEYRATQKELDGT  152



>ref|XP_007136363.1| hypothetical protein PHAVU_009G039000g [Phaseolus vulgaris]
 gb|ESW08357.1| hypothetical protein PHAVU_009G039000g [Phaseolus vulgaris]
Length=587

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLP+G+RFRPTDEEL+D+YL+ KI G+ AEV VIRE+D+CK EPWD+PD+S V + D 
Sbjct  19   LDSLPLGFRFRPTDEELIDYYLRQKINGNGAEVWVIREIDVCKWEPWDMPDLSVVRNKDP  78

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATTHGYWKATGKDRRIKSGM-MLIGMKKTLVFYTGRAPKG  137

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T  + DGT
Sbjct  138  KRTNWVMHEYRPTLKELDGT  157



>ref|XP_011003273.1| PREDICTED: NAC domain-containing protein 45-like isoform X2 [Populus 
euphratica]
Length=588

 Score =   210 bits (534),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 90/134 (67%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +1

Query  163  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC  342
            G+RFRP+DEELVD+YL++KI G +  V VIRE+D+CK EPWDLPD+S +++ D EWFFFC
Sbjct  14   GFRFRPSDEELVDYYLRLKINGDDDGVRVIREIDVCKWEPWDLPDLSIIKNKDPEWFFFC  73

Query  343  PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV  522
            P DRKY NG R NRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+GKRT+WV
Sbjct  74   PLDRKYPNGSRQNRATNAGYWKATGKDRKIKSGNNL-IGMKKTLVFYTGRAPKGKRTNWV  132

Query  523  IHEYRTTENKFDGT  564
            +HEYR TE + DGT
Sbjct  133  MHEYRATEEELDGT  146



>ref|XP_011470170.1| PREDICTED: NAC domain-containing protein 86 [Fragaria vesca subsp. 
vesca]
Length=579

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G+  L SLP+G+RFRPTDEEL++ YL+ KI G + EVSVIRE+D+C+ EPWDLPD+S ++
Sbjct  6    GVVSLSSLPLGFRFRPTDEELIEFYLRSKINGRDKEVSVIREIDVCRWEPWDLPDLSVIQ  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLG  489
            + D EWFFFCP+D+KY NG RLNRAT  GYWKATGKDR I S  GA  VGMKKTLV++ G
Sbjct  66   TQDPEWFFFCPQDKKYPNGFRLNRATIAGYWKATGKDRRIKS--GANLVGMKKTLVFHKG  123

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+GKRT+WV+HEYR T+ + DGT
Sbjct  124  RAPKGKRTNWVMHEYRATQKELDGT  148



>ref|XP_010525539.1| PREDICTED: NAC domain-containing protein 67-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010525540.1| PREDICTED: NAC domain-containing protein 67-like isoform X2 [Tarenaya 
hassleriana]
Length=464

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTDEELV +YL++KI G + +V +IREVDICK EPWDLPD+S V++ D+
Sbjct  6    LDSLPVGLRFRPTDEELVRYYLRLKINGHDDDVRIIREVDICKWEPWDLPDLSVVKTKDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R+NRAT  GYWKATGKDR + S K + +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPNGSRMNRATVAGYWKATGKDRNVKSVKNSIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDG  561
             RT WV+HEYR TE   DG
Sbjct  126  TRTCWVMHEYRATEKDLDG  144



>ref|XP_009360232.1| PREDICTED: uncharacterized protein LOC103950728 [Pyrus x bretschneideri]
Length=854

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 7/147 (5%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+C+ EPWDLP +S ++S D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPKLSVIKSDDQ  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  483
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV+Y
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSNGQVGMKKTLVFY  125

Query  484  LGRAPEGKRTHWVIHEYRTTENKFDGT  564
             GRAP+G+RT W++HEYR T+ + DGT
Sbjct  126  RGRAPKGERTSWIMHEYRATQKELDGT  152



>ref|XP_010104895.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXC02131.1| NAC domain-containing protein 78 [Morus notabilis]
Length=744

 Score =   212 bits (539),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 94/151 (62%), Positives = 115/151 (76%), Gaps = 7/151 (5%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   L SLP+G+RFRPTDEEL++HYL++KI G  A+V VI E+D+CK EPWDLP  S ++
Sbjct  2    GTVSLESLPLGFRFRPTDEELINHYLRLKINGRNADVHVIPEIDVCKREPWDLPRQSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKT  471
            + D EWFFFCP+DRKY NGQR NRAT+ GYWKATGKDRTI SR           +GMKKT
Sbjct  62   TDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRSRSYRSASNTNGLIGMKKT  121

Query  472  LVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            LV+Y GRAP+G+RT+W++HEYR T    DGT
Sbjct  122  LVFYRGRAPKGERTNWIMHEYRPTLKDLDGT  152



>gb|KHG02383.1| NAC domain-containing 74 [Gossypium arboreum]
Length=876

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    METLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDP  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T  + DGT
Sbjct  125  ERTNWIMHEYRPTTRELDGT  144



>gb|AIA57515.1| NAC domain-containing protein [Boehmeria nivea]
Length=644

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 116/151 (77%), Gaps = 7/151 (5%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   L SLP+G+RFRPTDEEL++HYL++K+ G  A+V VI E+D+CK EPWDLP +S ++
Sbjct  2    GTVTLESLPLGFRFRPTDEELINHYLRLKVNGRHADVHVIPEIDVCKWEPWDLPSLSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKT  471
            + D EWFFFCP+DRKY NGQR NRAT+ GYWKATGKDRTI SR           +GMKKT
Sbjct  62   TDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRSRAYRSPSNTNGLIGMKKT  121

Query  472  LVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            LV+Y GRAP+G+RTHW++HEYR T    DGT
Sbjct  122  LVFYRGRAPKGERTHWIMHEYRPTLKDLDGT  152



>ref|XP_011070419.1| PREDICTED: NAC domain-containing protein 4-like [Sesamum indicum]
 ref|XP_011070420.1| PREDICTED: NAC domain-containing protein 4-like [Sesamum indicum]
Length=590

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 115/148 (78%), Gaps = 8/148 (5%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L +LP G+RFRPTDEELV+HYL++KI G  + V VI EVD+CK EPWDLP +S ++S D 
Sbjct  10   LEALPKGFRFRPTDEELVNHYLRLKINGRHSAVEVIPEVDVCKWEPWDLPALSVIKSDDR  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKKTLVY  480
            EWFFFCP+D+KY NG R NRATE GYWKATGKDRTI SRK +         +GMKKTLV+
Sbjct  70   EWFFFCPRDKKYPNGHRSNRATEAGYWKATGKDRTIKSRKSSSSGWANPHLIGMKKTLVF  129

Query  481  YLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            Y GRAP+G+RT+W++HEYR TE   DGT
Sbjct  130  YKGRAPKGERTNWIMHEYRATEQDLDGT  157



>gb|KJB52428.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=859

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDL  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T  + DGT
Sbjct  125  ERTNWIMHEYRPTTKELDGT  144



>ref|XP_010660382.1| PREDICTED: uncharacterized protein LOC104877280 [Vitis vinifera]
 emb|CBI34627.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEEL++HYLK+KI G  +EV VIRE+D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELINHYLKLKIEGRHSEVEVIRELDVCKWEPWDLPGLSMIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-GAKVGMKKTLVYYLG  489
            + D EWFFFCP+DRKY NG+R NRAT+ GYWKATGKDRTI SRK  A +GMKKTLV+Y G
Sbjct  62   ADDPEWFFFCPRDRKYPNGRRSNRATDAGYWKATGKDRTIKSRKSSASIGMKKTLVFYKG  121

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+G+RT+W+ HEYR  ++  D +
Sbjct  122  RAPKGQRTNWIFHEYRVIDSASDSS  146



>ref|NP_001276287.1| NAC domain protein [Glycine max]
 gb|AGO14647.1| NAC transcription factor [Glycine max]
Length=589

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +1

Query  130  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV  309
            T +  L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V
Sbjct  13   TAVLSLNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVV  72

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
             + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  73   RNKDPEWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIKS-GSTLIGMKKTLVFYTG  131

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+GKRT+WV+HEYR T  + DGT
Sbjct  132  RAPKGKRTNWVMHEYRPTLKELDGT  156



>gb|KJB52425.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=654

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDL  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T  + DGT
Sbjct  125  ERTNWIMHEYRPTTKELDGT  144



>gb|KJB52427.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=790

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDL  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T  + DGT
Sbjct  125  ERTNWIMHEYRPTTKELDGT  144



>gb|KJB52426.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=721

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDL  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T  + DGT
Sbjct  125  ERTNWIMHEYRPTTKELDGT  144



>gb|KDO76787.1| hypothetical protein CISIN_1g009388mg [Citrus sinensis]
Length=536

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 12/150 (8%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAV+ +E         SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EP
Sbjct  1    MAVISME---------SLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEP  51

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AK  453
            WDLP +S +++ D EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK    A 
Sbjct  52   WDLPGLSVIKTEDPEWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKAGTNAC  111

Query  454  VGMKKTLVYYLGRAPEGKRTHWVIHEYRTT  543
            +GMKKTLV+Y GRAP+G+RT+W++HEYR T
Sbjct  112  IGMKKTLVFYRGRAPKGERTNWIMHEYRPT  141



>gb|KJB39512.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
 gb|KJB39513.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
Length=397

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLP+G RFRPTDEEL+D YL+ K+ G  + E+ VIREVD+CK EPWDLP +S V+  D
Sbjct  6    LNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSAVKGRD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S     +GMKKTLV+Y GRAP+
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSCLIGMKKTLVFYTGRAPK  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT ++ DGT
Sbjct  125  GKRTNWVMHEYRTTLDELDGT  145



>gb|KJB18878.1| hypothetical protein B456_003G073300 [Gossypium raimondii]
Length=547

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 120/154 (78%), Gaps = 10/154 (6%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL +E         +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EP
Sbjct  1    MAVLTME---------TLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEP  51

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLP +S ++S D EWFFFCP DRKY N  R NRAT++GYWKATGKDRTI S+K + +GM
Sbjct  52   WDLPGLSVIKSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKK-SLIGM  110

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLV+Y GRAP+G+RT+W++HEYR T    DGT
Sbjct  111  KKTLVFYKGRAPKGQRTYWIMHEYRPTTEDLDGT  144



>ref|XP_010519577.1| PREDICTED: NAC domain-containing protein 67-like [Tarenaya hassleriana]
Length=488

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTDEELV +YL+MKI G + +V +IREVDICK EPWDLPDMS V++ D+
Sbjct  6    LDSLPVGLRFRPTDEELVRYYLRMKINGHDDDVRIIREVDICKWEPWDLPDMSVVKTKDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R+NRAT  GYWKATGKDR I S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPNGSRMNRATVAGYWKATGKDRKIKSVNKNIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT WV+HEYR TE    GT
Sbjct  126  ARTCWVMHEYRATEKDLAGT  145



>gb|KHN46203.1| NAC domain-containing protein 78 [Glycine soja]
Length=588

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V + D 
Sbjct  17   LNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVVRNKDP  76

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  77   EWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIKS-GSTLIGMKKTLVFYTGRAPKG  135

