BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051M09

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    303   1e-99   Nicotiana tomentosiformis
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    300   2e-98   Nicotiana sylvestris
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    299   7e-98   Nicotiana benthamiana
gb|AFH57998.1|  chloroplast PsbO2 precursor                             297   4e-97   Nicotiana benthamiana
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    296   5e-97   Nicotiana tomentosiformis
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    296   7e-97   Nicotiana sylvestris
gb|AFH58000.1|  chloroplast PsbO4 precursor                             296   8e-97   Nicotiana benthamiana
gb|AFH57997.1|  chloroplast PsbO1 precursor                             296   8e-97   Nicotiana benthamiana
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      296   1e-96   Litchi chinensis [litchi]
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    293   1e-95   Populus euphratica
gb|AFH57999.1|  chloroplast PsbO3 precursor                             293   1e-95   Nicotiana benthamiana
gb|KDP31833.1|  hypothetical protein JCGZ_12294                         292   2e-95   Jatropha curcas
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            292   3e-95   Populus trichocarpa [western balsam poplar]
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    292   3e-95   Sesamum indicum [beniseed]
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    291   4e-95   Sesamum indicum [beniseed]
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          291   1e-94   Dimocarpus longan [longan]
gb|ABK96748.1|  unknown                                                 290   1e-94   Populus trichocarpa x Populus deltoides
ref|XP_007047093.1|  Photosystem II subunit O-2                         290   2e-94   
gb|AAS55410.1|  photosystem II protein                                  285   4e-94   Brassica rapa
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    289   4e-94   Malus domestica [apple tree]
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    289   4e-94   Pyrus x bretschneideri [bai li]
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    288   1e-93   Prunus mume [ume]
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    288   1e-93   Solanum tuberosum [potatoes]
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    288   1e-93   
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    287   2e-93   Ricinus communis
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    287   2e-93   Pyrus x bretschneideri [bai li]
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    287   3e-93   Vitis vinifera
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    286   7e-93   Pyrus x bretschneideri [bai li]
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    286   7e-93   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             284   3e-92   Prunus persica
ref|NP_001239736.1|  uncharacterized protein LOC100798485               283   6e-92   Glycine max [soybeans]
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            283   1e-91   Populus trichocarpa [western balsam poplar]
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    283   1e-91   Nelumbo nucifera [Indian lotus]
gb|KJB43586.1|  hypothetical protein B456_007G208000                    283   1e-91   Gossypium raimondii
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    283   1e-91   Populus euphratica
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    283   1e-91   Solanum tuberosum [potatoes]
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    282   2e-91   Brassica rapa
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    282   2e-91   Nicotiana sylvestris
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   281   3e-91   Citrus sinensis [apfelsine]
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           281   5e-91   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             281   7e-91   Capsella rubella
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             281   7e-91   Citrus clementina [clementine]
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    280   9e-91   Arabis alpina [alpine rockcress]
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     280   1e-90   Solanum tuberosum [potatoes]
gb|AAD38521.1|AF139818_1  33 kDa oxygen evolving protein of photo...    278   1e-90   Brassica napus [oilseed rape]
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             280   1e-90   Eutrema salsugineum [saltwater cress]
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               280   2e-90   Gossypium arboreum [tree cotton]
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    280   2e-90   Solanum tuberosum [potatoes]
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    280   2e-90   Brassica rapa
emb|CDP02430.1|  unnamed protein product                                279   3e-90   Coffea canephora [robusta coffee]
ref|XP_006856169.1|  hypothetical protein AMTR_s00059p00176390          279   3e-90   Amborella trichopoda
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    279   3e-90   Fragaria vesca subsp. vesca
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    279   3e-90   Elaeis guineensis
emb|CDY30764.1|  BnaC07g16640D                                          279   4e-90   Brassica napus [oilseed rape]
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    278   6e-90   Camelina sativa [gold-of-pleasure]
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    278   7e-90   
ref|XP_002877774.1|  photosystem II subunit O-2                         278   7e-90   Arabidopsis lyrata subsp. lyrata
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    278   8e-90   Nelumbo nucifera [Indian lotus]
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        278   1e-89   Arabidopsis lyrata subsp. lyrata
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    278   1e-89   Brassica rapa
emb|CDX81388.1|  BnaC09g07990D                                          278   1e-89   
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                   275   1e-89   
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  277   2e-89   Arabidopsis thaliana [mouse-ear cress]
gb|ADR71223.1|  chloroplast manganese stabilizing protein               276   2e-89   Solanum tuberosum [potatoes]
emb|CDY50981.1|  BnaC02g48890D                                          276   3e-89   Brassica napus [oilseed rape]
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    276   3e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    276   3e-89   Eucalyptus grandis [rose gum]
gb|AAT65501.1|  photosystem II protein                                  276   6e-89   Brassica oleracea
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             276   6e-89   Eutrema salsugineum [saltwater cress]
emb|CBI19622.3|  unnamed protein product                                273   1e-88   Vitis vinifera
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             275   1e-88   Phaseolus vulgaris [French bean]
gb|ABG25041.1|  33kDa precursor protein of oxygen-evolving complex      270   1e-88   Nicotiana tabacum [American tobacco]
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             275   1e-88   Phaseolus vulgaris [French bean]
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    275   1e-88   Arabis alpina [alpine rockcress]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   275   1e-88   
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                275   1e-88   Erythranthe guttata [common monkey flower]
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    275   2e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    274   4e-88   Tarenaya hassleriana [spider flower]
ref|NP_001043134.1|  Os01g0501800                                       274   5e-88   
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       273   5e-88   Arabidopsis thaliana [mouse-ear cress]
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            273   6e-88   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           273   6e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    273   7e-88   Glycine max [soybeans]
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             274   9e-88   
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    273   1e-87   Vitis vinifera
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    273   1e-87   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79166.1|  hypothetical protein VITISV_019248                     272   1e-87   Vitis vinifera
