BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051O14

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB03784.1|  catalase                                                298   1e-95   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          295   3e-94   Ipomoea batatas [batate]
emb|CBI29557.3|  unnamed protein product                                264   9e-87   Vitis vinifera
gb|AGC65520.1|  catalase                                                273   6e-86   Eriobotrya japonica [loquat]
ref|NP_001291326.1|  catalase isozyme 1                                 273   7e-86   Sesamum indicum [beniseed]
gb|ACL27272.1|  catalase                                                273   7e-86   Nicotiana benthamiana
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      273   8e-86   Solanum tuberosum [potatoes]
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             271   9e-86   
gb|AAC84138.1|  catalase                                                262   9e-86   Cichorium intybus [radicchio]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      272   1e-85   Nicotiana sylvestris
gb|AGE15298.2|  catalase 1                                              272   1e-85   Eriobotrya japonica [loquat]
emb|CCP37650.1|  catalase-1                                             272   1e-85   Nicotiana tabacum [American tobacco]
gb|AAB71764.1|  catalase 1                                              272   1e-85   Nicotiana tabacum [American tobacco]
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      270   1e-85   Nelumbo nucifera [Indian lotus]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             271   1e-85   
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 272   1e-85   Cucumis melo [Oriental melon]
ref|NP_001237556.1|  catalase-1/2                                       272   2e-85   Glycine max [soybeans]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             271   2e-85   Populus trichocarpa [western balsam poplar]
dbj|BAC79443.1|  catalase                                               271   2e-85   Acacia ampliceps
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      271   3e-85   Nelumbo nucifera [Indian lotus]
gb|ACJ71244.1|  catalase 2                                              268   5e-85   Vigna unguiculata
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             271   5e-85   
ref|NP_001235974.1|  catalase-3                                         271   5e-85   Glycine max [soybeans]
gb|ACJ71245.1|  catalase 2                                              268   5e-85   Vigna unguiculata
gb|AFU48609.1|  catalase 1                                              270   5e-85   Nicotiana benthamiana
gb|AET97564.1|  catalase                                                270   6e-85   Ziziphus jujuba [Chinese jujube]
gb|ABF93811.1|  Catalase-1, putative, expressed                         267   6e-85   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      270   7e-85   Fragaria vesca subsp. vesca
gb|KJB17474.1|  hypothetical protein B456_003G002800                    269   7e-85   Gossypium raimondii
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          270   8e-85   Vigna radiata var. radiata [golden gram]
gb|AHF27433.1|  catalase                                                270   9e-85   Cucurbita maxima [Boston marrow]
ref|XP_007018034.1|  Catalase 2                                         270   1e-84   
gb|KJB17473.1|  hypothetical protein B456_003G002800                    270   1e-84   Gossypium raimondii
ref|NP_001289779.1|  catalase isozyme 1                                 270   1e-84   Nelumbo nucifera [Indian lotus]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               270   1e-84   Gossypium hirsutum [American cotton]
tpg|DAA43177.1|  TPA: catalase2                                         270   1e-84   
gb|ADZ45555.1|  catalase                                                270   1e-84   Vigna radiata [mung bean]
gb|KHG12976.1|  Catalase isozyme 2                                      270   1e-84   Gossypium arboreum [tree cotton]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             270   1e-84   Phaseolus vulgaris [French bean]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      270   1e-84   Prunus mume [ume]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          270   1e-84   Soldanella alpina
gb|ADZ45556.1|  catalase                                                270   1e-84   Vigna radiata [mung bean]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      269   1e-84   Nicotiana tomentosiformis
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    269   2e-84   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       269   2e-84   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           269   2e-84   
emb|CAD42908.1|  catalase                                               269   2e-84   Prunus persica
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           269   2e-84   Sesamum indicum [beniseed]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      269   2e-84   Nicotiana sylvestris
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      269   2e-84   Cucumis melo [Oriental melon]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    269   2e-84   Gossypium raimondii
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             269   2e-84   Prunus persica
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              269   2e-84   Cicer arietinum [garbanzo]
gb|AIX10947.1|  putative catalase                                       269   2e-84   Gardenia jasminoides
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      269   2e-84   Nicotiana tomentosiformis
gb|AHF27430.1|  catalase                                                269   2e-84   Cucurbita moschata [ayote]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     268   3e-84   Eucalyptus grandis [rose gum]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         269   3e-84   Tarenaya hassleriana [spider flower]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                268   3e-84   Erythranthe guttata [common monkey flower]
ref|XP_002521709.1|  catalase, putative                                 268   3e-84   Ricinus communis
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              268   3e-84   Populus euphratica
ref|NP_001234186.1|  catalase isozyme 2                                 268   4e-84   
ref|XP_010530333.1|  PREDICTED: catalase-2                              268   4e-84   Tarenaya hassleriana [spider flower]
gb|ACB11496.1|  catalase                                                268   4e-84   Pinus sylvestris [Scotch pine]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               268   4e-84   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AIA61608.1|  catalase                                                268   5e-84   Gynostemma pentaphyllum [jiaogulan]
gb|AIZ77475.1|  catalase                                                268   5e-84   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010094556.1|  Catalase isozyme 1                                 268   5e-84   Morus notabilis
ref|NP_001048861.1|  Os03g0131200                                       268   5e-84   
ref|XP_010437527.1|  PREDICTED: catalase-2                              268   5e-84   Camelina sativa [gold-of-pleasure]
ref|XP_007046520.1|  Catalase 2                                         268   5e-84   Theobroma cacao [chocolate]
gb|KHG25152.1|  Catalase isozyme 1                                      268   6e-84   Gossypium arboreum [tree cotton]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         268   6e-84   Jatropha curcas
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               268   6e-84   Ricinus communis
tpg|DAA43178.1|  TPA: catalase2                                         269   6e-84   