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T  + DGT
Sbjct  136  KRTNWVMHEYRPTLKELDGT  155



>ref|XP_007141360.1| hypothetical protein PHAVU_008G189100g [Phaseolus vulgaris]
 gb|ESW13354.1| hypothetical protein PHAVU_008G189100g [Phaseolus vulgaris]
Length=569

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +1

Query  130  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV  309
            T +  L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V
Sbjct  14   TAVLSLNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVV  73

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
             + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  74   RNKDPEWFFFCPQDRKYPNGHRLNRATSLGYWKATGKDRRIKS-GSTLIGMKKTLVFYTG  132

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+GKRT+WV+HEYR T  + DGT
Sbjct  133  RAPKGKRTNWVMHEYRPTLKELDGT  157



>ref|XP_006596412.1| PREDICTED: NAC domain-containing protein 12-like [Glycine max]
Length=590

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +1

Query  130  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV  309
            T +  L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V
Sbjct  13   TAVLSLNTLPLGFRFRPTDEELIDYYLRSKINGNSDDVWVIREIDVCKWEPWDLPDLSVV  72

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
             + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  73   RNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIKS-GSTLIGMKKTLVFYTG  131

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+GKRT+WV+HEYR T  + +GT
Sbjct  132  RAPKGKRTNWVMHEYRPTLKELEGT  156



>ref|XP_003602412.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES72663.1| NAC transcription factor-like protein [Medicago truncatula]
Length=593

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  109  VLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWD  288
            V  V+    +  L+SLP+G+RFRPTDEEL+D+YL+ KI G+  EV VIRE+D+CK EPWD
Sbjct  7    VPSVDDGMAVLSLNSLPLGFRFRPTDEELIDYYLRSKINGNGDEVWVIREIDVCKWEPWD  66

Query  289  LPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKK  468
            +PD+S V + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKK
Sbjct  67   MPDLSVVRNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIKS-GTILIGMKK  125

Query  469  TLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            TLV+Y GRAP+GKRT+WV+HEYR T  + DGT
Sbjct  126  TLVFYSGRAPKGKRTNWVMHEYRPTLKELDGT  157



>gb|KHN40025.1| NAC domain-containing protein 78 [Glycine soja]
Length=590

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +1

Query  130  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV  309
            T +  L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V
Sbjct  13   TAVLSLNTLPLGFRFRPTDEELIDYYLRSKINGNSDDVWVIREIDVCKWEPWDLPDLSVV  72

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
             + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  73   RNKDPEWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIKS-GSTLIGMKKTLVFYTG  131

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP+GKRT+WV+HEYR T  + +GT
Sbjct  132  RAPKGKRTNWVMHEYRPTLKELEGT  156



>ref|XP_003602413.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES72664.1| NAC transcription factor-like protein [Medicago truncatula]
Length=620

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  109  VLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWD  288
            V  V+    +  L+SLP+G+RFRPTDEEL+D+YL+ KI G+  EV VIRE+D+CK EPWD
Sbjct  7    VPSVDDGMAVLSLNSLPLGFRFRPTDEELIDYYLRSKINGNGDEVWVIREIDVCKWEPWD  66

Query  289  LPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKK  468
            +PD+S V + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKK
Sbjct  67   MPDLSVVRNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIKS-GTILIGMKK  125

Query  469  TLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            TLV+Y GRAP+GKRT+WV+HEYR T  + DGT
Sbjct  126  TLVFYSGRAPKGKRTNWVMHEYRPTLKELDGT  157



>ref|XP_010529684.1| PREDICTED: NAC domain-containing protein 86 [Tarenaya hassleriana]
Length=637

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI EVD+CK EPWDLP +S +++ D 
Sbjct  8    VEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEVDVCKWEPWDLPGLSVIKTDDQ  67

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K A VGMKKTLV+Y GRAP G
Sbjct  68   EWFFFCPRDRKYPSGHRSNRATDTGYWKATGKDRTIKSKKMA-VGMKKTLVFYRGRAPRG  126

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T+   DG 
Sbjct  127  ERTNWIMHEYRATDKDLDGN  146



>ref|XP_010533527.1| PREDICTED: uncharacterized protein LOC104809290 [Tarenaya hassleriana]
Length=644

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +1

Query  121  ERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDM  300
            ER  G   + SLP+G+RFRPTDEEL++HYL +KI G  ++V VI EVD+CK EPWDLP +
Sbjct  17   EREMGAMSMESLPLGFRFRPTDEELINHYLCLKINGRHSDVQVIPEVDVCKWEPWDLPSL  76

Query  301  SFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVY  480
            S +++ D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+
Sbjct  77   SVIKTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRTIKSKK-TLIGMKKTLVF  135

Query  481  YLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            Y GRAP+G+RT+W++HEYR T+ + DG+
Sbjct  136  YRGRAPKGERTNWIMHEYRPTQKELDGS  163



>ref|XP_002317831.2| hypothetical protein POPTR_0012s00760g [Populus trichocarpa]
 gb|EEE96051.2| hypothetical protein POPTR_0012s00760g [Populus trichocarpa]
Length=608

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRP+DEELV++YL+ KI G + +V VIRE+D+CK EPWDLP +S +E+ D 
Sbjct  8    LNSLPLGFRFRPSDEELVNYYLRHKINGKDDKVRVIREIDVCKWEPWDLPGLSIIENKDP  67

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP DRKY NG R NRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  68   EWFFFCPLDRKYPNGSRQNRATNAGYWKATGKDRKIKS-GNRLIGMKKTLVFYTGRAPKG  126

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR TE + DGT
Sbjct  127  KRTNWVVHEYRATEEELDGT  146



>ref|XP_006306958.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39856.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=657

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  125  APRGERTNWIMHEYRATDKELDGT  148



>ref|XP_006306957.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39855.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=655

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  125  APRGERTNWIMHEYRATDKELDGT  148



>ref|XP_006306959.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39857.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=658

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  125  APRGERTNWIMHEYRATDKELDGT  148



>ref|XP_004514021.1| PREDICTED: uncharacterized protein LOC101501154 [Cicer arietinum]
Length=610

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 118/155 (76%), Gaps = 10/155 (6%)
 Frame = +1

Query  100  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  279
            EMAVL          L+ LP+G+RFRPTDEEL+D YL++KI G+  EV VIRE+D+CK E
Sbjct  14   EMAVLS---------LNKLPLGFRFRPTDEELIDFYLRLKINGNGDEVWVIREIDVCKWE  64

Query  280  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVG  459
            PWDLPD+S V + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +G
Sbjct  65   PWDLPDLSVVRNKDPEWFFFCPQDRKYPNGSRLNRATNHGYWKATGKDRKIKSGP-TLIG  123

Query  460  MKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            MKKTLV++ GRAP+GKRT+WV+HEYR T  + DGT
Sbjct  124  MKKTLVFHAGRAPKGKRTNWVMHEYRPTLKELDGT  158



>ref|XP_004309509.1| PREDICTED: uncharacterized protein LOC101295292 [Fragaria vesca 
subsp. vesca]
Length=713

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 16/161 (10%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL +E         SLP+G+RFRPTDEEL++HYL++KI G  +EV VI ++D+CK EP
Sbjct  1    MAVLSME---------SLPLGFRFRPTDEELINHYLRLKINGRHSEVQVIPDIDVCKWEP  51

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK------  444
            WDLP +S ++S D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+      
Sbjct  52   WDLPKLSMIKSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRRFKSAAN  111

Query  445  -GAKVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
                VGMKKTLV+Y GRAP+G+RT W++HEYR T+ + DGT
Sbjct  112  STGLVGMKKTLVFYKGRAPKGERTSWIMHEYRPTQKELDGT  152



>ref|XP_010499854.1| PREDICTED: NAC domain-containing protein 86-like isoform X3 [Camelina 
sativa]
Length=664

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  125  APRGERTNWIMHEYRATDKELDGT  148



>ref|XP_010499852.1| PREDICTED: NAC domain-containing protein 86-like isoform X1 [Camelina 
sativa]
Length=668

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  125  APRGERTNWIMHEYRATDKELDGT  148



>ref|XP_010499853.1| PREDICTED: NAC domain-containing protein 86-like isoform X2 [Camelina 
sativa]
Length=667

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  125  APRGERTNWIMHEYRATDKELDGT  148



>gb|KJB24042.1| hypothetical protein B456_004G125900 [Gossypium raimondii]
Length=455

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLP+G+RFRPTDEEL+  YL+ KI G    EV VIRE+D+CK EPWDLP MS +++ D
Sbjct  6    LNSLPIGFRFRPTDEELIHFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSAIQTRD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S   + +GMKK+LV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSSLIGMKKSLVFYTGRAPR  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT  + DGT
Sbjct  125  GKRTNWVMHEYRTTLIELDGT  145



>ref|XP_004502779.1| PREDICTED: uncharacterized protein LOC101492664 [Cicer arietinum]
Length=612

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L+SLP+G+RFRPTDEEL+D+YL+ KI G+  EV VIRE+D+CK EPWD+PD+S + + D 
Sbjct  20   LNSLPLGFRFRPTDEELIDYYLRQKINGNGDEVWVIREIDVCKWEPWDMPDLSVIRNKDP  79

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  80   EWFFFCPQDRKYPNGHRLNRATTHGYWKATGKDRKIKSGT-ILIGMKKTLVFYSGRAPKG  138

Query  505  KRTHWVIHEYRTTENKFDGT  564
            KRT+WV+HEYR T  + DGT
Sbjct  139  KRTNWVMHEYRPTLKELDGT  158



>ref|XP_006439176.1| hypothetical protein CICLE_v10019282mg [Citrus clementina]
 gb|ESR52416.1| hypothetical protein CICLE_v10019282mg [Citrus clementina]
Length=632

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 114/136 (84%), Gaps = 3/136 (2%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEPWDLPGLSVIKTEDP  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AKVGMKKTLVYYLGRA  495
            EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK    A +GMKKTLV+Y GRA
Sbjct  66   EWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKAGTNACIGMKKTLVFYRGRA  125

Query  496  PEGKRTHWVIHEYRTT  543
            P+G+RT+W++HEYR T
Sbjct  126  PKGERTNWIMHEYRPT  141



>gb|KFK45050.1| hypothetical protein AALP_AA1G337500 [Arabis alpina]
Length=650

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  8    METLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDP  67

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  68   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-MIIGMKKTLVFYRGRAPRG  126

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T+N  DGT
Sbjct  127  ERTNWIMHEYRATDNDLDGT  146



>gb|KJB37428.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=377

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  309
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYRTT ++ DGT
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGT  145



>ref|XP_006287681.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
 gb|EOA20579.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
Length=414

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIREVDICK EPWDLPD S V++ D+
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVVKTTDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  130  TRTCWIMHEYRATEKDLDGT  149



>gb|KFK45049.1| hypothetical protein AALP_AA1G337500 [Arabis alpina]
Length=649

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  8    METLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDP  67

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  68   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  126

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T+N  DGT
Sbjct  127  ERTNWIMHEYRATDNDLDGT  146



>ref|XP_006476249.1| PREDICTED: uncharacterized protein LOC102621962 [Citrus sinensis]
Length=632