gb|AAL08257.1|  AT5g66570/K1F13_25                                      272   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|EEC70714.1|  hypothetical protein OsI_02088                          272   2e-87   Oryza sativa Indica Group [Indian rice]
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      272   2e-87   Phaseolus vulgaris [French bean]
ref|NP_001241522.1|  uncharacterized protein LOC100820458               271   2e-87   Glycine max [soybeans]
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    271   3e-87   Phoenix dactylifera
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 271   4e-87   Morus notabilis
ref|NP_001240871.1|  uncharacterized protein LOC100811386               271   6e-87   Glycine max [soybeans]
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    270   1e-86   Camelina sativa [gold-of-pleasure]
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    270   2e-86   Brassica rapa
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    268   8e-86   Pisum sativum [garden pea]
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    268   9e-86   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         268   9e-86   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33308.1|  BnaA01g19750D                                          269   1e-85   Brassica napus [oilseed rape]
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    268   1e-85   Setaria italica
emb|CDY26519.1|  BnaC01g23800D                                          268   2e-85   Brassica napus [oilseed rape]
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    265   7e-85   Elaeis guineensis
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   7e-85   Cucumis melo [Oriental melon]
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   8e-85   Cucumis sativus [cucumbers]
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   8e-85   Camelina sativa [gold-of-pleasure]
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   8e-85   Oryza brachyantha
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            264   9e-85   Solanum tuberosum [potatoes]
gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       265   9e-85   Genlisea aurea
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   1e-84   Camelina sativa [gold-of-pleasure]
gb|ABG25040.1|  33kDa precursor protein of oxygen-evolving complex      259   1e-84   Solanum lycopersicum
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II            263   1e-84   Solanum tuberosum [potatoes]
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   1e-84   
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    264   2e-84   
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    264   2e-84   Camelina sativa [gold-of-pleasure]
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      265   3e-84   
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    264   4e-84   Phoenix dactylifera
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   263   9e-84   Medicago truncatula
ref|NP_001130585.1|  uncharacterized protein LOC100191684               261   2e-83   Zea mays [maize]
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       259   2e-82   Triticum urartu
dbj|BAJ89638.1|  predicted protein                                      258   3e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    258   6e-82   Tarenaya hassleriana [spider flower]
gb|AEN02470.1|  oxygen-evolving enhancer protein                        258   7e-82   Camellia sinensis [black tea]
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          257   1e-81   Leymus chinensis
gb|ADB07372.1|  chloroplast managanese stabilizing protein              255   1e-81   Capsicum annuum
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             256   2e-81   Arabidopsis lyrata subsp. lyrata
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    255   8e-81   Salicornia europaea [chicken-claws]
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          255   9e-81   Saccharum hybrid cultivar [sugarcane]
gb|AFK43771.1|  unknown                                                 254   1e-80   Lotus japonicus
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         254   1e-80   
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    253   3e-80   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    254   3e-80   Camelina sativa [gold-of-pleasure]
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    253   3e-80   Fritillaria agrestis
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    253   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    253   4e-80   
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    253   4e-80   
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    252   1e-79   Helianthus annuus
emb|CAA29062.1|  unnamed protein product                                251   2e-79   Spinacia oleracea
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    251   3e-79   Spinacia oleracea
ref|XP_009387680.1|  PREDICTED: oxygen-evolving enhancer protein ...    243   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    248   6e-78   Brachypodium distachyon [annual false brome]
gb|KJB43585.1|  hypothetical protein B456_007G208000                    245   4e-77   Gossypium raimondii
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             243   3e-76   Eutrema salsugineum [saltwater cress]
emb|CAN61828.1|  hypothetical protein VITISV_027630                     240   4e-75   Vitis vinifera
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    237   1e-74   Morus nigra
emb|CDX72613.1|  BnaC07g46350D                                          231   1e-71   
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    230   3e-71   
emb|CDY42709.1|  BnaA03g53620D                                          225   2e-69   Brassica napus [oilseed rape]
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        219   6e-68   Allium cepa
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      222   1e-67   Pinus sylvestris [Scotch pine]
gb|KJB43587.1|  hypothetical protein B456_007G208000                    216   2e-66   Gossypium raimondii
gb|ABR17376.1|  unknown                                                 213   2e-64   Picea sitchensis
gb|ACN40581.1|  unknown                                                 213   2e-64   Picea sitchensis
gb|ABK24541.1|  unknown                                                 213   2e-64   Picea sitchensis
gb|ABK23365.1|  unknown                                                 213   3e-64   Picea sitchensis
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   197   7e-59   Citrus sinensis [apfelsine]
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     194   3e-58   Eucalyptus grandis [rose gum]
gb|AIS72812.1|  oxygen evolving activity                                189   1e-57   Rhizophora apiculata
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             193   1e-57   Phaseolus vulgaris [French bean]
gb|ACE98011.1|  putative protein                                        187   1e-56   Populus tremula [European aspen]
prf||2002393A  oxygen-evolving complex protein 1                        186   3e-55
prf||1204192A  photosystem II protein 33kD                              174   2e-50
ref|XP_001756893.1|  predicted protein                                  173   5e-49   
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    158   2e-44   
ref|XP_004243178.1|  PREDICTED: oxygen-evolving enhancer protein ...    155   6e-44   Solanum lycopersicum
gb|ABV57472.1|  chloroplast PsbO                                        153   2e-43   Phyllostachys edulis [kikko-chiku]
ref|XP_001763258.1|  predicted protein                                  157   3e-43   
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    155   4e-43   Tarenaya hassleriana [spider flower]
ref|XP_001781590.1|  predicted protein                                  156   1e-42   
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        150   3e-40   Chara braunii
ref|NP_001140815.1|  hypothetical protein                               143   1e-38   
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        144   6e-38   Closterium peracerosum-strigosum-littorale complex
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             144   7e-38   Selaginella moellendorffii
gb|ACT83791.1|  putative photosystem II oxygen evolving system 33...    137   3e-37   Lemna minor
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             141   8e-37   
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             135   3e-35   
ref|XP_001784751.1|  predicted protein                                  134   1e-34   
gb|ADC54897.1|  oxygen-evolving enhancer protein                        117   2e-28   Cladophora coelothrix
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             117   4e-28   Ostreococcus tauri