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         268   6e-84   Camelina sativa [gold-of-pleasure]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 268   6e-84   
gb|KEH36313.1|  catalase heme-binding enzyme                            266   6e-84   Medicago truncatula
ref|NP_001237571.1|  catalase-4                                         268   7e-84   Glycine max [soybeans]
gb|AHF21552.1|  catalase                                                268   7e-84   Hylocereus undatus [dragon fruit]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         268   7e-84   Camelina sativa [gold-of-pleasure]
gb|EPS69543.1|  catalase                                                268   7e-84   Genlisea aurea
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 268   8e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK24453.1|  unknown                                                 268   8e-84   Picea sitchensis
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 267   8e-84   Populus euphratica
ref|XP_002301920.1|  catalase family protein                            267   8e-84   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               267   8e-84   Populus deltoides
emb|CDX72514.1|  BnaC07g45360D                                          267   9e-84   
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          267   9e-84   Amborella trichopoda
gb|AAC19397.1|  leaf catalase                                           267   1e-83   Mesembryanthemum crystallinum
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               267   1e-83   Cucurbita pepo
gb|AAK96854.1|  catalase                                                267   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240021.1|  catalase                                           267   1e-83   Glycine max [soybeans]
gb|AAO17721.1|  catalase                                                267   1e-83   Hypericum perforatum
ref|XP_010692546.1|  PREDICTED: catalase                                267   1e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         267   1e-83   Oryza brachyantha
ref|NP_001031791.1|  catalase 2                                         266   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             267   1e-83   Eutrema salsugineum [saltwater cress]
dbj|BAH19523.1|  AT4G35090                                              266   1e-83   Arabidopsis thaliana [mouse-ear cress]
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            267   1e-83   Pisum sativum [garden pea]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             267   1e-83   
gb|AJE26131.1|  catalase                                                267   1e-83   Salix matsudana [tortured willow]
gb|ADC95629.1|  catalase                                                267   1e-83   Bruguiera gymnorhiza [Burma mangrove]
gb|AHB72694.1|  catalase                                                267   1e-83   Beta vulgaris subsp. maritima [sea beet]
emb|CAA64220.1|  catalase                                               267   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            267   1e-83   Arabidopsis thaliana [mouse-ear cress]
gb|ACA50528.1|  putative catalase 2                                     267   1e-83   Brassica napus [oilseed rape]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             268   1e-83   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                                267   1e-83   Eutrema halophilum
gb|AFD29285.1|  catalase                                                267   2e-83   Vicia faba [broad bean]
gb|KFK30147.1|  catalase                                                266   2e-83   Arabis alpina [alpine rockcress]
gb|AAF71742.1|AF248491_1  catalase                                      266   2e-83   Raphanus sativus
dbj|BAH37035.1|  catalase 1                                             267   2e-83   Pisum sativum [garden pea]
gb|ACH63223.1|  catalase                                                266   2e-83   Rheum australe [Himalayan rhubarb]
gb|ACV92695.1|  catalase                                                266   2e-83   Brassica oleracea
gb|AAD17935.1|  catalase                                                266   2e-83   Brassica juncea [brown mustard]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                266   2e-83   Erythranthe guttata [common monkey flower]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 266   2e-83   Eucalyptus grandis [rose gum]
gb|AAD17933.1|  catalase                                                266   2e-83   Brassica juncea [brown mustard]
gb|AFU90823.1|  catalase                                                265   2e-83   Populus x beijingensis
gb|ACJ11733.1|  catalase                                                266   2e-83   Gossypium hirsutum [American cotton]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          266   2e-83   Amborella trichopoda
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      266   2e-83   
ref|XP_009138342.1|  PREDICTED: catalase-2                              266   2e-83   Brassica rapa
gb|KJB57963.1|  hypothetical protein B456_009G187600                    266   2e-83   Gossypium raimondii
dbj|BAJ90861.1|  predicted protein                                      266   2e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFN81243.1|  catalase 1                                              266   2e-83   Brassica rapa subsp. pekinensis [bai cai]
gb|AII23739.1|  catalase                                                266   3e-83   Zostera marina
gb|AAR84577.1|  catalase 1b                                             265   3e-83   Lotus japonicus
gb|KEH36312.1|  catalase heme-binding enzyme                            266   3e-83   Medicago truncatula
emb|CDP07287.1|  unnamed protein product                                266   3e-83   Coffea canephora [robusta coffee]
ref|XP_009106100.1|  PREDICTED: catalase-2                              266   3e-83   Brassica rapa
gb|ADM96039.1|  catalase                                                266   4e-83   Cucumis sativus [cucumbers]
gb|AAX88799.1|  catalase                                                266   4e-83   Euphorbia characias
gb|AAR84578.1|  catalase 1a                                             266   4e-83   Lotus japonicus
gb|ABM47415.1|  catalase                                                266   4e-83   Prunus avium [gean]
emb|CDX69111.1|  BnaC01g03420D                                          265   4e-83   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      265   5e-83   
gb|AAF61734.1|AF243519_1  catalase 4                                    265   5e-83   Helianthus annuus
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       263   5e-83   Cucumis sativus [cucumbers]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      265   5e-83   Vitis vinifera
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      265   5e-83   Solanum lycopersicum
gb|ACL35349.1|  catalase                                                265   6e-83   Picea glauca
emb|CAG23920.1|  catalase                                               265   6e-83   Festuca arundinacea [tall fescue]
gb|AFU90822.1|  catalase                                                265   6e-83   Populus tomentosa [Chinese white poplar]
dbj|BAA34714.1|  catalase                                               265   7e-83   Oryza sativa [red rice]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      265   8e-83   Cucumis melo [Oriental melon]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         265   8e-83   Tarenaya hassleriana [spider flower]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     262   8e-83   Eucalyptus grandis [rose gum]
gb|AAD17936.1|  catalase                                                265   8e-83   Brassica juncea [brown mustard]
gb|ABY21704.1|  catalase-1 precursor                                    265   8e-83   Panax ginseng [Asiatic ginseng]