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 114/136 (84%), Gaps = 3/136 (2%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEPWDLPGLSVIKTEDP  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AKVGMKKTLVYYLGRA  495
            EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK    A +GMKKTLV+Y GRA
Sbjct  66   EWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKAGTNACIGMKKTLVFYRGRA  125

Query  496  PEGKRTHWVIHEYRTT  543
            P+G+RT+W++HEYR T
Sbjct  126  PKGERTNWIMHEYRPT  141



>gb|AAF31292.1|AC006424_21 CDS [Arabidopsis thaliana]
Length=577

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGR  124

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  125  APRGERTNWIMHEYRATDKELDGT  148



>gb|KHF99264.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=635

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 120/154 (78%), Gaps = 10/154 (6%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL +E         +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EP
Sbjct  1    MAVLTME---------TLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEP  51

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLP +S ++S D EWFFFCP DRKY N  R NRAT++GYWKATGKDRTI S+K + +GM
Sbjct  52   WDLPGLSVIKSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKK-SLIGM  110

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLV+Y GRAP+G+RT+W++HEYR T    DGT
Sbjct  111  KKTLVFYKGRAPKGQRTYWIMHEYRPTTKDLDGT  144



>gb|KJB18876.1| hypothetical protein B456_003G073300 [Gossypium raimondii]
Length=635

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 120/154 (78%), Gaps = 10/154 (6%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAVL +E         +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EP
Sbjct  1    MAVLTME---------TLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEP  51

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLP +S ++S D EWFFFCP DRKY N  R NRAT++GYWKATGKDRTI S+K + +GM
Sbjct  52   WDLPGLSVIKSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKK-SLIGM  110

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLV+Y GRAP+G+RT+W++HEYR T    DGT
Sbjct  111  KKTLVFYKGRAPKGQRTYWIMHEYRPTTEDLDGT  144



>gb|KJB39511.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
Length=525

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLP+G RFRPTDEEL+D YL+ K+ G  + E+ VIREVD+CK EPWDLP +S V+  D
Sbjct  6    LNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSAVKGRD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S     +GMKKTLV+Y GRAP+
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSCLIGMKKTLVFYTGRAPK  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT ++ DGT
Sbjct  125  GKRTNWVMHEYRTTLDELDGT  145



>gb|KHG05224.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=533

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 114/141 (81%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLP+G RFRPTDEEL+D YL+ K+ G  + E+ VIREVD+CK EPWDLP +S V++ D
Sbjct  6    LNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSAVKARD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S     +GMKKTLV+Y GRAP+
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSCLIGMKKTLVFYTGRAPK  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT ++ DGT
Sbjct  125  GKRTNWVMHEYRTTLDELDGT  145



>ref|XP_011081340.1| PREDICTED: uncharacterized protein LOC105164394 isoform X2 [Sesamum 
indicum]
Length=588

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 8/148 (5%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L +LP G+RFRPTDEELV HYL++KI G  + V VI E+D+CK EPWDLP +S ++S D 
Sbjct  3    LEALPKGFRFRPTDEELVSHYLRLKINGHHSSVQVIPEIDVCKWEPWDLPALSVIKSDDQ  62

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKKTLVY  480
            EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK           +GMKKTLV+
Sbjct  63   EWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSLPSGRSNTQLIGMKKTLVF  122

Query  481  YLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            Y GRAP+G+RT+W++HEYR TE   DG+
Sbjct  123  YKGRAPKGERTNWIMHEYRATEPDLDGS  150



>ref|XP_011081339.1| PREDICTED: uncharacterized protein LOC105164394 isoform X1 [Sesamum 
indicum]
Length=593

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 8/148 (5%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L +LP G+RFRPTDEELV HYL++KI G  + V VI E+D+CK EPWDLP +S ++S D 
Sbjct  3    LEALPKGFRFRPTDEELVSHYLRLKINGHHSSVQVIPEIDVCKWEPWDLPALSVIKSDDQ  62

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKKTLVY  480
            EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK           +GMKKTLV+
Sbjct  63   EWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSLPSGRSNTQLIGMKKTLVF  122

Query  481  YLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            Y GRAP+G+RT+W++HEYR TE   DG+
Sbjct  123  YKGRAPKGERTNWIMHEYRATEPDLDGS  150



>gb|KJB24041.1| hypothetical protein B456_004G125900 [Gossypium raimondii]
Length=483

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLP+G+RFRPTDEEL+  YL+ KI G    EV VIRE+D+CK EPWDLP MS +++ D
Sbjct  6    LNSLPIGFRFRPTDEELIHFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSAIQTRD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S   + +GMKK+LV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSSLIGMKKSLVFYTGRAPR  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT  + DGT
Sbjct  125  GKRTNWVMHEYRTTLIELDGT  145



>ref|XP_006287682.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
 gb|EOA20580.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
Length=466

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIREVDICK EPWDLPD S V++ D+
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVVKTTDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  130  TRTCWIMHEYRATEKDLDGT  149



>gb|KHG07501.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=562

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLP G+RFRPTDEEL+D YL+ KI G    EV VIRE+D+CK EPWDLP MS +E+ D
Sbjct  6    LNSLPTGFRFRPTDEELIDFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSAIETRD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRAT+ GYWKATGKDR I S   + +GMKK+LV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATKAGYWKATGKDRKIKS-GSSLIGMKKSLVFYTGRAPR  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT  + DGT
Sbjct  125  GKRTNWVMHEYRTTLIELDGT  145



>ref|XP_010241065.1| PREDICTED: uncharacterized protein LOC104585779 isoform X1 [Nelumbo 
nucifera]
Length=609

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G+  L +LP+G+RFRPTDEEL++HYL+ KI G E +V VI EVD+CK EPWDLP++S ++
Sbjct  6    GVLSLGALPLGFRFRPTDEELINHYLRCKINGKEDKVRVIPEVDVCKWEPWDLPELSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYL  486
            + D EWFFF P+DRKY NG R NRATE GYWKATGKDRTI +R      +GMKKTLV+Y 
Sbjct  66   NGDPEWFFFSPRDRKYPNGHRSNRATEAGYWKATGKDRTIKARTSGMHLIGMKKTLVFYR  125

Query  487  GRAPEGKRTHWVIHEYRTTENKFDGT  564
            GRAP G+RT+W++HEYR TE + DGT
Sbjct  126  GRAPNGQRTNWIMHEYRATEEELDGT  151



>ref|XP_010241066.1| PREDICTED: uncharacterized protein LOC104585779 isoform X2 [Nelumbo 
nucifera]
Length=608

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G+  L +LP+G+RFRPTDEEL++HYL+ KI G E +V VI EVD+CK EPWDLP++S ++
Sbjct  6    GVLSLGALPLGFRFRPTDEELINHYLRCKINGKEDKVRVIPEVDVCKWEPWDLPELSVIK  65

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYL  486
            + D EWFFF P+DRKY NG R NRATE GYWKATGKDRTI +R      +GMKKTLV+Y 
Sbjct  66   NGDPEWFFFSPRDRKYPNGHRSNRATEAGYWKATGKDRTIKARTSGMHLIGMKKTLVFYR  125

Query  487  GRAPEGKRTHWVIHEYRTTENKFDGT  564
            GRAP G+RT+W++HEYR TE + DGT
Sbjct  126  GRAPNGQRTNWIMHEYRATEEELDGT  151



>ref|XP_003602411.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=434

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 117/158 (74%), Gaps = 10/158 (6%)
 Frame = +1

Query  91   CGVEMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDIC  270
            C  EM  L          L SLP+G+RFRPTDEEL+D+YL++KI G+  EV VIRE+D+C
Sbjct  218  CIFEMVTLS---------LISLPLGFRFRPTDEELIDYYLRLKINGNGDEVQVIREIDVC  268

Query  271  KHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA  450
            K EPWD+PD+S ++ +D EWFFFCP+DR+Y NG RLNR T  GYWKATGKDR I S    
Sbjct  269  KWEPWDMPDLSVIKDNDPEWFFFCPQDRQYPNGNRLNRETNHGYWKATGKDRKIKS-GTI  327

Query  451  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
             +GMKKTLV+Y+ RAP G+R++WV+HEYR T  + DGT
Sbjct  328  LIGMKKTLVFYISRAPNGRRSNWVMHEYRPTLEELDGT  365



>gb|AIU39715.1| NAC transcription factor 14 [Brassica napus]
Length=635

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  11   MESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  70

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  71   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T+   DGT
Sbjct  130  ERTNWIMHEYRATDKDLDGT  149



>gb|KFK27735.1| hypothetical protein AALP_AA8G422400 [Arabis alpina]
Length=464

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + EV VIREVDICK EPWDLPD S V++ D+
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGRDDEVRVIREVDICKWEPWDLPDFSVVKTTDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGNTKIIGVKRTLVFYTGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W+IHEYR TE   DGT
Sbjct  130  TRTCWIIHEYRATEKDLDGT  149



>ref|XP_010493709.1| PREDICTED: NAC domain-containing protein 74 [Camelina sativa]
Length=466

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  126  TRTCWIMHEYRATEKDLDGT  145



>ref|XP_002867065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43324.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>ref|XP_009151462.1| PREDICTED: uncharacterized protein LOC103874777 [Brassica rapa]
 emb|CDY26922.1| BnaA05g17900D [Brassica napus]
Length=636

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  11   MESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  70

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  71   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T+   DGT
Sbjct  130  ERTNWIMHEYRATDKDLDGT  149



>emb|CDY66161.1| BnaCnng49700D [Brassica napus]
Length=635

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  11   MESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  70

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  71   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T+   DGT
Sbjct  130  ERTNWIMHEYRATDKDLDGT  149



>ref|XP_002874210.1| tip [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50469.1| tip [Arabidopsis lyrata subsp. lyrata]
Length=461

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D 
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVVKTTDA  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  130  TRTCWIMHEYRATEKDLDGT  149



>ref|NP_973954.1| protein NAC 014 [Arabidopsis thaliana]
 gb|ACI49788.1| At1g33060 [Arabidopsis thaliana]
 gb|AEE31559.1| protein NAC 014 [Arabidopsis thaliana]
Length=652

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S ++
Sbjct  17   ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  76

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  77   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGR  135

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  136  APRGERTNWIMHEYRATDKELDGT  159



>ref|NP_174582.3| protein NAC 014 [Arabidopsis thaliana]
 gb|AEE31558.1| protein NAC 014 [Arabidopsis thaliana]
Length=648

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S ++
Sbjct  17   ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  76

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  77   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGR  135

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  136  APRGERTNWIMHEYRATDKELDGT  159



>ref|XP_010432258.1| PREDICTED: NAC domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=522

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G+  + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GVVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>ref|XP_010421284.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Camelina 
sativa]
 ref|XP_010421286.1| PREDICTED: NAC domain-containing protein 74-like isoform X3 [Camelina 
sativa]
Length=467

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  126  TRTCWIMHEYRATEKDLDGT  145



>ref|NP_567986.3| NAC transcription factor-like 9 [Arabidopsis thaliana]
 gb|AEE86533.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=512

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>ref|XP_010478725.1| PREDICTED: uncharacterized protein LOC104757674 isoform X1 [Camelina 
sativa]
Length=660

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  61   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGRAPRG  119

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+W++HEYR T+ + DGT
Sbjct  120  GRTNWIMHEYRATDKELDGT  139