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    116   1e-27   Ostreococcus lucimarinus CCE9901
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    115   2e-27   Coccomyxa subellipsoidea C-169
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              115   3e-27   Chlorella variabilis
ref|XP_010550781.1|  PREDICTED: oxygen-evolving enhancer protein ...    110   2e-26   Tarenaya hassleriana [spider flower]
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          112   2e-26   Chlamydomonas incerta
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    112   4e-26   Chlamydomonas reinhardtii
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    112   4e-26   Chlamydomonas reinhardtii
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    111   8e-26   Micromonas pusilla CCMP1545
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        109   3e-25   Oedogonium obesum
ref|XP_003082811.1|  photosystem II oxygen-evolving complex prote...    106   6e-25   
gb|AFK37254.1|  unknown                                                 102   1e-24   Medicago truncatula
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        107   3e-24   Hafniomonas montana
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        106   5e-24   Pyramimonas parkeae
gb|ADC54900.1|  oxygen-evolving enhancer protein                        102   8e-24   Entransia fimbriata
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...    105   1e-23   Volvox carteri f. nagariensis
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...    105   1e-23   Volvox carteri
gb|ADC54902.1|  oxygen-evolving enhancer protein                        101   2e-23   Klebsormidium flaccidum
gb|ACU65446.1|  putative oxygen-evolving enhancer                     99.8    2e-23   Tragopogon dubius [yellow salsify]
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                      101   6e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...    103   6e-23   Micromonas commoda
ref|XP_007513615.1|  predicted protein                                  103   7e-23   Bathycoccus prasinos
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II        102   8e-23   Nephroselmis olivacea
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...    103   8e-23   Auxenochlorella protothecoides
gb|ACU65447.1|  putative oxygen-evolving enhancer                     97.4    1e-22   Tragopogon pratensis [Jack-go-to-bed-at-noon]
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                      101   3e-22   Monoraphidium neglectum
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    100   5e-22   Euglena stellata
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  99.8    6e-22   Euglena pseudostellata
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II        100   7e-22   Lepidodinium chlorophorum
gb|AGI15739.1|  collinsiaXIII-like protein                            97.8    8e-22   Collinsia rattanii
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  99.0    1e-21   Cryptoglena skujai
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  98.6    1e-21   Monomorphina pyrum
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II      99.4    2e-21   Tetraselmis cordiformis
gb|AEW08532.1|  hypothetical protein CL304Contig1_01                  94.4    3e-21   Pinus radiata
gb|AGI15740.1|  collinsiaXIII-like protein                            95.9    3e-21   Collinsia rattanii
gb|AGI15761.1|  collinsiaXIII-like protein                            96.3    3e-21   Collinsia linearis
gb|AGI15756.1|  collinsiaXIII-like protein                            96.3    3e-21   Collinsia linearis
gb|ADC54906.1|  oxygen-evolving enhancer protein                      95.5    3e-21   Phyllodictyon orientale
gb|AGI15742.1|  collinsiaXIII-like protein                            95.9    3e-21   Collinsia rattanii
gb|ADC54905.1|  oxygen-evolving enhancer protein                      95.5    4e-21   Ostreococcus tauri
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II      98.2    4e-21   Bryopsis plumosa
gb|ADC54893.1|  oxygen-evolving enhancer protein                      95.1    5e-21   Boodlea composita
gb|AFB34200.1|  hypothetical protein CL304Contig1_01                  93.6    5e-21   Abies alba [abete-blanco]
gb|ADC54908.1|  oxygen-evolving enhancer protein                      94.4    9e-21   Siphonocladus tropicus
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II      97.4    1e-20   Chlorarachnion reptans
gb|KIY92168.1|  Oxygen-evolving enhancer protein 1,chloroplastic      94.4    1e-20   Monoraphidium neglectum
gb|ADC54913.1|  oxygen-evolving enhancer protein                      93.6    2e-20   Valonia utricularis
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor         96.3    3e-20   Euglena gracilis
emb|CCI69514.1|  oxygen-evolving enhancer protein                     93.6    4e-20   Scotinosphaera sp. CAUP H5307
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...  95.5    4e-20   Euglena gracilis
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  94.4    5e-20   Discoplastis spathirhyncha
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                   95.1    6e-20   Cyanophora paradoxa
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  94.0    8e-20   Euglena archaeoplastidiata
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1     94.0    1e-19   Gymnochlora stellata
gb|ADC54894.1|  oxygen-evolving enhancer protein                      90.1    3e-19   Bornetella sphaerica
gb|AAP79149.1|  photosystem II protein PsbO                           91.3    1e-18   Bigelowiella natans
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  89.7    2e-18   Euglena granulata
gb|ADE06500.1|  oxygen-evolving enhancer                              85.5    3e-18   Tragopogon porrifolius [oyster plant]
gb|ADC54904.1|  oxygen-evolving enhancer protein                      87.4    3e-18   Nephroselmis olivacea
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II  89.7    3e-18   Coccomyxa subellipsoidea C-169
emb|CCI69513.1|  oxygen-evolving enhancer protein                     86.7    6e-18   Chlorochytrium lemnae
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II      87.8    2e-17   Eutreptiella gymnastica
gb|ADC54890.1|  oxygen-evolving enhancer protein                      83.6    8e-17   Acetabularia acetabulum
gb|ADC54903.1|  oxygen-evolving enhancer protein                      82.4    3e-16   Mesostigma viride
gb|ADC54901.1|  oxygen-evolving enhancer protein                      81.6    4e-16   Ignatius tetrasporus
gb|ADC54898.1|  oxygen-evolving enhancer protein                      81.6    5e-16   Codium sp. HEC 15711
gb|AGI15762.1|  collinsiaXIII-like protein                            81.6    5e-16   Collinsia linearis
gb|ADC54912.1|  oxygen-evolving enhancer protein                      80.1    2e-15   Ulva intestinalis
gb|ADC54899.1|  oxygen-evolving enhancer protein                      79.3    4e-15   Derbesia sp. 2773-1
gb|ADC54891.1|  oxygen-evolving enhancer protein                      78.2    7e-15   Ulvella repens
gb|ADC54895.1|  oxygen-evolving enhancer protein                      78.2    8e-15   Bryopsis sp. EE4
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                     77.4    9e-14   Pyrenomonas helgolandii
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722            76.3    1e-13   Chlorella variabilis
gb|ADC54907.1|  oxygen-evolving enhancer protein                      74.3    2e-13   Tetradesmus obliquus
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                     75.5    3e-13   Porphyridium purpureum
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide      75.1    4e-13   Tolypothrix bouteillei VB521301
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...  75.5    4e-13   Guillardia theta
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...  74.7    5e-13   cyanobacterium PCC 7702
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...  74.7    5e-13   Synechococcus sp. PCC 6312
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111            75.5    5e-13   Guillardia theta CCMP2712
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...  74.7    8e-13   Emiliania huxleyi CCMP1516
ref|XP_002894679.1|  predicted protein                                71.2    9e-13   
emb|CAH25340.1|  oxygen-evolving enhancer                             73.6    1e-12   Guillardia theta
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...  73.6    1e-12   Scytonema hofmannii
gb|ADC54896.1|  oxygen-evolving enhancer protein                      71.6    2e-12   Parachlorella kessleri
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...  72.8    3e-12   Fischerella muscicola