ref|XP_003558892.1|  PREDICTED: catalase-1                              265   8e-83   Brachypodium distachyon [annual false brome]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               265   8e-83   Cucurbita pepo
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       265   8e-83   Cucumis sativus [cucumbers]
ref|XP_002306976.2|  catalase family protein                            265   9e-83   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 263   9e-83   
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             265   1e-82   Capsella rubella
gb|AGV54297.1|  peroxisomal catalase                                    265   1e-82   Phaseolus vulgaris [French bean]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 265   1e-82   Vitis vinifera
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      265   1e-82   Elaeis guineensis
dbj|BAA34205.1|  catalase                                               265   1e-82   Oryza sativa Japonica Group [Japonica rice]
gb|ADU56199.1|  catalase                                                265   1e-82   Hevea brasiliensis [jebe]
ref|NP_001268098.1|  catalase                                           265   1e-82   Vitis vinifera
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               264   1e-82   Gossypium hirsutum [American cotton]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      264   1e-82   Populus euphratica
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             264   1e-82   Phaseolus vulgaris [French bean]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 264   1e-82   Solanum tuberosum [potatoes]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               264   1e-82   Cucurbita pepo
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              263   2e-82   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              265   2e-82   Brassica rapa
gb|AAB62892.1|  catalase-1                                              264   2e-82   Nicotiana glutinosa
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             264   2e-82   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 263   2e-82   
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      264   2e-82   
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      264   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              264   2e-82   
gb|ACL81498.1|  catalase                                                264   2e-82   Ginkgo biloba [ginkgo]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          264   2e-82   Helianthus annuus
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 264   2e-82   Phoenix dactylifera
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    263   2e-82   Arabis alpina [alpine rockcress]
gb|AAF19965.1|AF207906_1  catalase 1                                    263   3e-82   Zantedeschia aethiopica [arum-lily]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      263   3e-82   Phoenix dactylifera
prf||1906388A  catalase                                                 263   4e-82
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      263   4e-82   Eucalyptus grandis [rose gum]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      263   4e-82   Phoenix dactylifera
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      263   4e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001784759.1|  predicted protein                                  263   5e-82   
emb|CDP01803.1|  unnamed protein product                                263   5e-82   Coffea canephora [robusta coffee]
gb|ABV55108.1|  catalase 2                                              263   5e-82   Musa acuminata AAA Group [Cavendish banana]
ref|XP_001752315.1|  predicted protein                                  263   5e-82   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             263   5e-82   
emb|CAE82295.1|  catalase                                               263   6e-82   Homogyne alpina
gb|AAF61733.1|AF243518_1  catalase 3                                    263   6e-82   Helianthus annuus
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         263   6e-82   Setaria italica
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             262   7e-82   Selaginella moellendorffii
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             262   7e-82   Citrus clementina [clementine]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      262   7e-82   Citrus sinensis [apfelsine]
gb|AAK67359.2|AF390210_1  catalase                                      262   7e-82   Suaeda salsa
gb|AAD50974.1|AF170272_1  catalase CAT1                                 262   8e-82   Manihot esculenta [manioc]
gb|AIS20825.1|  CAT                                                     262   9e-82   Pyrus x bretschneideri [bai li]
ref|XP_010061175.1|  PREDICTED: catalase-like                           262   1e-81   Eucalyptus grandis [rose gum]
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      262   1e-81   
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 262   1e-81   Prunus mume [ume]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             262   1e-81   Prunus persica
prf||2104177A  catalase                                                 262   1e-81
emb|CAD42909.1|  catalase                                               261   1e-81   Prunus persica
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      261   2e-81   Elaeis guineensis
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 261   2e-81   Nicotiana sylvestris
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 261   2e-81   Nicotiana tomentosiformis
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              261   2e-81   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             261   2e-81   Eutrema salsugineum [saltwater cress]
emb|CAA45564.1|  catalase                                               261   3e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     263   3e-81   Eucalyptus grandis [rose gum]
prf||1803522A  catalase                                                 261   3e-81
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               261   3e-81   Zea mays [maize]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      260   4e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIP93616.1|  CAT1                                                    260   4e-81   Bassia scoparia [burning bush]
emb|CDY01363.1|  BnaA07g11360D                                          260   5e-81   
ref|XP_009103333.1|  PREDICTED: catalase-1                              260   5e-81   Brassica rapa
gb|AAB86582.2|  catalase                                                260   5e-81   Raphanus sativus
gb|AHA50082.1|  catalase                                                260   5e-81   Eleutherococcus senticosus
gb|AAF61732.1|AF243517_1  catalase 2                                    260   5e-81   Helianthus annuus
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      260   7e-81   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY17510.1|  BnaC03g65530D                                          259   7e-81   Brassica napus [oilseed rape]
emb|CDX76313.1|  BnaA08g10870D                                          259   8e-81   
emb|CDY31877.1|  BnaC07g15270D                                          259   9e-81   Brassica napus [oilseed rape]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              260   9e-81   Populus euphratica
gb|ABB51561.1|  truncated catalase 2                                    258   9e-81   Avicennia marina
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               259   1e-80   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AFR53082.1|  CAT                                                     259   1e-80   Anthurium andraeanum [flamingo-lily]
gb|AIU99487.1|  catalase                                                259   1e-80   Saccharum hybrid cultivar ROC22