>ref|XP_006415127.1| hypothetical protein EUTSA_v10007021mg [Eutrema salsugineum]
 gb|ESQ33480.1| hypothetical protein EUTSA_v10007021mg [Eutrema salsugineum]
Length=654

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  12   MESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  71

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  72   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  130

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT+W++HEYR T+   DGT
Sbjct  131  ERTNWIMHEYRATDKDLDGT  150



>ref|XP_010478726.1| PREDICTED: uncharacterized protein LOC104757674 isoform X2 [Camelina 
sativa]
Length=659

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  61   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGRAPRG  119

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+W++HEYR T+ + DGT
Sbjct  120  GRTNWIMHEYRATDKELDGT  139



>ref|NP_197847.3| TCV-interacting protein [Arabidopsis thaliana]
 gb|AAF87300.1|AF281062_1 TIP [Arabidopsis thaliana]
 dbj|BAB11211.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAN72023.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAP81801.1| At5g24590 [Arabidopsis thaliana]
 gb|AED93330.1| TCV-interacting protein [Arabidopsis thaliana]
Length=451

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGHDNDVRVIREIDICKWEPWDLPDFSVVKTTDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  130  TRTCWIMHEYRATEKDLDGT  149



>ref|NP_001119122.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
 emb|CAA20028.1| NAM / CUC2 -like protein [Arabidopsis thaliana]
 emb|CAB80274.1| NAM / CUC2-like protein [Arabidopsis thaliana]
 gb|AEE86534.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=534

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>ref|NP_001190927.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
 gb|AEE86535.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=533

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>ref|XP_010432259.1| PREDICTED: NAC domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=537

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G+  + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GVVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>ref|XP_010446907.1| PREDICTED: NAC domain-containing protein 86-like [Camelina sativa]
Length=522

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>gb|KJB37424.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=472

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  309
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYRTT ++ DGT
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGT  145



>ref|XP_003526771.1| PREDICTED: uncharacterized protein LOC100808469 [Glycine max]
Length=598

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLP+G+RFRPTDEELV++YL+ KI G+  +V VIRE+D+CK EPWD+P +S V++ D 
Sbjct  19   LDSLPLGFRFRPTDEELVNYYLRQKINGNGRQVWVIREIDVCKWEPWDMPGLSVVQTKDP  78

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S K   +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRRIKSGKDL-IGMKKTLVFYTGRAPKG  137

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WV+HEYR T  + DGT
Sbjct  138  NRTNWVMHEYRPTLKELDGT  157



>gb|KHN19577.1| NAC domain-containing protein 78 [Glycine soja]
Length=598

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLP+G+RFRPTDEELV++YL+ KI G+  +V VIRE+D+CK EPWD+P +S V++ D 
Sbjct  19   LDSLPLGFRFRPTDEELVNYYLRQKINGNGRQVWVIREIDVCKWEPWDMPGLSVVQTKDP  78

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S K   +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRRIKSGKDL-IGMKKTLVFYTGRAPKG  137

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WV+HEYR T  + DGT
Sbjct  138  NRTNWVMHEYRPTLKELDGT  157



>gb|KHG14091.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=559

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  309
            G+  L+SLP+G+RFRPTD+EL+D YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDQELIDFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
            ++ D EWFFFCP DRKY  G RLNRAT+ GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATDAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYRTT ++ DGT
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGT  145



>ref|XP_010437454.1| PREDICTED: uncharacterized protein LOC104721220 [Camelina sativa]
Length=526

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>ref|XP_002893753.1| ANAC014 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70012.1| ANAC014 [Arabidopsis lyrata subsp. lyrata]
Length=647

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
             L  + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S ++
Sbjct  17   ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  76

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  77   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-LIIGMKKTLVFYRGR  135

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP G+RT+W++HEYR T+ + DGT
Sbjct  136  APRGERTNWIMHEYRATDKELDGT  159



>gb|KJB37426.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=482

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  309
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYRTT ++ DGT
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGT  145



>gb|AHJ79190.1| NAC domain protein NAC49 [Gossypium hirsutum]
Length=628

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L+SLP+G RFRPTDEEL+D YL+ K+ G  + E+ VIREVD+CK EPWDLP +S V+  D
Sbjct  6    LNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSAVKGRD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  501
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S     +GMKKTLV+Y GRAP+
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSCLIGMKKTLVFYTGRAPK  124

Query  502  GKRTHWVIHEYRTTENKFDGT  564
            GKRT+WV+HEYRTT ++ DGT
Sbjct  125  GKRTNWVMHEYRTTLDELDGT  145



>ref|XP_006286077.1| hypothetical protein CARUB_v10007613mg [Capsella rubella]
 gb|EOA18975.1| hypothetical protein CARUB_v10007613mg [Capsella rubella]
Length=526

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  492
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  493  APEGKRTHWVIHEYRTTENKFDGT  564
            AP+G+RT+W++HEYR T    DGT
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGT  144



>ref|XP_010456676.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
Length=521

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  126  TRTCWIMHEYRATEKDLDGT  145



>ref|XP_006394715.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
 gb|ESQ32001.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
Length=458

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIREVDICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGNTKIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  126  SRTCWIMHEYRATEKDLDGT  145



>gb|AHJ79172.1| NAC domain protein NAC31 [Gossypium hirsutum]
 gb|KJB37427.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=541

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  309
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYRTT ++ DGT
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGT  145



>gb|KJB37423.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=520

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  309
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  310  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  489
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  490  RAPEGKRTHWVIHEYRTTENKFDGT  564
            RAP GKRT+WV+HEYRTT ++ DGT
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGT  145



>ref|XP_006291082.1| hypothetical protein CARUB_v10017199mg [Capsella rubella]
 gb|EOA23980.1| hypothetical protein CARUB_v10017199mg [Capsella rubella]
Length=460

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I + K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKTSKTNIIGVKRTLVFHAGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WVIHEYR TEN   GT
Sbjct  130  TRTNWVIHEYRATENDLSGT  149



>ref|XP_006394714.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
 gb|ESQ32000.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
Length=483

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL++KI G + +V VIREVDICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGNTKIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  126  SRTCWIMHEYRATEKDLDGT  145



>ref|XP_010542182.1| PREDICTED: uncharacterized protein LOC104815470 [Tarenaya hassleriana]
Length=668

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+C+ EPWDLP +S +++ D 
Sbjct  18   IESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPGLSVIKTDDQ  77

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K A VGMKKTLV+Y GRAP  
Sbjct  78   EWFFFCPRDRKYPSGHRSNRATDSGYWKATGKDRTIRSKKTA-VGMKKTLVFYRGRAPRA  136

Query  505  KRTHWVIHEYRTTENKFDG  561
            +RT W++HEYR T+   DG
Sbjct  137  ERTSWIMHEYRATDKDLDG  155



>ref|XP_010515305.1| PREDICTED: NAC domain-containing protein 19-like [Camelina sativa]
Length=453

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLPVG RFRPTDEELV +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELVRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I + K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGKTKIIGVKRTLVFHAGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WVIHEYR TEN   GT
Sbjct  130  TRTNWVIHEYRATENDLSGT  149



>ref|XP_010426468.1| PREDICTED: NAC domain-containing protein 74 [Camelina sativa]
Length=453

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I + K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGKTKIIGVKRTLVFHAGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WVIHEYR TEN   GT
Sbjct  130  TRTNWVIHEYRATENDLSGT  149



>gb|ACU23644.1| unknown [Glycine max]
Length=603

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLP+G+RFRPTDEELV++YL+ KI G+  EV VIRE+D+CK EPWD+P +S V++ D 
Sbjct  19   LDSLPLGFRFRPTDEELVNYYLRQKINGNGREVWVIREIDVCKWEPWDMPGLSVVQTKDP  78

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRKIKSGT-ILIGMKKTLVFYTGRAPKG  137

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WV+HEYR T  + DGT
Sbjct  138  NRTNWVMHEYRPTLKELDGT  157



>ref|XP_010503613.1| PREDICTED: NAC domain-containing protein 19-like [Camelina sativa]
Length=455

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I + K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGKTKIIGVKRTLVFHAGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WVIHEYR TEN   GT
Sbjct  130  TRTNWVIHEYRATENDLSGT  149



>ref|NP_001276211.1| uncharacterized LOC100777071 [Glycine max]
 gb|AGO14649.1| NAC transcription factor [Glycine max]
Length=604

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLP+G+RFRPTDEELV++YL+ KI G+  EV VIRE+D+CK EPWD+P +S V++ D 
Sbjct  19   LDSLPLGFRFRPTDEELVNYYLRQKINGNGREVWVIREIDVCKWEPWDMPGLSVVQTKDP  78

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRKIKSGT-ILIGMKKTLVFYTGRAPKG  137

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WV+HEYR T  + DGT
Sbjct  138  NRTNWVMHEYRPTLKELDGT  157



>ref|XP_008811393.1| PREDICTED: NAC domain-containing protein 74-like [Phoenix dactylifera]
Length=289

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 110/144 (76%), Gaps = 5/144 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L  LP+G+RF PTDEELV+HYLK KI+G  ++E  VI E+D+CK EPWDLPD S + S D
Sbjct  6    LQLLPLGFRFHPTDEELVNHYLKRKISGRIKSEAEVIPEIDVCKCEPWDLPDKSIIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHNVIGMKKTLVFHQG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDG  561
            RAP+G RT W++HEYRTTE +F+ 
Sbjct  126  RAPKGIRTSWIMHEYRTTEPEFES  149



>emb|CDY05939.1| BnaC08g21160D [Brassica napus]
Length=463

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTDEELV  YL+ KI G + +V+ IRE+DICK EPWDLP  S ++++D+
Sbjct  13   LDSLPVGLRFRPTDEELVSFYLQRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTNDS  72

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K + +G+K+TLV++ GRAP+G
Sbjct  73   EWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKSSIIGLKRTLVFHSGRAPKG  132

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+W++HEYR TE+   GT
Sbjct  133  TRTNWIMHEYRATEDDLSGT  152



>gb|EYU35608.1| hypothetical protein MIMGU_mgv1a022295mg, partial [Erythranthe 
guttata]
Length=447

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 114/149 (77%), Gaps = 9/149 (6%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSV-IREVDICKHEPWDLPDMSFVESHD  321
            L SLP G+RFRPTDEELV+HYL++KI G  ++V V I EVD+CK EPWDLP +S ++S D
Sbjct  3    LESLPKGFRFRPTDEELVNHYLRLKINGRHSDVDVVIPEVDVCKWEPWDLPALSVIKSGD  62

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKKTLV  477
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI S K +         +GMKKTLV
Sbjct  63   QEWFFFCPRDRKYPNGNRSNRATEAGYWKATGKDRTIKSHKSSSLGRSTSQLIGMKKTLV  122

Query  478  YYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            ++ GRAP+G+RT+W++HEYR T    DGT
Sbjct  123  FHRGRAPKGERTNWIMHEYRATGPDLDGT  151



>ref|XP_011043746.1| PREDICTED: uncharacterized protein LOC105139114 [Populus euphratica]
Length=608