gb|ADC54892.1|  oxygen-evolving enhancer protein                      70.9    3e-12   Blastophysa rhizopus
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                     72.8    4e-12   Botrydium granulatum
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...  72.4    4e-12   Chlorogloeopsis fritschii
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                     72.4    5e-12   Vaucheria frigida
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...  71.6    6e-12   Fischerella sp. PCC 9339
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                     72.4    7e-12   Chroomonas caudata
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                     72.0    7e-12   Dixoniella grisea
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...  71.6    7e-12   Hapalosiphonaceae
gb|ABF59672.1|  photosystem II extrinsic protein O                    71.6    1e-11   Vaucheria litorea
gb|ADC54909.1|  oxygen-evolving enhancer protein                      68.9    1e-11   Tetraselmis striata
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...  70.5    2e-11   Fischerella sp. PCC 9605
gb|EWM24380.1|  oxygen-evolving enhancer protein                      69.7    2e-11   Nannochloropsis gaditana
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...  70.1    2e-11   Fischerella muscicola
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1               69.7    2e-11   Chondrus crispus [carageen]
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...  69.7    3e-11   Cyanothece sp. PCC 7425
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...  69.3    3e-11   
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...  69.3    3e-11   
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...  69.3    3e-11   
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...  69.3    3e-11   
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...  69.7    3e-11   
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...  69.3    4e-11   
gb|ACN35184.1|  unknown                                               68.2    4e-11   
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...  69.3    4e-11   
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...  69.7    4e-11   
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                     70.1    4e-11   
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...  68.9    5e-11   
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...  68.9    5e-11   
sp|P83504.1|PSBO_BRACM  RecName: Full=Oxygen-evolving enhancer pr...  65.1    6e-11   
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...  68.9    6e-11   
gb|EWM24379.1|  oxygen-evolving enhancer protein                      69.7    7e-11   
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                     69.3    8e-11   
gb|KEI69285.1|  PsbO                                                  68.2    1e-10   
gb|ADJ93800.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  67.0    1e-10   
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...  68.2    1e-10   
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...  67.8    1e-10   
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...  68.2    1e-10   
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...  67.8    1e-10   
ref|WP_019500685.1|  hypothetical protein                             67.8    1e-10   
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...  67.8    2e-10   
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...  67.8    2e-10   
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor          68.6    2e-10   
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...  67.8    2e-10   
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II      67.4    2e-10   
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...  67.0    3e-10   
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...  67.0    3e-10   
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...  66.6    3e-10   
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...  66.6    3e-10   
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...  66.6    4e-10   
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...  66.6    4e-10   
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...  66.6    4e-10   
ref|XP_005706438.1|  photosystem II PsbO protein                      66.2    9e-10   
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...  65.5    1e-09   
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...  65.5    1e-09   
ref|WP_017286598.1|  hypothetical protein                             65.5    1e-09   
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...  65.1    1e-09   
gb|ADC54911.1|  oxygen-evolving enhancer protein                      63.2    1e-09   
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...  65.1    1e-09   
ref|WP_016922728.1|  hypothetical protein                             65.1    1e-09   
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...  65.1    1e-09   
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...  64.7    2e-09   
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...  64.7    2e-09   
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...  64.3    3e-09   
ref|XP_005536430.1|  manganese-stabilzing protein precursor           64.7    3e-09   
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...  63.9    3e-09   
dbj|BAJ61708.1|  oxygen-evolving enhancer protein                     62.8    3e-09   
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...  63.9    4e-09   
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...  63.5    4e-09   
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                  63.9    5e-09   
gb|ABO47876.1|  plastid oxygen-evolving enhancer 1-2 precursor        63.5    5e-09   
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...  63.5    6e-09   
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                  63.9    6e-09   
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...  63.2    6e-09   
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                  63.9    6e-09   
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...  63.2    6e-09   
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678            63.5    7e-09   
dbj|BAG85210.1|  extrinsic protein in photosystem II                  63.5    7e-09   
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                     63.2    1e-08   
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor        63.2    1e-08   
gb|AAN11311.1|  oxygen-evolving enhancer 1                            62.8    1e-08   
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...  62.0    2e-08   
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...  62.0    2e-08   
emb|CBN78902.1|  manganese stabilising protein                        62.8    2e-08   
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...  62.0    2e-08   
gb|ADC54910.1|  oxygen-evolving enhancer protein                      60.1    2e-08   
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor     62.4    2e-08   
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...  62.0    2e-08   
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor          62.0    2e-08   
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...  61.6    2e-08   
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...  61.6    2e-08   
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...  61.6    2e-08   
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...  61.6    2e-08   
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein     61.6    2e-08   
ref|WP_011318645.1|  photosystem II manganese-stabilizing protein...  61.6    2e-08   
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor         61.6    3e-08   
gb|ABR26133.1|  oxygen-evolving enhancer protein 1                    60.1    3e-08   
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                  62.0    3e-08   
ref|WP_010997995.1|  manganese-stabilzing protein                     61.2    3e-08   
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...  61.2    3e-08   
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide      61.2    3e-08   
ref|WP_018399127.1|  hypothetical protein                             60.8    4e-08   
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...  60.5    5e-08   
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...  60.5    6e-08   
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...  60.5    6e-08   
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein          60.1    7e-08   
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...  60.5    7e-08   
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...  60.1    9e-08   