gb|AAM97541.1|  catalase 2                                              259   1e-80   Capsicum annuum
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          259   1e-80   Avicennia marina
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 259   2e-80   Oryza brachyantha
emb|CDY52649.1|  BnaAnng11640D                                          258   2e-80   Brassica napus [oilseed rape]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 259   2e-80   Elaeis guineensis
gb|AAM97542.1|  catalase 3                                              259   2e-80   Capsicum annuum
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      259   2e-80   Phoenix dactylifera
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          259   2e-80   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    259   2e-80   Oryza sativa Indica Group [Indian rice]
ref|NP_001058635.1|  Os06g0727200                                       259   2e-80   
gb|AIU99480.1|  catalase                                                258   3e-80   Saccharum spontaneum [fodder cane]
gb|AIU99488.1|  catalase                                                258   3e-80   Saccharum hybrid cultivar ROC22
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               258   3e-80   Zea mays [maize]
ref|NP_001241808.1|  catalase isozyme B                                 258   4e-80   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             258   4e-80   Zea mays [maize]
ref|NP_001105415.1|  catalase isozyme 1                                 258   4e-80   
ref|NP_001105310.1|  catalase isozyme 2                                 258   4e-80   
gb|AGI65617.1|  catalase                                                257   5e-80   Fragaria x ananassa
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      258   6e-80   
gb|AIM43584.1|  catalase                                                257   7e-80   Saccharum hybrid cultivar Yacheng05-179
gb|AAG61140.2|AF332973_1  catalase 2                                    257   7e-80   Zantedeschia aethiopica [arum-lily]
gb|AIU99486.1|  catalase                                                257   7e-80   Saccharum spontaneum [fodder cane]
ref|XP_010692544.1|  PREDICTED: catalase-like                           257   9e-80   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ76836.3|  catalase                                                257   1e-79   Dimocarpus longan [longan]
dbj|BAA34204.1|  catalase                                               257   1e-79   Oryza sativa Japonica Group [Japonica rice]
gb|AIU99481.1|  catalase                                                257   1e-79   Saccharum spontaneum [fodder cane]
gb|AAB70006.1|  catalase                                                256   1e-79   Chlamydomonas reinhardtii
dbj|BAJ88747.1|  predicted protein                                      258   1e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001696763.1|  catalase/peroxidase                                256   1e-79   Chlamydomonas reinhardtii
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             256   1e-79   
gb|AIU99479.1|  catalase                                                256   2e-79   Saccharum arundinaceum
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      256   2e-79   Brachypodium distachyon [annual false brome]
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 256   2e-79   Phoenix dactylifera
emb|CDP07288.1|  unnamed protein product                                256   2e-79   Coffea canephora [robusta coffee]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 256   2e-79   Tarenaya hassleriana [spider flower]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         256   2e-79   Tarenaya hassleriana [spider flower]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 265   2e-79   
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             253   2e-79   
gb|AAY59707.1|  catalase                                                256   3e-79   Oryza sativa Indica Group [Indian rice]
gb|AAC19398.1|  root catalase                                           256   3e-79   Mesembryanthemum crystallinum
ref|XP_011396830.1|  Catalase isozyme 2                                 256   3e-79   Auxenochlorella protothecoides
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      256   4e-79   
ref|NP_564121.1|  catalase 1                                            255   5e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAC17731.1|  catalase 1                                              255   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 256   5e-79   
ref|XP_009149539.1|  PREDICTED: catalase-3                              256   6e-79   Brassica rapa
ref|XP_002950455.1|  catalase                                           255   7e-79   Volvox carteri f. nagariensis
gb|AIU99483.1|  catalase                                                254   1e-78   Saccharum hybrid cultivar ROC22
ref|NP_973873.1|  catalase 3                                            252   1e-78   
gb|ABK24543.1|  unknown                                                 254   1e-78   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             254   2e-78   
emb|CDY29519.1|  BnaA06g14510D                                          254   2e-78   
gb|AAD30291.2|AF139538_1  catalase 2                                    253   2e-78   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    253   2e-78   
gb|AAP80622.1|AF475100_1  catalase isozyme                              246   2e-78   
gb|AAG43363.1|AF151368_1  catalase                                      253   2e-78   
gb|AAD30292.1|AF139539_1  catalase 3                                    253   2e-78   
ref|XP_005645077.1|  catalase                                           253   2e-78   
ref|XP_009110221.1|  PREDICTED: catalase-3                              253   2e-78   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         253   2e-78   
gb|AIU99484.1|  catalase                                                253   3e-78   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         253   3e-78   
dbj|BAA05494.1|  catalase                                               253   3e-78   
emb|CDY33636.1|  BnaC08g19360D                                          253   3e-78   
ref|NP_001031073.1|  catalase 3                                         253   3e-78   
ref|NP_564120.1|  catalase 3                                            253   3e-78   
emb|CDY31878.1|  BnaC07g15280D                                          253   3e-78   
gb|AAB07026.1|  catalase 1                                              253   3e-78   
ref|XP_001779509.1|  predicted protein                                  253   3e-78   
gb|ADQ28492.1|  catalase                                                253   3e-78   
dbj|BAH56915.1|  AT1G20620                                              253   3e-78   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               253   3e-78   
gb|AAM65021.1|  unknown                                                 253   3e-78   
gb|AIU99482.1|  catalase                                                253   4e-78   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               253   4e-78   
gb|ABK41476.1|  catalase                                                253   4e-78   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         253   4e-78   
gb|ACJ22771.1|  catalase 1                                              253   5e-78   
gb|ADU56198.1|  catalase                                                252   5e-78   
emb|CAA73663.1|  catalase                                               252   5e-78   
ref|XP_010477308.1|  PREDICTED: catalase-1                              252   6e-78   
gb|AIU99485.1|  catalase                                                252   6e-78   
ref|XP_002510677.1|  catalase, putative                                 261   6e-78   