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 8/154 (5%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  282
            MAV+ +        L+SLP+G+RFRP+DEELV++YL+ KI G + +V VIR +D+CK EP
Sbjct  1    MAVMSLN-------LNSLPLGFRFRPSDEELVNYYLRHKINGKDDKVKVIRGIDVCKWEP  53

Query  283  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  462
            WDLP +S +++ D EWFFFCP DRKY NG R NRAT+ GYWKATGKDR I S     +GM
Sbjct  54   WDLPVLSIIKNKDPEWFFFCPLDRKYPNGSRQNRATDAGYWKATGKDRKIKS-GNRLIGM  112

Query  463  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            KKTLV+Y GRAP+GKRT+WV+HEYR TE + DGT
Sbjct  113  KKTLVFYTGRAPKGKRTNWVMHEYRATEEELDGT  146



>ref|XP_009111639.1| PREDICTED: NAC domain-containing protein 2 isoform X2 [Brassica 
rapa]
 emb|CDY19828.1| BnaA09g04810D [Brassica napus]
Length=445

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L +LPVG+RF PTDEELV +YL+ KI G + +V VIR VDICK+EPWDLPD+S V + D+
Sbjct  6    LDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVVRTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGSTKIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  126  TRTCWIMHEYRATEKDLDGT  145



>ref|XP_009111638.1| PREDICTED: NAC domain-containing protein 74 isoform X1 [Brassica 
rapa]
Length=446

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L +LPVG+RF PTDEELV +YL+ KI G + +V VIR VDICK+EPWDLPD+S V + D+
Sbjct  6    LDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVVRTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGSTKIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  126  TRTCWIMHEYRATEKDLDGT  145



>gb|AIS36139.1| NAC transcription factor 91-1 [Brassica napus]
Length=445

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL+ KI G + +V VIR VDICK+EPWDLPD+S V + D+
Sbjct  6    LDSLPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVVRTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRKVKSGSTKIIGVKRTLVFYTGRAPKG  125

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  126  TRTCWIMHEYRATEKDLDGT  145



>ref|XP_010461128.1| PREDICTED: NAC domain-containing protein 86 [Camelina sativa]
Length=658

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EWFFFCP+ RKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  61   EWFFFCPRYRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGRAPRG  119

Query  505  KRTHWVIHEYRTTENKFDGT  564
            +RT W++HEYR T+ + DGT
Sbjct  120  ERTDWIMHEYRATDKELDGT  139



>emb|CDX86970.1| BnaC03g52400D [Brassica napus]
Length=316

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTDEELV +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   LDSLPVGLRFRPTDEELVRYYLRRKINGHDDDVKAIREIDICKCEPWDLPDFSAIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NR+T  G+WKATGKDR I S K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRSTIAGHWKATGKDRKIKSGKNNVIGLKRTLVFHSGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WV+HEYR TE    GT
Sbjct  130  TRTNWVMHEYRATEQDLSGT  149



>ref|XP_008783552.1| PREDICTED: uncharacterized protein LOC103702771 [Phoenix dactylifera]
Length=672

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  130  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSF  306
            T LPP  SLP+G+RFRPTDEELV+HYLK KI G   +EV VI EVD+CK EPWDLPD S 
Sbjct  2    TVLPP-ESLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPEVDVCKCEPWDLPDKSL  60

Query  307  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSR--KGAKVGMKKTLVY  480
            + S D EWFFF P+DRKY NG R NRATE GYWKATGKDR I ++    + +GMKKTLV+
Sbjct  61   IRSDDPEWFFFTPRDRKYPNGHRANRATEAGYWKATGKDRMIKTKPPSPSLIGMKKTLVF  120

Query  481  YLGRAPEGKRTHWVIHEYRTTENKFD  558
            Y GRAP G R++W++HEYRT+E++FD
Sbjct  121  YRGRAPNGVRSNWIMHEYRTSESEFD  146



>gb|KFK34231.1| hypothetical protein AALP_AA5G118000 [Arabis alpina]
Length=458

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTDEELV  YL  KI G + +V  IRE+DICK EPWDLPD+S +++ D+
Sbjct  10   LDSLPVGLRFRPTDEELVRFYLGRKINGHDDDVKAIREIDICKWEPWDLPDLSVIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY  G R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPTGSRQNRATIAGYWKATGKDRKIKSAKKNIIGVKRTLVFHSGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WV+HEYR TEN   GT
Sbjct  130  TRTNWVMHEYRATENDLSGT  149



>emb|CDP12257.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 115/152 (76%), Gaps = 8/152 (5%)
 Frame = +1

Query  133  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  312
            G+    SLP+G+RFRPTDEEL++HYL++KI G   EV VI EVD+CK EPWDLP +S ++
Sbjct  2    GVVSTESLPLGFRFRPTDEELINHYLRLKINGRHDEVQVIPEVDVCKWEPWDLPQLSVIK  61

Query  313  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKK  468
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI S + +         +GMKK
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSHRSSPSSNSSTHLIGMKK  121

Query  469  TLVYYLGRAPEGKRTHWVIHEYRTTENKFDGT  564
            TLV+Y GRAP+G+RT W++HEYR TE   DGT
Sbjct  122  TLVFYRGRAPKGERTSWIMHEYRATEPDLDGT  153



>emb|CDY08139.1| BnaA06g15870D [Brassica napus]
Length=464

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTDEELV  YL  KI G + +V+ IRE+DICK EPWDLP  S ++++D+
Sbjct  13   LDSLPVGLRFRPTDEELVRFYLHRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTNDS  72

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K + +G+K+TLV++ GRAP+G
Sbjct  73   EWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKNSIIGVKRTLVFHSGRAPKG  132

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+W++HEYR TE+   GT
Sbjct  133  TRTNWIMHEYRATEDDLSGT  152



>ref|XP_009391051.1| PREDICTED: uncharacterized protein LOC103977297 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391052.1| PREDICTED: uncharacterized protein LOC103977297 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=723

 Score =   202 bits (513),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L SLP+G+RF PTDEELV+HYLK KITG  ++E+ VI E+D+CK EPWDLP+ S + S+D
Sbjct  6    LASLPLGFRFHPTDEELVNHYLKRKITGRIKSEMQVIPEIDVCKCEPWDLPEKSLIRSND  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRVIRSKSSAAKSTIIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP G RT+W++HEYRTTE +F+
Sbjct  126  RAPHGVRTNWIMHEYRTTELEFE  148



>ref|XP_009149732.1| PREDICTED: NAC transcription factor 29 [Brassica rapa]
Length=463

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTDEELV  YL  KI G + +V+ IRE+DICK EPWDLP  S ++++D+
Sbjct  13   LDSLPVGLRFRPTDEELVRFYLHRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTNDS  72

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K + +G+K+TLV++ GRAP+G
Sbjct  73   EWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKNSIIGVKRTLVFHSGRAPKG  132

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+W++HEYR TE+   GT
Sbjct  133  TRTNWIMHEYRATEDDLSGT  152



>ref|XP_009391053.1| PREDICTED: uncharacterized protein LOC103977297 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=721

 Score =   202 bits (513),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L SLP+G+RF PTDEELV+HYLK KITG  ++E+ VI E+D+CK EPWDLP+ S + S+D
Sbjct  6    LASLPLGFRFHPTDEELVNHYLKRKITGRIKSEMQVIPEIDVCKCEPWDLPEKSLIRSND  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRVIRSKSSAAKSTIIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP G RT+W++HEYRTTE +F+
Sbjct  126  RAPHGVRTNWIMHEYRTTELEFE  148



>ref|XP_006404132.1| hypothetical protein EUTSA_v10010340mg [Eutrema salsugineum]
 gb|ESQ45585.1| hypothetical protein EUTSA_v10010340mg [Eutrema salsugineum]
Length=470

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTD+ELV  YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   LDSLPVGLRFRPTDQELVRFYLRRKINGHDNDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIRSDKDNIIGVKRTLVFHSGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+W+IHEYR TE    GT
Sbjct  130  TRTNWIIHEYRATEKDLSGT  149



>ref|XP_002877683.1| ANAC062 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53942.1| ANAC062 [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRRKINGHDDDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKSGKTNIIGVKRTLVFHAGRAPRG  129

Query  505  KRTHWVIHEYRTTENKFDG  561
             RT+WVIHEYR TE+   G
Sbjct  130  TRTNWVIHEYRATEDDLSG  148



>gb|AIS36140.1| NAC transcription factor 91-2 [Brassica napus]
Length=456

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D+
Sbjct  6    LDSLPVGFRFSPTDEELVHYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  125  TRTCWIMHEYRATEQDLDGT  144



>emb|CDX80455.1| BnaC07g29890D [Brassica napus]
Length=456

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D+
Sbjct  6    LDSLPVGFRFSPTDEELVHYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  125  TRTCWIMHEYRATEQDLDGT  144



>ref|XP_009389904.1| PREDICTED: uncharacterized protein LOC103976433 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=650

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 116/157 (74%), Gaps = 12/157 (8%)
 Frame = +1

Query  100  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKH  276
            EMAVL VE         S P+G+RFRPTD ELV+HYLK KITG  ++E  VI E+DICK 
Sbjct  5    EMAVLSVE---------SFPLGFRFRPTDVELVNHYLKGKITGRIKSEDEVISEIDICKC  55

Query  277  EPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTIS--SRKGA  450
            EPWDLPD+S ++S D+EWFFF PKDRKY NG R NRAT+ GYWKATGKDR I   SR   
Sbjct  56   EPWDLPDISLIKSSDSEWFFFSPKDRKYPNGNRSNRATKAGYWKATGKDRMIRSISRVPT  115

Query  451  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDG  561
             +G KKTLV+Y GRAP G RT WV+HEYRTTE +FD 
Sbjct  116  IIGTKKTLVFYQGRAPSGVRTTWVMHEYRTTEKEFDS  152



>ref|XP_002445085.1| hypothetical protein SORBIDRAFT_07g003900 [Sorghum bicolor]
 gb|EES14580.1| hypothetical protein SORBIDRAFT_07g003900 [Sorghum bicolor]
Length=663

 Score =   200 bits (509),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 113/148 (76%), Gaps = 5/148 (3%)
 Frame = +1

Query  130  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSF  306
            T +  L +LP+G+RF PTDEELV HYLK KITG   +E  VI E+D+CK EPWDLPD S 
Sbjct  4    TAVMELRTLPLGFRFHPTDEELVTHYLKGKITGQINSEAEVIPEIDVCKCEPWDLPDKSI  63

Query  307  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISS----RKGAKVGMKKTL  474
            ++S D EWFFF PKDRKY NG R NRATE GYWKATGKDR I S    RK   +GMKKTL
Sbjct  64   IQSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSKGDKRKQHTIGMKKTL  123

Query  475  VYYLGRAPEGKRTHWVIHEYRTTENKFD  558
            V++ GRAP+G+RT W++HEYRTTE +FD
Sbjct  124  VFHRGRAPKGERTGWIMHEYRTTEPQFD  151



>ref|XP_004972796.1| PREDICTED: uncharacterized protein LOC101763561 [Setaria italica]
Length=671

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 111/143 (78%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L +LP+G+RF PTDEELV HYLK KITG   +EV VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKALPLGFRFHPTDEELVRHYLKGKITGQINSEVEVIPEIDVCKCEPWDLPDKSLIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISS----RKGAKVGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S    RK   +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSKGDKRKQHVIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G+RT W++HEYRTTE +FD
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFD  148