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...  60.1    9e-08   
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...  60.1    1e-07   
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...  60.1    1e-07   
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                     60.1    1e-07   
ref|WP_015956866.1|  photosystem II manganese-stabilizing protein...  59.7    1e-07   
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...  59.7    1e-07   
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein     59.3    1e-07   
gb|ACF28695.1|  oxygen evolving complex protein variant               57.4    2e-07   
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)   58.9    2e-07   
gb|ACF28689.1|  oxygen evolving complex protein variant               57.4    2e-07   
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...  58.9    2e-07   
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide      58.9    2e-07   
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...  58.9    2e-07   
gb|ACF28690.1|  oxygen evolving complex protein variant               57.0    2e-07   
ref|WP_037222014.1|  Photosystem II manganese-stabilizing protein...  58.9    2e-07   
gb|ACF28701.1|  oxygen evolving complex protein variant               57.0    2e-07   
gb|AAF13997.1|  photosystem II manganese stabilizing protein          58.9    2e-07   
gb|ACF28693.1|  oxygen evolving complex protein variant               57.0    2e-07   
ref|WP_013323533.1|  photosystem II manganese-stabilizing protein...  58.9    2e-07   
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...  58.9    2e-07   
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                   58.9    3e-07   
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                  58.9    3e-07   
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)  58.5    3e-07   
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...  58.5    4e-07   
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...  58.2    4e-07   
ref|WP_027841041.1|  Photosystem II manganese-stabilizing polypep...  58.2    4e-07   
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...  58.2    4e-07   
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...  57.8    6e-07   
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...  57.4    7e-07   
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...  57.4    7e-07   
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO     57.8    7e-07   
ref|WP_017662186.1|  hypothetical protein                             57.4    7e-07   
gb|ACF28700.1|  oxygen evolving complex protein variant               56.2    8e-07   
ref|WP_015785306.1|  MULTISPECIES: photosystem II manganese-stabi...  57.4    8e-07   
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...  57.0    1e-06   
ref|WP_019506429.1|  hypothetical protein                             57.0    1e-06   
ref|WP_008233010.1|  Photosystem II manganese-stabilizing protein...  56.2    2e-06   
ref|WP_015170887.1|  photosystem II manganese-stabilizing protein...  55.8    2e-06   
ref|WP_007100705.1|  photosystem II manganese-stabilizing polypep...  55.8    3e-06   
ref|WP_010873097.1|  photosystem II manganese-stabilizing polypep...  55.5    4e-06   
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...  55.5    4e-06   
ref|WP_044204234.1|  Photosystem II manganese-stabilizing polypep...  55.1    4e-06   
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...  55.1    5e-06   
ref|WP_038016162.1|  Photosystem II manganese-stabilizing polypep...  55.1    5e-06   
gb|EDX87597.1|  Manganese-stabilizing protein / photosystem II po...  55.1    6e-06   
gb|EDX78335.1|  Manganese-stabilizing protein / photosystem II po...  54.7    6e-06   
ref|WP_008313000.1|  Manganese-stabilising protein / photosystem ...  54.7    8e-06   
ref|WP_011243530.1|  MULTISPECIES: photosystem II PsbO protein        54.3    1e-05   
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein     54.3    1e-05   
gb|ACF28688.1|  oxygen evolving complex protein variant               52.4    1e-05   
ref|WP_015109468.1|  Manganese-stabilising protein / photosystem ...  53.9    1e-05   
ref|WP_026072511.1|  Photosystem II manganese-stabilizing protein...  53.5    2e-05   
gb|EJK75097.1|  hypothetical protein THAOC_03193                      53.5    2e-05   
ref|WP_035832498.1|  Photosystem II manganese-stabilizing polypep...  53.5    2e-05   
ref|WP_015133089.1|  photosystem II manganese-stabilizing protein...  53.5    2e-05   
ref|WP_006456861.1|  Manganese-stabilizing protein / photosystem ...  53.1    2e-05   
ref|XP_002291225.1|  oxygen-evolving enhancer protein 1 precursor     53.1    2e-05   
ref|WP_035985606.1|  hypothetical protein                             53.1    3e-05   
ref|WP_039726071.1|  MULTISPECIES: Photosystem II manganese-stabi...  53.1    3e-05   
ref|WP_015219672.1|  photosystem II manganese-stabilizing protein...  53.1    3e-05   
gb|ACF28697.1|  oxygen evolving complex protein variant               51.2    3e-05   
gb|ACF28692.1|  oxygen evolving complex protein variant               51.2    3e-05   
gb|ACF28698.1|  oxygen evolving complex protein variant               51.2    3e-05   
gb|EKD06931.1|  photosystem II manganese-stabilizing protein PsbO     52.8    3e-05   
ref|WP_006616815.1|  MULTISPECIES: photosystem II manganese-stabi...  52.8    3e-05   
emb|CDX73783.1|  BnaC08g22200D                                        50.4    4e-05   
ref|WP_011932278.1|  photosystem II manganese-stabilizing protein...  52.4    5e-05   
ref|WP_024544659.1|  Photosystem II manganese-stabilizing polypep...  52.4    5e-05   
ref|WP_011618325.1|  photosystem II manganese-stabilizing protein     52.0    5e-05   
ref|WP_038542990.1|  Photosystem II manganese-stabilizing polypep...  52.0    5e-05   
ref|WP_010314562.1|  photosystem II manganese-stabilizing protein     52.0    6e-05   
gb|ACF28691.1|  oxygen evolving complex protein variant               50.4    6e-05   
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...  52.0    7e-05   
gb|ACF28699.1|  oxygen evolving complex protein variant               50.1    7e-05   
ref|WP_015192867.1|  photosystem II manganese-stabilizing protein...  51.6    8e-05   
ref|WP_002791059.1|  Photosystem II manganese-stabilizing polypep...  51.6    9e-05   
ref|WP_006853634.1|  photosystem II manganese-stabilizing protein...  51.6    9e-05   
ref|WP_002800587.1|  Photosystem II manganese-stabilizing polypep...  51.6    9e-05   
ref|YP_002049183.1|  Photosystem II manganese-stabilizing polypep...  51.2    1e-04   
gb|ABH09263.1|  photosystem II manganese-stabilizing protein          51.2    1e-04   
ref|WP_002773425.1|  Photosystem II manganese-stabilizing polypep...  51.2    1e-04   
ref|WP_006510630.1|  Manganese-stabilising protein / photosystem ...  50.8    1e-04   
gb|AHJ27766.1|  Photosystem II manganese-stabilizing protein (PsbO)   50.8    1e-04   
ref|WP_023065168.1|  photosystem II manganese-stabilizing polypep...  50.8    1e-04   
ref|WP_011613279.1|  photosystem II manganese-stabilizing protein...  50.8    1e-04   
ref|WP_043737375.1|  Photosystem II manganese-stabilizing polypep...  50.8    2e-04   
emb|CAK29098.1|  Photosystem II manganese-stabilizing protein PsbO    50.4    2e-04   
ref|WP_008199011.1|  Photosystem II manganese-stabilizing polypep...  50.4    2e-04   
ref|WP_028953543.1|  Photosystem II manganese-stabilizing polypep...  50.4    2e-04   
ref|WP_004162736.1|  Photosystem II manganese-stabilizing polypep...  50.1    2e-04   
ref|WP_006172331.1|  photosystem II manganese-stabilizing polypep...  50.1    3e-04   
ref|WP_004160298.1|  Photosystem II manganese-stabilizing polypep...  50.1    3e-04   
ref|WP_002738218.1|  photosystem II manganese-stabilizing polypep...  50.1    3e-04   
ref|WP_002761031.1|  Photosystem II manganese-stabilizing polypep...  50.1    3e-04   
ref|WP_002741980.1|  photosystem II manganese-stabilizing polypep...  49.7    4e-04   
ref|WP_011360791.1|  photosystem II manganese-stabilizing polypep...  49.7    4e-04   
ref|WP_025782239.1|  Photosystem II manganese-stabilizing polypep...  49.3    5e-04   
ref|WP_036480960.1|  Photosystem II manganese-stabilizing polypep...  49.3    5e-04   
ref|WP_009788842.1|  photosystem II manganese-stabilizing polypep...  48.9    6e-04   
ref|WP_017293645.1|  hypothetical protein                             48.9    7e-04   
ref|WP_011127177.1|  photosystem II manganese-stabilizing polypep...  48.9    7e-04   
ref|WP_030006064.1|  Photosystem II manganese-stabilizing polypep...  48.9    8e-04   
ref|WP_015151496.1|  Manganese-stabilising protein / photosystem ...  48.5    0.001   
ref|WP_015223075.1|  photosystem II manganese-stabilizing protein...  48.5    0.001   