emb|CDY01364.1|  BnaA07g11370D                                          254   7e-78   
gb|AHZ13843.1|  catalase                                                252   8e-78   
gb|ABK24449.1|  unknown                                                 252   9e-78   
gb|AFW66787.1|  catalase3                                               252   1e-77   
gb|AGT16310.1|  catalase                                                252   1e-77   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    252   1e-77   
gb|AFW66788.1|  catalase3                                               251   1e-77   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               251   2e-77   
emb|CDY29518.1|  BnaA06g14520D                                          251   2e-77   
ref|XP_009149540.1|  PREDICTED: catalase-1                              251   3e-77   
emb|CDY31490.1|  BnaC05g15990D                                          251   3e-77   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      250   3e-77   
gb|AAC49807.1|  catalase 3                                              250   4e-77   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               250   4e-77   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           250   4e-77
ref|NP_001045673.1|  Os02g0115700                                       250   5e-77   
gb|ABN71233.2|  catalase                                                250   5e-77   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         249   7e-77   
gb|EMS61345.1|  Catalase isozyme 1                                      253   7e-77   
ref|XP_010498496.1|  PREDICTED: catalase-3                              249   8e-77   
gb|ADN94253.1|  catalase                                                249   9e-77   
gb|AEB22071.1|  catalase 2                                              237   2e-76   
gb|AEQ30070.1|  catalase                                                248   2e-76   
gb|EMT05040.1|  Catalase-1                                              249   2e-76   
dbj|BAJ92414.1|  predicted protein                                      248   2e-76   
emb|CAH61266.1|  catalase                                               248   3e-76   
gb|ADY02963.1|  catalase                                                248   3e-76   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      248   3e-76   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               248   3e-76   
emb|CDY40645.1|  BnaA03g53180D                                          248   3e-76   
gb|AFW66785.1|  catalase3 isoform 1                                     253   3e-76   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      248   3e-76   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          248   4e-76   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    248   4e-76   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               247   5e-76   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          248   5e-76
ref|NP_001274863.1|  catalase isozyme 1                                 247   5e-76   
emb|CAA43814.1|  catalase                                               247   6e-76   
gb|ABB88582.1|  catalase                                                247   7e-76   
ref|NP_001234827.1|  catalase isozyme 1                                 247   7e-76   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             245   8e-76   
gb|ABC01913.1|  catalase isozyme 1-like protein                         246   2e-75   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             246   2e-75   
emb|CDY31488.1|  BnaC05g15970D                                          246   3e-75   
gb|AAR97905.1|  catalase                                                245   3e-75   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    245   3e-75   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      245   4e-75   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      245   4e-75   
emb|CAA85470.1|  catalase                                               245   4e-75   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 244   8e-75   
gb|AJF34884.1|  catalase                                                243   2e-74   
gb|AGT16054.1|  catalase                                                243   2e-74   
gb|AGT16188.1|  catalase                                                243   2e-74   
gb|AGT16203.1|  catalase                                                243   3e-74   
gb|EMS51034.1|  Catalase isozyme 2                                      243   3e-74   
gb|ABB72796.1|  catalase isozyme 1-like protein                         242   4e-74   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          243   4e-74   
dbj|BAF91369.1|  catalase                                               242   6e-74   
gb|ADU56189.1|  catalase 1                                              230   1e-73   
gb|AAR14052.2|  catalase                                                241   1e-73   
gb|AAC48918.1|  salicylic acid binding catalase                         241   1e-73   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               241   1e-73   
gb|AGT15888.1|  catalase                                                241   2e-73   
gb|AAF79625.1|AC027665_26  F5M15.5                                      248   3e-73   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              238   9e-73   
ref|XP_002890395.1|  F5M15.5                                            246   1e-72   
dbj|BAQ21275.1|  catalase                                               238   2e-72   
gb|EMT06167.1|  Catalase isozyme 2                                      240   1e-71   
gb|KDD77132.1|  catalase                                                236   1e-71   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        235   2e-71   
ref|NP_001105416.1|  catalase isozyme 3                                 235   3e-71   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             225   7e-71   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     229   5e-69   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                228   1e-68   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   228   1e-67   
ref|XP_005708279.1|  catalase                                           224   3e-67   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          223   2e-66   
gb|AHF27432.1|  catalase                                                211   1e-62   
gb|AAC39465.1|  catalase 3                                              200   3e-62   
ref|XP_005536240.1|  catalase                                           211   6e-62   
gb|AHG98056.1|  catalase                                                205   7e-62   
gb|AHF27429.1|  catalase                                                209   8e-62   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          209   1e-61   
gb|ADI58890.1|  catalase                                                198   5e-61   
gb|ADR01107.1|  catalase 3                                              201   1e-59   
dbj|BAH20307.1|  AT1G20620                                              202   5e-59   
ref|XP_011022275.1|  PREDICTED: catalase-like                           201   2e-58   
ref|XP_009362858.1|  PREDICTED: catalase-4-like                         187   3e-57   
gb|ABR16304.1|  unknown                                                 196   2e-56   
ref|XP_005642928.1|  catalase                                           187   4e-53   
gb|AAL38024.1|AF443179_1  catalase                                      177   5e-52   
gb|AIR77003.1|  catalase                                                179   5e-52   
gb|KFK81701.1|  catalase family protein                                 175   2e-51   
ref|XP_005644653.1|  catalase-domain-containing protein                 184   3e-51   
gb|AIM05077.1|  catalase                                                173   4e-51   