>ref|XP_009150983.1| PREDICTED: protein ATAF2-like isoform X2 [Brassica rapa]
Length=455

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D+
Sbjct  6    LDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  125  TRTCWIMHEYRATEQDLDGT  144



>ref|XP_009150982.1| PREDICTED: protein ATAF2-like isoform X1 [Brassica rapa]
Length=456

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D+
Sbjct  6    LDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDS  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  125  TRTCWIMHEYRATEQDLDGT  144



>ref|XP_010941180.1| PREDICTED: uncharacterized protein LOC105059551 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 112/143 (78%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L  LP+G+RF PTDEELV+HYLK KITG  +++V VI EVD+CK EPWDLPD S + S D
Sbjct  6    LELLPLGFRFHPTDEELVNHYLKRKITGRIKSDVEVIPEVDVCKCEPWDLPDKSIIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   LEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHNVIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G RTHW++HEYRTTE +F+
Sbjct  126  RAPKGIRTHWIMHEYRTTEPEFE  148



>ref|XP_010941181.1| PREDICTED: uncharacterized protein LOC105059551 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 112/143 (78%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L  LP+G+RF PTDEELV+HYLK KITG  +++V VI EVD+CK EPWDLPD S + S D
Sbjct  6    LELLPLGFRFHPTDEELVNHYLKRKITGRIKSDVEVIPEVDVCKCEPWDLPDKSIIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   LEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHNVIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G RTHW++HEYRTTE +F+
Sbjct  126  RAPKGIRTHWIMHEYRTTEPEFE  148



>ref|XP_009385839.1| PREDICTED: uncharacterized protein LOC103973093 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=717

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 114/143 (80%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L SLP+G+RF+PTDEELV++YLK KITG   +++ VI E+D+CK EPWDLPD S ++S D
Sbjct  6    LDSLPLGFRFQPTDEELVNYYLKPKITGRIRSQMEVIPEIDVCKCEPWDLPDKSVIKSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRIIRSKSSAGKSTIIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G RTHW++HEYRTTE +F+
Sbjct  126  RAPKGARTHWIMHEYRTTEPEFE  148



>ref|XP_009385838.1| PREDICTED: uncharacterized protein LOC103973093 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=719

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 114/143 (80%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L SLP+G+RF+PTDEELV++YLK KITG   +++ VI E+D+CK EPWDLPD S ++S D
Sbjct  6    LDSLPLGFRFQPTDEELVNYYLKPKITGRIRSQMEVIPEIDVCKCEPWDLPDKSVIKSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRIIRSKSSAGKSTIIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G RTHW++HEYRTTE +F+
Sbjct  126  RAPKGARTHWIMHEYRTTEPEFE  148



>ref|XP_008788721.1| PREDICTED: uncharacterized protein LOC103706411 isoform X1 [Phoenix 
dactylifera]
Length=715

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 110/144 (76%), Gaps = 5/144 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L SLP+G+RF PTDEELV HYLK KI G  + EV VI EVD+CK EPWDLPD S + S D
Sbjct  6    LGSLPLGFRFHPTDEELVTHYLKRKINGRIKTEVEVIPEVDVCKCEPWDLPDKSIIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  +     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAASARHSVIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDG  561
            RAP+G RTHW++HEYRTTE +F+ 
Sbjct  126  RAPKGIRTHWIMHEYRTTEPEFES  149



>emb|CDX88115.1| BnaA06g27060D [Brassica napus]
Length=443

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D 
Sbjct  6    LDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDA  65

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  125  TRTCWIMHEYRATEQDLDGT  144



>ref|XP_008788722.1| PREDICTED: uncharacterized protein LOC103706411 isoform X2 [Phoenix 
dactylifera]
Length=707

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 110/144 (76%), Gaps = 5/144 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L SLP+G+RF PTDEELV HYLK KI G  + EV VI EVD+CK EPWDLPD S + S D
Sbjct  6    LGSLPLGFRFHPTDEELVTHYLKRKINGRIKTEVEVIPEVDVCKCEPWDLPDKSIIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  +     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAASARHSVIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFDG  561
            RAP+G RTHW++HEYRTTE +F+ 
Sbjct  126  RAPKGIRTHWIMHEYRTTEPEFES  149



>ref|NP_190522.1| transcription factor NTL6 [Arabidopsis thaliana]
 emb|CAB62457.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAL24091.1| putative NAC2 protein [Arabidopsis thaliana]
 gb|AAN41378.1| putative NAC2 protein [Arabidopsis thaliana]
 gb|AEE78553.1| NAC domain-containing protein 62 [Arabidopsis thaliana]
Length=469

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRRKINGHDDDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW +FCP DRKY +G R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP G
Sbjct  70   EWLYFCPLDRKYPSGSRQNRATVAGYWKATGKDRKIKSGKTNIIGVKRTLVFHAGRAPRG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+W+IHEYR TE+   GT
Sbjct  130  TRTNWIIHEYRATEDDLSGT  149



>ref|XP_009389911.1| PREDICTED: uncharacterized protein LOC103976433 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 115/156 (74%), Gaps = 12/156 (8%)
 Frame = +1

Query  103  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHE  279
            MAVL VE         S P+G+RFRPTD ELV+HYLK KITG  ++E  VI E+DICK E
Sbjct  1    MAVLSVE---------SFPLGFRFRPTDVELVNHYLKGKITGRIKSEDEVISEIDICKCE  51

Query  280  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTIS--SRKGAK  453
            PWDLPD+S ++S D+EWFFF PKDRKY NG R NRAT+ GYWKATGKDR I   SR    
Sbjct  52   PWDLPDISLIKSSDSEWFFFSPKDRKYPNGNRSNRATKAGYWKATGKDRMIRSISRVPTI  111

Query  454  VGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDG  561
            +G KKTLV+Y GRAP G RT WV+HEYRTTE +FD 
Sbjct  112  IGTKKTLVFYQGRAPSGVRTTWVMHEYRTTEKEFDS  147



>ref|XP_010919012.1| PREDICTED: uncharacterized protein LOC105043241 isoform X2 [Elaeis 
guineensis]
Length=573

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 3/142 (2%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESH  318
            PL SLP+G+RF PTDEELV++YLK KI G   +EV VI EVD+CK EPW+LP  S + S 
Sbjct  5    PLESLPLGFRFHPTDEELVNYYLKGKINGRINSEVVVIPEVDVCKSEPWELPGKSVIRSD  64

Query  319  DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGR  492
            D EWFFF P+DRKY NG R NRAT+ GYWKATG+DRTI +R      +GMKKTLV++LGR
Sbjct  65   DPEWFFFSPRDRKYPNGHRSNRATDAGYWKATGRDRTIKTRPPGSTIIGMKKTLVFHLGR  124

Query  493  APEGKRTHWVIHEYRTTENKFD  558
            AP+G RT+W++HEYRTTE++FD
Sbjct  125  APKGVRTYWIMHEYRTTESEFD  146



>emb|CDX87118.1| BnaC09g04330D [Brassica napus]
Length=832

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L +LPVG+RF PTDEELV +YL+ KI G + +V VIR VD+CK+EPWDLPD+S V + D+
Sbjct  383  LDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDMCKYEPWDLPDLSVVRTMDS  442

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  443  EWLFFCPLDRKYPSGSRMNRATIAGYWKATGKDRKVKSGSTKIIGVKRTLVFYTGRAPKG  502

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT W++HEYR TE   DGT
Sbjct  503  TRTCWIMHEYRATEKDLDGT  522



>ref|NP_001061034.1| Os08g0157900 [Oryza sativa Japonica Group]
 dbj|BAC99653.1| NAC2 protein-like [Oryza sativa Japonica Group]
 dbj|BAF22948.1| Os08g0157900 [Oryza sativa Japonica Group]
 gb|ACJ54898.1| NAC2 protein [Oryza sativa Japonica Group]
 gb|EEE68077.1| hypothetical protein OsJ_26109 [Oryza sativa Japonica Group]
Length=729

 Score =   198 bits (504),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 93/143 (65%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L  LP+G+RF PTDEELV HYLK KITG   +E  VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSLIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G+RT W++HEYRTTE +F+
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFE  148



>ref|XP_010919011.1| PREDICTED: uncharacterized protein LOC105043241 isoform X1 [Elaeis 
guineensis]
Length=610

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 3/142 (2%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESH  318
            PL SLP+G+RF PTDEELV++YLK KI G   +EV VI EVD+CK EPW+LP  S + S 
Sbjct  5    PLESLPLGFRFHPTDEELVNYYLKGKINGRINSEVVVIPEVDVCKSEPWELPGKSVIRSD  64

Query  319  DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGR  492
            D EWFFF P+DRKY NG R NRAT+ GYWKATG+DRTI +R      +GMKKTLV++LGR
Sbjct  65   DPEWFFFSPRDRKYPNGHRSNRATDAGYWKATGRDRTIKTRPPGSTIIGMKKTLVFHLGR  124

Query  493  APEGKRTHWVIHEYRTTENKFD  558
            AP+G RT+W++HEYRTTE++FD
Sbjct  125  APKGVRTYWIMHEYRTTESEFD  146



>ref|XP_010234378.1| PREDICTED: uncharacterized protein LOC100838012 [Brachypodium 
distachyon]
Length=800

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 111/143 (78%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L +LP+G+RF PTDEELV HYLK KITG   AEV VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKTLPLGFRFHPTDEELVRHYLKGKITGQINAEVEVIPEIDVCKCEPWDLPDKSLIRSED  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSKGEKKKQHMIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G+RT W++HEYRTTE +F+
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFE  148



>ref|XP_006659850.1| PREDICTED: uncharacterized protein LOC102700454 [Oryza brachyantha]
Length=698

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L  LP+G+RF PTDEELV HYLK KITG   AE  VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKKLPLGFRFHPTDEELVRHYLKGKITGQIRAEAEVIPEIDVCKCEPWDLPDKSLIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G+RT W++HEYRTTE +F+
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFE  148



>gb|EMT07892.1| NAC domain-containing protein 78 [Aegilops tauschii]
Length=694

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (78%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L +LP+G+RF PTDEELV HYLK KITG  + EV VI E+D+CK EPWDLPD + + S D
Sbjct  6    LKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKALIRSED  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSKGEKKKQHMIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G+RT W++HEYRTTE +F+
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFE  148



>gb|EEC82928.1| hypothetical protein OsI_27885 [Oryza sativa Indica Group]
Length=738

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L  LP+G+RF PTDEELV HYLK KITG   +E  VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSLIRSDD  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G+RT W++HEYRTTE +F+
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFE  148



>gb|EMS48745.1| NAC domain-containing protein 78 [Triticum urartu]
Length=722

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (78%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L +LP+G+RF PTDEELV HYLK KITG  + EV VI E+D+CK EPWDLPD + + S D
Sbjct  6    LKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKALIRSED  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSKGEKKKQHMIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G+RT W++HEYRTTE +F+
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFE  148



>dbj|BAJ97142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=704

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (78%), Gaps = 5/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  321
            L +LP+G+RF PTDEELV HYLK KITG  + EV VI E+D+CK EPWDLPD + + S D
Sbjct  6    LKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKALIRSED  65