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 167/184 (91%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV P+      RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
             F+DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V +FAFKPGKY+AKKFCLEPTSFTVKA+SV+KNAPP+FQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 166/184 (90%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV P+      RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V +FAFKPGKY+AKKFCLEPTSFTVKA+SV+KNAPP+FQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   299 bits (765),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 165/184 (90%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV P+      RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V +FAFKPGKY+A KFCLEPTSFTVKA+SV+KNAPP+FQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   297 bits (760),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 164/184 (89%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MA SLQ AATLMQPTKVGV P+      RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MATSLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V +FAFKPGKY+A KFCLEPTSFTVKA+SV+KNAPP+FQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   296 bits (759),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 164/184 (89%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV  +      RS Q+V KA GV+P+ A++TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSVSKAFGVEPAAAKLTCSLQSDLKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL++SGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVISGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            VE+FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   296 bits (758),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 164/184 (89%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV  +      RS Q++ KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSLSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V++FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VDSFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   296 bits (758),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 163/184 (89%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV  +      R  Q+V KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRLSQSVSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            VE+FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   296 bits (758),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 164/184 (89%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MA SLQ AATLMQPTKVGV P+      RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAVSLQAAATLMQPTKVGVAPARNNLQLRSAQSVCKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V +FAFKPGKY+AKKFCLEPTSFTVKA+SV+KNAPP+FQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   296 bits (757),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV+P+      RS Q+V KA GVD +  RITCSLQS  K++A 
Sbjct  1    MAASLQAAATLMQPTKVGVSPARSTVQLRSSQSVSKAFGVDSAGGRITCSLQSDFKDMAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
               DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V++FAFKPGKY AKK CLEPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  VDSFAFKPGKYQAKKLCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   293 bits (749),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 162/183 (89%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV        RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            E+FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   293 bits (749),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV  +      RS Q V KA GV+P+ AR+ CS QS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQCVSKAFGVEPAAARLNCSFQSDLKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAVKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            VE+FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 159/183 (87%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV   I    RS Q V KA G++PS ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRISLQLRSSQNVSKAFGLEPSTARISCSLQSDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            + FA KPGKY+AKKFCLEPTSFTVKA+ VSKNAPPEFQNTKLMTR TYTLDEIEGPFEV+
Sbjct  121  DKFAIKPGKYNAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVA  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   292 bits (747),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 161/183 (88%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV        RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLARK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            E+FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   292 bits (747),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 163/183 (89%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AATLMQPTKVGV+       RS Q+VGK+ GV+P+ AR++CSLQ+ +K+LA  
Sbjct  1    MATSLQAAATLMQPTKVGVSARSSLQLRSVQSVGKSFGVEPASARLSCSLQADLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   CTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY+AKKFCLEPTSFTVKA+ V+KNAPPEFQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  QDG  183