ref|XP_005647994.1|  catalase-domain-containing protein                 181   8e-51   
ref|WP_016090862.1|  catalase                                           171   1e-50   
gb|ACJ71242.1|  catalase 1                                              173   3e-50   
ref|WP_040574212.1|  catalase                                           180   4e-50   
gb|EJF09706.1|  catalase                                                179   4e-50   
ref|WP_036667842.1|  catalase                                           179   4e-50   
ref|WP_024632816.1|  MULTISPECIES: catalase                             179   4e-50   
dbj|GAE06714.1|  catalase                                               173   7e-50   
ref|WP_034700019.1|  catalase                                           179   7e-50   
ref|WP_036612802.1|  catalase                                           179   8e-50   
ref|WP_035405433.1|  catalase                                           178   1e-49   
ref|WP_026975362.1|  catalase                                           178   1e-49   
ref|WP_028402967.1|  catalase                                           178   1e-49   
ref|WP_017674668.1|  catalase                                           178   2e-49   
ref|WP_002162341.1|  catalase                                           177   3e-49   
ref|WP_018976489.1|  catalase                                           177   3e-49   
ref|WP_002978792.1|  catalase                                           177   3e-49   
ref|WP_011983963.1|  catalase                                           177   3e-49   
ref|XP_005712277.1|  unnamed protein product                            177   3e-49   
ref|WP_015737807.1|  catalase                                           177   4e-49   
ref|WP_009590324.1|  catalase                                           177   4e-49   
ref|WP_036662024.1|  catalase                                           177   4e-49   
ref|WP_001069151.1|  catalase                                           176   4e-49   
gb|KFH72187.1|  catalase                                                176   5e-49   
ref|WP_028783654.1|  catalase                                           176   5e-49   
ref|WP_028396461.1|  catalase                                           176   6e-49   
ref|WP_013390447.1|  catalase                                           176   6e-49   
ref|WP_019121620.1|  catalase                                           176   6e-49   
ref|WP_035511089.1|  MULTISPECIES: catalase                             176   7e-49   
ref|WP_035435964.1|  catalase                                           176   7e-49   
ref|WP_020618147.1|  catalase                                           176   7e-49   
ref|WP_003470096.1|  catalase                                           176   7e-49   
gb|AAS40190.1|  catalase                                                175   8e-49   
ref|WP_015846975.1|  catalase                                           176   8e-49   
ref|WP_043068684.1|  catalase                                           176   9e-49   
ref|WP_040058190.1|  catalase                                           176   9e-49   
ref|WP_034285200.1|  catalase                                           176   9e-49   
ref|WP_017691823.1|  catalase                                           176   9e-49   
ref|WP_019393152.1|  catalase                                           176   9e-49   
ref|WP_018395773.1|  catalase                                           176   9e-49   
ref|WP_010788026.1|  Catalase                                           176   1e-48   
ref|WP_006207005.1|  catalase                                           176   1e-48   
ref|WP_007202104.1|  catalase                                           176   1e-48   
ref|WP_001069181.1|  MULTISPECIES: catalase                             176   1e-48   
ref|WP_039073350.1|  catalase                                           175   1e-48   
ref|WP_001069175.1|  catalase                                           176   1e-48   
ref|WP_001069186.1|  catalase                                           176   1e-48   
ref|WP_036640075.1|  catalase                                           175   1e-48   
ref|WP_038700758.1|  catalase                                           176   1e-48   
ref|WP_002194469.1|  catalase                                           175   1e-48   
ref|WP_001069173.1|  catalase                                           175   1e-48   
ref|WP_000184218.1|  catalase                                           175   1e-48   
ref|WP_001069174.1|  catalase                                           175   1e-48   
ref|WP_001069182.1|  MULTISPECIES: catalase                             175   1e-48   
ref|WP_020060313.1|  catalase                                           175   1e-48   
ref|WP_001069172.1|  catalase                                           175   1e-48   
ref|WP_016122096.1|  catalase                                           175   1e-48   
ref|WP_001069187.1|  catalase                                           175   1e-48   
ref|WP_016088914.1|  catalase                                           175   1e-48   
ref|WP_000184219.1|  catalase                                           175   1e-48   
ref|WP_001069185.1|  catalase                                           175   1e-48   
ref|WP_001069180.1|  MULTISPECIES: catalase                             175   1e-48   
ref|WP_042982436.1|  catalase                                           175   1e-48   
ref|WP_001069188.1|  catalase                                           175   1e-48   
ref|WP_038413367.1|  catalase                                           175   1e-48   
ref|WP_038335781.1|  catalase                                           176   1e-48   
ref|WP_001069190.1|  catalase                                           175   1e-48   
ref|WP_001069169.1|  MULTISPECIES: catalase                             175   1e-48   
ref|WP_001069170.1|  catalase                                           175   1e-48   
ref|WP_001069168.1|  catalase                                           175   1e-48   
ref|WP_001069179.1|  MULTISPECIES: catalase                             175   1e-48   
ref|WP_017673056.1|  catalase                                           175   1e-48   
ref|WP_001069191.1|  catalase                                           175   1e-48   
ref|WP_033673856.1|  catalase                                           175   1e-48   
ref|WP_001069177.1|  MULTISPECIES: catalase                             175   1e-48   
ref|WP_002201400.1|  catalase                                           175   1e-48   
ref|WP_001069189.1|  catalase                                           175   2e-48   
ref|WP_001069184.1|  MULTISPECIES: catalase                             175   2e-48   
ref|WP_001069176.1|  MULTISPECIES: catalase                             175   2e-48   
ref|WP_002011249.1|  catalase                                           175   2e-48   
ref|WP_044741157.1|  catalase                                           175   2e-48   
ref|WP_016104158.1|  catalase                                           175   2e-48   
ref|WP_001069171.1|  catalase                                           175   2e-48   
ref|WP_002202803.1|  catalase                                           175   2e-48   
ref|WP_001069183.1|  catalase                                           175   2e-48   
ref|WP_016103618.1|  catalase                                           175   2e-48   
ref|WP_002125906.1|  MULTISPECIES: catalase                             175   2e-48   
ref|WP_044437756.1|  catalase                                           175   2e-48   
ref|WP_002188737.1|  catalase                                           175   2e-48   
ref|WP_002149880.1|  catalase                                           175   2e-48   
ref|WP_002170801.1|  MULTISPECIES: catalase                             175   2e-48   