Query  322  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  489
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSKGEKKKQHMIGMKKTLVFHRG  125

Query  490  RAPEGKRTHWVIHEYRTTENKFD  558
            RAP+G+RT W++HEYRTTE +F+
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFE  148



>ref|XP_010934040.1| PREDICTED: uncharacterized protein LOC105054253 isoform X1 [Elaeis 
guineensis]
Length=685

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHDNE  327
            SLP+G+RFRPTDEELV+HYLK KI G   +EV VI +VD+CK EPWDLPD S + S D E
Sbjct  8    SLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPDVDVCKCEPWDLPDKSVIRSDDPE  67

Query  328  WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPE  501
            WFFF P+DRKY  G R NRATE GYWKATG+DR I ++      +GMKKTLV+Y GRAP 
Sbjct  68   WFFFSPRDRKYPTGHRANRATEAGYWKATGRDRMIKTKPPGAILIGMKKTLVFYRGRAPH  127

Query  502  GKRTHWVIHEYRTTENKFD  558
            G RT+W++HEYRT+E++FD
Sbjct  128  GVRTNWIMHEYRTSESEFD  146



>ref|XP_010934041.1| PREDICTED: uncharacterized protein LOC105054253 isoform X2 [Elaeis 
guineensis]
Length=684

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHDNE  327
            SLP+G+RFRPTDEELV+HYLK KI G   +EV VI +VD+CK EPWDLPD S + S D E
Sbjct  8    SLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPDVDVCKCEPWDLPDKSVIRSDDPE  67

Query  328  WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPE  501
            WFFF P+DRKY  G R NRATE GYWKATG+DR I ++      +GMKKTLV+Y GRAP 
Sbjct  68   WFFFSPRDRKYPTGHRANRATEAGYWKATGRDRMIKTKPPGAILIGMKKTLVFYRGRAPH  127

Query  502  GKRTHWVIHEYRTTENKFD  558
            G RT+W++HEYRT+E++FD
Sbjct  128  GVRTNWIMHEYRTSESEFD  146



>ref|XP_009150140.1| PREDICTED: NAC transcription factor 29-like [Brassica rapa]
 emb|CDY00208.1| BnaA06g21090D [Brassica napus]
Length=432

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLPVG RFRPTDEELV +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   LDSLPVGLRFRPTDEELVRYYLRRKINGHDDDVKAIREIDICKCEPWDLPDFSAIKTKDS  69

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  504
            EW FF P DRKY  G R NR+T  G+WKATGKDR I S K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFSPLDRKYPTGSRQNRSTIAGHWKATGKDRKIKSGKNNVIGLKRTLVFHSGRAPKG  129

Query  505  KRTHWVIHEYRTTENKFDGT  564
             RT+WV+HEYR TE+   GT
Sbjct  130  TRTNWVMHEYRATEHDLSGT  149



>ref|XP_008808290.1| PREDICTED: uncharacterized protein LOC103720389 [Phoenix dactylifera]
Length=609

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 110/143 (77%), Gaps = 3/143 (2%)
 Frame = +1

Query  142  PLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESH  318
            PL SLP G+RF PTDEELV+HYLK KI G   +EV VI EVD+CK EPWDLPD S + S 
Sbjct  5    PLESLPRGFRFHPTDEELVNHYLKGKINGRINSEVVVIPEVDVCKCEPWDLPDKSVIRSD  64

Query  319  DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGR  492
            D EWFFF P+DRKY +G R NRAT+ GYWKATG+DR I ++      +GMKKTLV++ GR
Sbjct  65   DPEWFFFSPRDRKYPSGHRSNRATKAGYWKATGRDRMIKTKPPGSTIIGMKKTLVFHRGR  124

Query  493  APEGKRTHWVIHEYRTTENKFDG  561
            AP+G RT+W+IHEYRTTE +FD 
Sbjct  125  APKGVRTNWIIHEYRTTEFEFDS  147



>emb|CBI38740.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLPVG+RF PTDEELVDHYLK+KI G  + V +I EVD+CK EPWDLP +S ++++D EW
Sbjct  5    SLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPVLSVIQTNDPEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK  507
            FFFCP D KY  G+R NRATE GYWK TGKDR I SR   + +G KKTLV+Y GRAP+  
Sbjct  65   FFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSRATKELLGTKKTLVFYRGRAPQSV  124

Query  508  RTHWVIHEYRTT  543
            RT+WV+HEYR  
Sbjct  125  RTNWVMHEYRAA  136



>ref|XP_009397631.1| PREDICTED: uncharacterized protein LOC103982434 [Musa acuminata 
subsp. malaccensis]
Length=640

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLP-DMSFVESH  318
            + SLP+G+RFRPTD ELV+HYLK KITG  ++E+ VI E+D+CK EPWD+P D S ++S 
Sbjct  6    VESLPLGFRFRPTDAELVNHYLKGKITGRIKSEIEVIPEIDVCKCEPWDVPADKSLIKSI  65

Query  319  DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGR  492
            D EWFFF PKDRKY +G R NRATE GYWKATGKDRTI SR      +GMKKTLV++ GR
Sbjct  66   DPEWFFFSPKDRKYPSGNRSNRATEAGYWKATGKDRTIKSRSPGSMILGMKKTLVFHRGR  125

Query  493  APEGKRTHWVIHEYRTTENKFDG  561
            AP+G RT+W++HEYRTTE +++ 
Sbjct  126  APKGVRTNWIMHEYRTTEPEYES  148



>ref|XP_006846443.1| hypothetical protein AMTR_s00018p00070180 [Amborella trichopoda]
 gb|ERN08118.1| hypothetical protein AMTR_s00018p00070180 [Amborella trichopoda]
Length=177

 Score =   180 bits (456),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 102/141 (72%), Gaps = 5/141 (4%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLP G+RF PTDEELV +YL+ KI G    V VI EVD+CK EPWDLP  S +++ D 
Sbjct  6    LESLPPGFRFGPTDEELVSYYLRRKINGGRG-VQVIPEVDMCKCEPWDLPGKSIIKNQDP  64

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLGR  492
            EWFFFCP+DRKY NG+R NRAT+ GYWKATG DR I S+        +G KKTLV++ GR
Sbjct  65   EWFFFCPRDRKYPNGRRSNRATKAGYWKATGNDRPIKSKSHGSRSDLIGTKKTLVFHEGR  124

Query  493  APEGKRTHWVIHEYRTTENKF  555
            AP GK+THW++HEYR   N F
Sbjct  125  APHGKKTHWIVHEYRANGNAF  145



>ref|XP_009383033.1| PREDICTED: NAC domain-containing protein 67-like [Musa acuminata 
subsp. malaccensis]
Length=407

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YLK KI G E E+ +I EVD+ K EPWDLP+ SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLKRKINGREIELEIIPEVDLYKCEPWDLPEKSFLPSKDLEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +FF P+DRKY NG R NRAT  GYWKATGKDR +SS++ A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATRAGYWKATGKDRRVSSQRRA-VGMKKTLVYYRGRAPHGSR  123

Query  511  THWVIHEYRTTENK  552
            T WV+HEYR  EN+
Sbjct  124  TDWVMHEYRLDENE  137



>ref|XP_009390804.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            +LP G+RF PTDEELV +YLK KI G   E+ +I EVD+ K EPW+LP+ SF+ S D EW
Sbjct  5    TLPPGFRFHPTDEELVGYYLKKKINGHNLELEIIPEVDLYKCEPWELPEKSFLPSKDLEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +FF P+DRKY NG R NRAT+ GYWKATGKDR +SS++ A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATQSGYWKATGKDRRVSSQRRA-VGMKKTLVYYRGRAPHGSR  123

Query  511  THWVIHEYRTTENKFDGT  564
            T WV+HEYR  EN+ + T
Sbjct  124  TDWVMHEYRLDENECETT  141



>gb|KDO61523.1| hypothetical protein CISIN_1g036998mg, partial [Citrus sinensis]
Length=265

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL  KI G   E+ +I E+D+ KHEPWDLPD S++   D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLDRKINGRTIELEIIPEIDLYKHEPWDLPDKSYLPGKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +FF P+D+KY NG R NRAT  GYWKATGKDRT+ S K + VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDKKYPNGSRTNRATRAGYWKATGKDRTVHSHKQS-VGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYR  537
            T+WV+HEYR
Sbjct  124  TNWVMHEYR  132



>ref|XP_003546832.1| PREDICTED: NAC domain-containing protein 68-like [Glycine max]
 gb|KHN48855.1| NAC domain-containing protein 78 [Glycine soja]
Length=347

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL+ KITG   E+ +I EVD+ K EPWDLPD SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLERKITGRSIELDIIAEVDLYKCEPWDLPDKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT+ GYWKATGKDR + S+K  +VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATQAGYWKATGKDRPVHSQK-KQVGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYRTTEN  549
            T+WV+HEYR  E+
Sbjct  124  TNWVMHEYRLIES  136



>ref|XP_003532905.1| PREDICTED: NAC domain-containing protein 74-like [Glycine max]
 gb|KHN21369.1| NAC domain-containing protein 78 [Glycine soja]
Length=348

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL+ KITG   E+ +I EVD+ K EPWDLPD SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLERKITGRSIELEIIAEVDLYKCEPWDLPDKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT+ GYWKATGKDR + S+K  +VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATQAGYWKATGKDRPVHSQK-KQVGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYRTTEN  549
            T+WV+HEYR  E+
Sbjct  124  TNWVMHEYRLIES  136



>ref|XP_006846446.1| hypothetical protein AMTR_s00018p00071850 [Amborella trichopoda]
 gb|ERN08121.1| hypothetical protein AMTR_s00018p00071850 [Amborella trichopoda]
Length=567

 Score =   188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 105/138 (76%), Gaps = 2/138 (1%)
 Frame = +1

Query  145  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  324
            L SLP G+RFRP+DEELV +YL  KI G    V VI E+D+CK EPWDLP  S +++ D 
Sbjct  6    LESLPPGFRFRPSDEELVSYYLIRKINGGGG-VDVIPEIDMCKCEPWDLPGKSIIKTEDP  64

Query  325  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSR-KGAKVGMKKTLVYYLGRAPE  501
            EWFFFCP+DRKY NG+R NRATE GYWKATGKDRTI S+ + + +G KKTLV+Y GRAP 
Sbjct  65   EWFFFCPRDRKYPNGRRSNRATEAGYWKATGKDRTIKSKSRRSLIGTKKTLVFYEGRAPH  124

Query  502  GKRTHWVIHEYRTTENKF  555
            GKRTHW++HEYR   N  
Sbjct  125  GKRTHWIMHEYRANGNAL  142



>ref|XP_009389125.1| PREDICTED: NAC domain-containing protein 19-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHDNE  327
            SLP+G+RFRPTD ELV+HYLK KI+G  ++EV VI E+D+CK+EP DLPD S  +S D+E
Sbjct  16   SLPLGFRFRPTDVELVNHYLKGKISGRIKSEVEVIPEIDVCKYEPCDLPDKSLTKSVDSE  75