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   291 bits (746),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +3

Query  36   ASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  215
            +SLQ AATLMQPTKVG T    RS QT+GKA GV+P+ AR+TCSLQ+ +K+LAH  +DAA
Sbjct  4    SSLQAAATLMQPTKVGRTSLQLRSVQTLGKAFGVEPAGARMTCSLQADLKDLAHKLTDAA  63

Query  216  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  395
            K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV++FAF
Sbjct  64   KIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAF  123

Query  396  KPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K GKY+AKKFCLEPTSFTVKA+ V+KNAPPEFQ TKLMTR TYTLDEIEGPF VS DG
Sbjct  124  KAGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFVVSEDG  181



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 159/184 (86%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV+P+      RS+Q+V KA G D +  RITCSLQ   K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVSPARSTVQLRSFQSVSKAFGADSAGGRITCSLQPDFKDLAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DA K+AGFALAT AL+VSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCADATKIAGFALATPALVVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V++FAFKPGKY AKKFCLEPTSFTVKA+ V+KN+PPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  VDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNSPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV        RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA+K+AGFALATSAL+ SGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALIASGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            E+FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   290 bits (742),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV---TPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV   T    RS Q+V KA G++P  AR+TCSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSVQLRSSQSVSKAFGLEPVGARLTCSLQSDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY AKKFCLEPTSFTVKA+ VSKNAPPEFQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVSKNAPPEFQRTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
            +DG
Sbjct  181  TDG  183



>gb|AAS55410.1| photosystem II protein [Brassica rapa]
Length=233

 Score =   285 bits (730),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 156/184 (85%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  16   MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDIKDFAG  75

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  76   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  135

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  136  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  195

Query  558  SSDG  569
            SSDG
Sbjct  196  SSDG  199



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV+       RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  TEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            + DG
Sbjct  181  APDG  184



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV+       RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            + DG
Sbjct  181  APDG  184



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV---TPSIGRSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVG    T  + RS Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1    MAASLQAAATLMQPTKVGAPARTSLLLRSSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
               DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            +E FAFKPGKY+AKKFCLEPTSFTVKA+SV+KNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            MAASLQ AATLMQPTKVG   ++  RS Q+V KA GV+   AR+TCSLQ++IKELA   +
Sbjct  1    MAASLQAAATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCT  60

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61   DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FAFKPGKY+AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEVS D
Sbjct  121  FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPD  180

Query  567  G  569
            G
Sbjct  181  G  181



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            MAASLQ AATLMQPTKVGV  ++  RS Q+V KA GV+    R+TCSLQ++IKELA   +
Sbjct  1    MAASLQAAATLMQPTKVGVRNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCT  60

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61   DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FAFKPGKY+AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEVS D
Sbjct  121  FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPD  180

Query  567  G  569
            G
Sbjct  181  G  181



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 160/185 (86%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AATLMQPTKVG  PS       RS Q+V KA G++P+ ARITCSLQS +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGGVPSSRATLQLRSSQSVSKAFGLEPASARITCSLQSDLKDLA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
                DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            G++ F+FK GKY+AKKFCLEPTSFTVKA+SV+KNAPPEFQNTKLMTR TYTLDEIEGPFE
Sbjct  121  GLDKFSFKAGKYNAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            V  DG
Sbjct  181  VGPDG  185



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV+       RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            + DG
Sbjct  181  APDG  184



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   287 bits (734),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV        RS Q+V KA G++P+ AR TCSLQ+ +K+LAH 
Sbjct  1    MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKDLAHK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA K+AGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKIAGFALATSALLVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFK GKY  KKFCLEPTSFTVKA+ VSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   286 bits (731),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVGV+       RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E FAFKPGKY+AKKFCLEPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLD+IEGPFEV
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDQIEGPFEV  180

Query  558  SSDG  569
            + DG
Sbjct  181  APDG  184



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   286 bits (732),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 163/185 (88%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV-TPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AATLMQP+KVGV + SIG    RS   + +A G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPSKVGVASRSIGGQQLRSGSHLSRAFGFEPTTARLTCSLQSDLRDLA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
            H  SDAAKLAGFALATSAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   HKCSDAAKLAGFALATSALVVAGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++FAFKPGKY+AKKFCLEPTSFTVKA+ VSKNAP EFQ TKLMTR TYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNAPAEFQRTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VS DG
Sbjct  181  VSPDG  185



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   284 bits (727),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 158/184 (86%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVG         R  Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1    MAASLQAAATLMQPTKVGAPARTSLQLRPSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
               DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            +E FAFKPGKY+AKKFCLEPTSFTVKA+SV+KNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   283 bits (725),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AAT MQPTKVG+     +S Q + KA G++P+ A++TCSLQ  +KE A    D
Sbjct  1    MAASLQAAATFMQPTKVGIASRNLKSTQCISKAFGLEPAAAKLTCSLQPDLKEFAQKCVD  60

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            AFKPGKY+A+K CLEPTSFTVKA+ V+KNAPPEFQNTKLMTR TYTLDEIEGPFEV+SDG
Sbjct  121  AFKPGKYNAQKLCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFEVTSDG  180



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 161/183 (88%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV        RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY+AKK CLEPTSFTVKA+ ++KN+PP+FQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV+   G   RS Q+V KA G + S AR+TCSLQS +K+ A  
Sbjct  1    MAASLQAAATLMQPTKVGVSSRSGQQLRSSQSVCKAFGFETSGARLTCSLQSDLKDFAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA+K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG+
Sbjct  61   CVDASKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGI  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++F FK GKY+ KKFCLEPTSFTVKA+ VSKN+PPEFQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFGFKSGKYNMKKFCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
            +DG
Sbjct  181  TDG  183



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV---TPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AATLMQP KV     T  + RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY AKKFCLEPTSFTVKA+ V+KNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
            +DG
Sbjct  181  TDG  183