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/146 (97%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHL+EKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLIEKIQNFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGATAK FFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVKMYTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAVKMYTREGNWDLVGNNFPVFFIR  146



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVKMYTR GN+DLVGNNFPVFFIR
Sbjct  121  GFAVKMYTRGGNWDLVGNNFPVFFIR  146



>emb|CBI29557.3| unnamed protein product [Vitis vinifera]
 emb|CBI37654.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   264 bits (674),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIR  146



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   273 bits (697),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   271 bits (692),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   262 bits (670),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ER+VHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA K YTREGNFD+VGNNFPVFF R
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTR  146



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS++NTPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FNTPF TTN G PV+NN  ALT+GSRGPILLEDYHLVEKI NFTRER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   268 bits (684),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   268 bits (684),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  114  DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  293
            DP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  294  RVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  473
            RVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  474  FAVKMYTREGNFDLVGNNFPVFFIR  548
            FAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIR  145



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+P+ TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   267 bits (682),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIR  146



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   269 bits (687),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPS++F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIR  146



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPS++FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYR SS+FNTPF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGATAK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIR  146



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFI  545
            GFAVK YTREGNFDLVGNNFPVFF+
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFV  145



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FNTPF TTN G PVWNN  ALTVG+RGPILLEDYHLVEK+ N+TRERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVR  146



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+ FCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++NTPFCTTN GAPVWNNT  +++G RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLIEKIATFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTH+I+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSS N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRA GVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDIT+LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIR  146



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIR  146



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPV+NN  +L+VG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP + RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIR  146



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVR  146



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFI  545
            GFAVK YTREGNFDLVGNNFPVFF+
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFV  145



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSFNT F TTN GAPVWNNT A+T+G RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ER+VHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA K YTREGNFD+VGNNFPVFFIR
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIR  146



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLT ADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   267 bits (682),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   267 bits (683),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVR  146



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIR  146



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVH RGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHRRGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPV++N  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIR  146



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFI  545
            GFAVK YTREGN+DLVGNNFPVFF+
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFV  145



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF T N GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKSYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFI  545
            GFAVK YTREGN+DLVGNNFPVFF+
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFV  145



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFI  545
            GFAVK YTREGN+DLVGNNFPVFF+
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFV  145



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ ++P+ TTN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLR PGVQTP+IVRFSTVIHERGSPE+IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  114  DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  293
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  294  RVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  473
            RVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  474  FAVKMYTREGNFDLVGNNFPVFFIR  548
            FAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIR  145



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+H+TCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF TTN GAPVWN+  +LTVGSRGPILLEDYHL+EK+ +FTRER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ER+VHARGA+AK FFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVR  146



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIR  146



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP+K+RPSS FN+P+ TTN GAPVWNN  +LTVGSRGPILLEDYHL+EKI  F RERIP
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKIAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAP VQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPAVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFTR  146



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFI  545
            GFAVK YTREGNFDLVGNNFPVFF+
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFV  145



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GA VWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFIR  146



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK  FEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGLFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVR  146



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FF+VTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+F+TPF TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK+YT EGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKLYTGEGNFDLVGNNFPVFFIR  146



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFP FF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVR  146



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS+++TPF TTN GAPV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ER+VHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA K YTREGNFD+VGNNFPVFF R
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTR  146



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   263 bits (671),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  120  SKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERV  299
            S  RPSS+F+TPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIPERV
Sbjct  3    SHQRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERV  62

Query  300  VHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFA  479
            VHARGA+AK FFEVTHDITHLTCADFLRAPG QTP+IVRFSTVIHERGSPET+RDPRGFA
Sbjct  63   VHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPETLRDPRGFA  122

Query  480  VKMYTREGNFDLVGNNFPVFFIR  548
            VK YTREGNFDLVGNNFPVFF+R
Sbjct  123  VKFYTREGNFDLVGNNFPVFFVR  145



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETPRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DL GNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLAGNNFPVFFIR  146



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  114  DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  293
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  294  RVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  473
            RVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  474  FAVKMYTREGNFDLVGNNFPVFFIR  548
            FAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIR  145



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   265 bits (677),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIR  146



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   262 bits (669),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVG NFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIR  146



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS+FN+ + TTN GAPVWNN  +LTVG+RGPILLEDY LVEKI NF RERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIR  146



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++ L+CADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLSCADFLRAPGVQTPVIVRFSTVIHERVSPETVRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDIT+L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   263 bits (673),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVR  146



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIR  146



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
             FA+K YTREGN+DLVGNNFPVFFIR
Sbjct  121  VFAIKFYTREGNWDLVGNNFPVFFIR  146



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA++K FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIR  146



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RG  LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVR  146



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS+FN PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDIT+L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PFCTTN GAP  NN   LTVG+RG +LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  123  KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  302
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  303  HARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  482
            HARGA+AK FFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  63   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  122

Query  483  KMYTREGNFDLVGNNFPVFFIR  548
            K YTREGNFDLVGNNFPVFFIR
Sbjct  123  KFYTREGNFDLVGNNFPVFFIR  144



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVR  146



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFP FF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVR  146



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+PF TTN GAPVWNN  ++TVGSRGPILLEDYHLVEKI  F RERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVR  146



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+P+CTTN GAPVWNNT +LT+G+RGP+LLEDYHL+EK+  FTRERIP
Sbjct  1    MDPYKHRPSSAYNSPYCTTNQGAPVWNNTSSLTLGNRGPVLLEDYHLIEKLSVFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLR+PGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNN PVFF R
Sbjct  121  GFAVKFYTREGNFDIVGNNIPVFFTR  146



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVT+D++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP + RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGP+ LEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>prf||1906388A catalase
Length=492

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVG NFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIR  146



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DL+GNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIR  146



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS +NTPF TTN G+PVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPE IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIR  146



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DL+GNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIR  146



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS ++TPF TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIR  146



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVR  146



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RP+S++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ER+VHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA K YTREGNFD+VGNNFPVFF R
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTR  146