Query  328  WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG--AKVGMKKTLVYYLGRAPE  501
            WFFF PKD+KY N  R NRATE GYWK TGKDR I S     A +GMKKTLV++LGRAP+
Sbjct  76   WFFFAPKDKKYPNSNRSNRATEAGYWKPTGKDRMIKSGSACPAIIGMKKTLVFHLGRAPK  135

Query  502  GKRTHWVIHEYRTTENK  552
            G RT+W++HEYRT E++
Sbjct  136  GVRTNWIMHEYRTLESE  152



>ref|XP_007149170.1| hypothetical protein PHAVU_005G047300g [Phaseolus vulgaris]
 gb|ESW21164.1| hypothetical protein PHAVU_005G047300g [Phaseolus vulgaris]
Length=346

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL+ KITG   E+ +I EVD+ K EPWDLPD SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLERKITGRSIELDIIAEVDLYKCEPWDLPDKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT+ GYWKATGKDR + S+K   VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATQAGYWKATGKDRPVHSQK-KPVGMKKTLVYYKGRAPHGLR  123

Query  511  THWVIHEYRTTEN  549
            T+WV+HEYR  E+
Sbjct  124  TNWVMHEYRLIES  136



>ref|XP_010661534.1| PREDICTED: uncharacterized protein LOC100252386 isoform X1 [Vitis 
vinifera]
Length=584

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLPVG+RF PTDEELVDHYLK+KI G  + V +I EVD+CK EPWDLP +S ++++D EW
Sbjct  13   SLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPVLSVIQTNDPEW  72

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK  507
            FFFCP D KY  G+R NRATE GYWK TGKDR I SR   + +G KKTLV+Y GRAP+  
Sbjct  73   FFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSRATKELLGTKKTLVFYRGRAPQSV  132

Query  508  RTHWVIHEYRTT  543
            RT+WV+HEYR  
Sbjct  133  RTNWVMHEYRAA  144



>ref|XP_002268892.1| PREDICTED: NAC transcription factor NAM-B1-like isoform X3 [Vitis 
vinifera]
Length=560

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLPVG+RF PTDEELVDHYLK+KI G  + V +I EVD+CK EPWDLP +S ++++D EW
Sbjct  13   SLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPVLSVIQTNDPEW  72

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK  507
            FFFCP D KY  G+R NRATE GYWK TGKDR I SR   + +G KKTLV+Y GRAP+  
Sbjct  73   FFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSRATKELLGTKKTLVFYRGRAPQSV  132

Query  508  RTHWVIHEYRTT  543
            RT+WV+HEYR  
Sbjct  133  RTNWVMHEYRAA  144



>ref|XP_006422300.1| hypothetical protein CICLE_v10005341mg [Citrus clementina]
 ref|XP_006493742.1| PREDICTED: NAC domain-containing protein 74-like [Citrus sinensis]
 gb|ESR35540.1| hypothetical protein CICLE_v10005341mg [Citrus clementina]
Length=344

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL  KI G   E+ +I E+D+ KHEPWDLPD S++   D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLDRKINGRTIELEIIPEIDLYKHEPWDLPDKSYLPGKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +FF P+D+KY NG R NRAT  GYWKATGKDRT+ S K + VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDKKYPNGSRTNRATRAGYWKATGKDRTVHSHKQS-VGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYR  537
            T+WV+HEYR
Sbjct  124  TNWVMHEYR  132



>ref|XP_010661535.1| PREDICTED: uncharacterized protein LOC100252386 isoform X2 [Vitis 
vinifera]
Length=573

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLPVG+RF PTDEELVDHYLK+KI G  + V +I EVD+CK EPWDLP +S ++++D EW
Sbjct  13   SLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPVLSVIQTNDPEW  72

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK  507
            FFFCP D KY  G+R NRATE GYWK TGKDR I SR   + +G KKTLV+Y GRAP+  
Sbjct  73   FFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSRATKELLGTKKTLVFYRGRAPQSV  132

Query  508  RTHWVIHEYRTT  543
            RT+WV+HEYR  
Sbjct  133  RTNWVMHEYRAA  144



>ref|XP_008371963.1| PREDICTED: protein BEARSKIN1-like [Malus domestica]
Length=351

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL  KI G   E+ +I EVD+ K EPWDLPD SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLDRKINGRTIELEIIPEVDLYKCEPWDLPDKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT  GYWKATGKDR +SS++ A VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVSSQRRA-VGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYRTTEN  549
            T+WV+HEYR  ++
Sbjct  124  TNWVMHEYRLVDS  136



>ref|XP_004293835.1| PREDICTED: NAC domain-containing protein 86 [Fragaria vesca subsp. 
vesca]
Length=347

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            +LP G+RF PTDEELV +YL  KI G   E+ +I EVD+ K EPWDLPD SF+ S D EW
Sbjct  5    TLPPGFRFHPTDEELVAYYLDRKINGRTIELEIIPEVDLYKCEPWDLPDKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT  GYWKATGKDR ++S + A VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVNSNRRA-VGMKKTLVYYKGRAPHGIR  123

Query  511  THWVIHEYRTTE  546
            T+WV+HEYR T+
Sbjct  124  TNWVMHEYRLTD  135



>gb|AGL39702.1| NAC transcription factor 046 [Jatropha curcas]
 gb|KDP36447.1| hypothetical protein JCGZ_08577 [Jatropha curcas]
Length=318

 Score =   180 bits (456),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL  KITG   E+ +I EVD+ K EPWDLP+ SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLDRKITGKTIELEIIPEVDLYKCEPWDLPEKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+D+KY NG R NRAT+ GYWKATGKDR + S+    VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDKKYPNGSRTNRATKAGYWKATGKDRAVHSQ-NRPVGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYRTTENKF  555
            T+WV+HEYR T + F
Sbjct  124  TNWVMHEYRLTHHSF  138



>ref|XP_009363322.1| PREDICTED: NAC domain-containing protein 19-like [Pyrus x bretschneideri]
Length=351

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL  KI G   E+ +I EVD+ K EPWDLPD SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLDRKINGRTIELEIIPEVDLYKCEPWDLPDKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT  GYWKATGKDR +SS+  A VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVSSQSRA-VGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYRTTEN  549
            T+WV+HEYR  ++
Sbjct  124  TNWVMHEYRLVDS  136



>ref|XP_004157040.1| PREDICTED: uncharacterized protein LOC101224912 [Cucumis sativus]
Length=654

 Score =   186 bits (473),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YLK KI G E E+ +I EVD+ K EPWDLP  S + S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLKRKINGREIELEIIPEVDLYKCEPWDLPGKSLLPSKDLEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++S+  A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNSQSRA-VGMKKTLVYYRGRAPHGAR  123

Query  511  THWVIHEYR  537
            T WV+HEYR
Sbjct  124  TDWVMHEYR  132



>ref|XP_004148915.1| PREDICTED: uncharacterized protein LOC101209310 [Cucumis sativus]
 gb|KGN50914.1| hypothetical protein Csa_5G324000 [Cucumis sativus]
Length=654

 Score =   186 bits (473),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YLK KI G E E+ +I EVD+ K EPWDLP  S + S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLKRKINGREIELEIIPEVDLYKCEPWDLPGKSLLPSKDLEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++S+  A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNSQSRA-VGMKKTLVYYRGRAPHGAR  123

Query  511  THWVIHEYR  537
            T WV+HEYR
Sbjct  124  TDWVMHEYR  132



>ref|XP_003595952.1| NAC domain protein [Medicago truncatula]
 gb|AES66203.1| NAC transcription factor-like protein [Medicago truncatula]
Length=346

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            +LP G+RF PTDEELV +YL+ KITG   E+ +I EVD+ K EPWDLP+ SF+ S D EW
Sbjct  5    TLPPGFRFHPTDEELVAYYLERKITGRTIELDIIAEVDLYKCEPWDLPERSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT  GYWKATGKDR ++S+K  +VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATRGGYWKATGKDRAVNSQK-KQVGMKKTLVYYKGRAPHGIR  123

Query  511  THWVIHEYRTTEN  549
            T+WV+HEYR  E+
Sbjct  124  TNWVMHEYRLIES  136



>ref|XP_009340546.1| PREDICTED: NAC transcription factor 29-like [Pyrus x bretschneideri]
Length=351

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL  KI G   E+ +I EVD+ K EPWDLPD SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLDRKINGRTIELEIIPEVDLYKCEPWDLPDKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT  GYWKATGKDR ++S++ A VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVNSQRRA-VGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYR  537
            T+WV+HEYR
Sbjct  124  TNWVMHEYR  132



>ref|XP_010092473.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB51239.1| NAC domain-containing protein 78 [Morus notabilis]
Length=349

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL  KITG   E+ +I EVD+ K EPWDLPD S++ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLDRKITGQTIELEIIPEVDLYKCEPWDLPDKSYLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+DRKY NG R NRAT  GYWKATGKDR +  ++   VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDRKYPNGSRTNRATRAGYWKATGKDRPVQPQR-RPVGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYRTTENKFDG  561
            T+WV+HEYR  E+   G
Sbjct  124  TNWVMHEYRLIEDSLSG  140



>gb|AGL39704.1| NAC transcription factor 048 [Jatropha curcas]
 gb|KDP45802.1| hypothetical protein JCGZ_17409 [Jatropha curcas]
Length=237

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 7/146 (5%)
 Frame = +1

Query  127  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  306
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPW+L + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWELAEKSF  56

Query  307  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  486
            + S D EW+FF P+DRKY NG R NRAT+ GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATKAGYWKSTGKDRRVNSQNRA-IGMKKTLVYYR  115

Query  487  GRAPEGKRTHWVIHEYRTTENKFDGT  564
            GRAP+G RT WV+HEYR  + + D T
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKESDDT  141



>ref|XP_004171745.1| PREDICTED: NAC domain-containing protein 74-like [Cucumis sativus]
Length=152

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 105/140 (75%), Gaps = 7/140 (5%)
 Frame = +1

Query  127  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  306
            P GLPP      G+RF PTDEELV++YLK KI+G E E+ +I EVD+ K EPW+L + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKISGQEIELDIIPEVDLYKCEPWELSEKSF  56

Query  307  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  486
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR +SS+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVSSQNRA-IGMKKTLVYYR  115

Query  487  GRAPEGKRTHWVIHEYRTTE  546
            GRAP+G RT WV+HEYR  +
Sbjct  116  GRAPQGIRTDWVMHEYRLDD  135



>ref|XP_007022771.1| NAC domain containing protein 20 [Theobroma cacao]
 gb|EOY14296.1| NAC domain containing protein 20 [Theobroma cacao]
Length=333

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  151  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  330
            SLP G+RF PTDEELV +YL  KI+G   E+ +I EVD+ K EPWDLPD SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLDRKISGRTIELEIIPEVDLYKCEPWDLPDKSFLPSKDMEW  64

Query  331  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  510
            +F+ P+D+KY NG R NRAT  GYWKATGKDR + S+K A VGMKKTLVYY GRAP G R
Sbjct  65   YFYSPRDKKYPNGSRTNRATRAGYWKATGKDRAVHSQKRA-VGMKKTLVYYRGRAPHGIR  123

Query  511  THWVIHEYRTTE  546
            T+WV+HEYR  E
Sbjct  124  TNWVMHEYRLVE  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920