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS++N PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ER+VHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA K YTREGNFD+VGNNFPVFF R
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTR  146



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ N P  +TN GAPVW+N  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIR  146



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVR  146



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N+P+ T N GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSS NTPF TT+ GAPVWNN  ++TVG+RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMIEKLANFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARG +AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFA K YTREGNFD+VGNNFPVFFIR
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIR  146



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVG NFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIR  146



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>prf||2104177A catalase
Length=492

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDIT LTCADFLRAPGVQTP+IVR STVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRLSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLR+PGVQTP+IVRFSTV +ERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLR+PGVQTP+IVRFSTV +ERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +3

Query  123  KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  302
            ++RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  303  HARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  482
            HARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  125

Query  483  KMYTREGNFDLVGNNFPVFFI  545
            K YTREGNFDLVGNNFPVFF+
Sbjct  126  KFYTREGNFDLVGNNFPVFFV  146



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP ++RPSS+ ++PF TTN GAPVWNN  +L+VG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLR PGVQTP+I RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIH RGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  99   PLISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTR  278
            P  +MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF R
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDR  148

Query  279  ERIPERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  458
            ERIPERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  149  ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  208

Query  459  RDPRGFAVKMYTREGNFDLVGNNFPVFFIR  548
            RDPRGFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  209  RDPRGFAVKFYTREGNFDLVGNNFPVFFVR  238



>prf||1803522A catalase
Length=491

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFFIR
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIR  145



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DLVGNNFPVFFIR
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIR  145



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DL+GNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIR  146



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N+P  TTN GAPVWN+  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THDI+HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIR  146



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRP+SS+N+PF T N GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFFIR
Sbjct  120  GFAVKFYTREGNFDLVGNNFPVFFIR  145



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS+FN+P+ TTN GAP WNN  +LTVG+RGPILLEDY LVE I NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFS VIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISKLTCADFLRAPGVQTPVIVRFSIVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++N PF TTN GAPV+NN  +LTVG+RGPILLEDYH VEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DL+GNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIR  146



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   259 bits (662),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  123  KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  302
            +YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  303  HARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  482
            HARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  62   HARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  121

Query  483  KMYTREGNFDLVGNNFPVFFIR  548
            K YTREGNFDLVGNNFPVFFIR
Sbjct  122  KFYTREGNFDLVGNNFPVFFIR  143



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   259 bits (662),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  123  KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  302
            +YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  303  HARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  482
            HARGA+AK FFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  62   HARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  121

Query  483  KMYTREGNFDLVGNNFPVFFIR  548
            K YTREGNFDLVGNNFPVFFIR
Sbjct  122  KFYTREGNFDLVGNNFPVFFIR  143



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  123  KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  302
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  303  HARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  482
            HARGA+AK FFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPRGFAV
Sbjct  84   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPRGFAV  143

Query  483  KMYTREGNFDLVGNNFPVFFIR  548
            K YTREGNFDLVGNNFPVFFIR
Sbjct  144  KFYTREGNFDLVGNNFPVFFIR  165



>gb|ABB51561.1| truncated catalase 2 [Avicennia marina]
Length=424

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGATAK FFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIR  146



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  132  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  311
            PSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+PERVVHAR
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  312  GATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  491
            GA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  61   GASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  492  TREGNFDLVGNNFPVFFIR  548
            TREGNFDLVGNNFPVFFIR
Sbjct  121  TREGNFDLVGNNFPVFFIR  139



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KYRPSS++++ F TTN G PVWN+  ALT+G+RGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKYRPSSAYDSNFTTTNAGGPVWNDDVALTIGTRGPILLEDYHLIEKVAHFARERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DL+GNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIR  146



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK+YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKLYTREGNFDLVGNNMPVFFIR  146



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  135  SSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHARG  314
            SS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI ERVVHARG
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARG  60

Query  315  ATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYT  494
            A+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK YT
Sbjct  61   ASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  120

Query  495  REGNFDLVGNNFPVFFIR  548
            REGNFDLVGNNFPVFFIR
Sbjct  121  REGNFDLVGNNFPVFFIR  138



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGATAK FFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFD+VGNNFPVFFIR
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIR  146



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSASNSSFWTTNSGAPVWNNNSALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  126  YRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVH  305
            YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVVH
Sbjct  43   YRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVH  102

Query  306  ARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVK  485
            ARGA+AK FFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPRGFAVK
Sbjct  103  ARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVK  162

Query  486  MYTREGNFDLVGNNFPVFFIR  548
             YTREGNFDLVGNN PVFFIR
Sbjct  163  FYTREGNFDLVGNNIPVFFIR  183



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFL APGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+ N+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNNFPVFF+R
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVR  146



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSSSF+T + TTN G PVWN+  ALTVG+RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTTYTTTNAGGPVWNDDQALTVGARGPILLEDYHLIEKIAHFARERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DL+GNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIR  146



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGNFDLVGNN PVFFIR
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIR  146



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNPPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAV  YTREGN+DLVGNNFPVFFIR
Sbjct  120  GFAVNFYTREGNWDLVGNNFPVFFIR  145



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  132  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  311
            PSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIPERVVHAR
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  312  GATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  491
            GA+AK FFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  61   GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  492  TREGNFDLVGNNFPVFFIR  548
            TREGNFDLVGNNFPVFF+R
Sbjct  121  TREGNFDLVGNNFPVFFVR  139



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  290
            MDP K+RPSS+F+T + TTN G PVWN+  ALTVGSRGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDTAYTTTNAGGPVWNDDQALTVGSRGPILLEDYHLIEKIAHFARERIP  60

Query  291  ERVVHARGATAKCFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  470
            ERVVHARGA+AK FFE THD+T+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  471  GFAVKMYTREGNFDLVGNNFPVFFIR  548
            GFAVK YTREGN+DL+GNNFPVFFIR
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIR  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720