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 161/183 (88%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV        RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY+AKK CLEPTSFTVKA+ ++KN+PP+FQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVG   +      RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V++FAFKPGKY+AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 156/184 (85%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDIKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 156/184 (85%), Gaps = 9/184 (5%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATL     +GV PS      RS   V KA GV+PS AR+TCSLQ+  K+LA 
Sbjct  1    MAASLQAAATL-----IGVIPSRNNLQFRSSHCVSKAFGVEPSSARLTCSLQADFKDLAQ  55

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56   KCSDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  115

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            VE FAFKPGKY+AKKFCLEPTSFTVKA+ V+KN+PPEFQ TKLMTR TYTLDEIEGPFEV
Sbjct  116  VETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPEFQKTKLMTRLTYTLDEIEGPFEV  175

Query  558  SSDG  569
            SSDG
Sbjct  176  SSDG  179



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   281 bits (720),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQT-----VGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AATLMQPTKVGV P+   S Q      V KA GVD + ARI+CSL + +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCSLNNDLKDLA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++FAFKPGKY AKKFCLEPTSFTVKA+SV+KNAPP+FQNTKLMTR TYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VS DG
Sbjct  181  VSPDG  185



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 155/183 (85%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQP KVGV    G   RS Q V +A G++P+ ARITCS Q+  K+LA  
Sbjct  1    MAASLQAAATLMQPAKVGVPSRTGLQLRSSQIVSRAFGLEPAAARITCSSQTDFKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA K+AGFALATSAL+VSGA AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGAGAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY+ KK CLEPTSFTVKA+ V+KNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNVKKLCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   281 bits (718),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (85%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   281 bits (718),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 159/185 (86%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQT-----VGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AATLMQPTKVGV P+   S Q      V KA GVD + ARI+C+L + +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCTLNNDLKDLA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++FAFKPGKY AKKFCLEPTSFTVKA+SV+KNAPP+FQNTKLMTR TYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VS DG
Sbjct  181  VSPDG  185



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   280 bits (717),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 153/183 (84%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AAT +QP K+  +PS     RS QTVGK+ G+D SPAR+TCSL S  K+    
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSPARLTCSLHSDFKDFVGK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV 
Sbjct  121  EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 4/183 (2%)
 Frame = +3

Query  33   AASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            AASLQ AATLMQPTKVG   +      RS Q+V KA G++PS +R++CSLQ+ +K+ A  
Sbjct  1    AASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY+AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>gb|AAD38521.1|AF139818_1 33 kDa oxygen evolving protein of photosystem II [Brassica napus]
Length=274

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+A T +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 155/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSAATFLQSAKIATAPSRGGSHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SEIFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 156/183 (85%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AATLMQP KV          RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVPLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLALK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY AKKFCLEPTSFTVKA+ V+KNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
            +DG
Sbjct  181  TDG  183



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVG   +      RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V++FAFK GKY+AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VDSFAFKSGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 156/184 (85%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+A+T +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSASTFLQAAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPS---IGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQP KVGV P    + RS   + KA GV+ S AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLQAAATLMQPAKVGVAPRNNVLLRSSPNLSKAFGVEQSSARLTCSLQADLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV
Sbjct  61   CTDAAKVAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            + FAFKPGKY AKK CLEPTSFTVKA+  +KN+PPEFQ TKLMTR TYTLDEIEGPFEV+
Sbjct  121  DKFAFKPGKYDAKKLCLEPTSFTVKAEGPNKNSPPEFQKTKLMTRLTYTLDEIEGPFEVN  180

Query  561  SDG  569
            +DG
Sbjct  181  TDG  183



>ref|XP_006856169.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 155/183 (85%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTK+G +   G   RS   + KA G +PS AR+TCS+Q  ++ELAH 
Sbjct  1    MAASLQAAATLMQPTKLGGSSRNGLQLRSSSQICKAFGFEPSSARLTCSIQEDLRELAHK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTY EVKG+GTANQCP I+GGV
Sbjct  61   CVDATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYTEVKGTGTANQCPAIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            + FAFKPGKY+ KKFCLEPTSFTVKA+S++KNAPPEFQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DKFAFKPGKYNMKKFCLEPTSFTVKAESINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 155/183 (85%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV--TPSIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHN  200
            MAAS+Q AATLMQPTK+GV    S+      V KA G++P+ + R+TCSLQ+ +KE AH 
Sbjct  1    MAASMQAAATLMQPTKLGVPSRTSLQLRSSNVSKAFGLEPAASSRLTCSLQTDLKEFAHK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG 
Sbjct  61   CVDATKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGS  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            E FAFKPGKY AKKFCLEPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  EAFAFKPGKYVAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 157/185 (85%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSI--GRSYQT---VGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AATLMQP KVG T     G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPAKVGATGRTLAGQQLRTSSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
            H  +DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   HKCADATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++FAFKPGKY  KK CLEPTSFTVKA+ VSKNAPPEFQ TKLMTR TYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VS +G
Sbjct  181  VSPNG  185



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 155/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +   K+   PS G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1    MAASLQSAATFLLSAKISAAPSRGSAHLRSTQTVGKSFGLESSSARLTCSYQSDIKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   278 bits (712),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 155/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +Q  K+  TPS G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTTPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+ KPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   278 bits (712),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATLMQPTKVG   +      RS Q++ KA G++PS ++++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLPLRSAQSLSKAFGLEPSASKLSCSLQADLKDFAQ  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            V++F+FKPGKY+AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEV
Sbjct  121  VDSFSFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S DG
Sbjct  181  SPDG  184



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   278 bits (711),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 154/183 (84%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AAT +QP K+  +PS     RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             S+AAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSEAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV 
Sbjct  121  ETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   278 bits (711),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 154/183 (84%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATL QPTKVGV    G   RS  TV K  G DPS AR+TCSLQS +KELA  
Sbjct  1    MAASLQAAATLRQPTKVGVPVKGGLQLRSTPTVCKNFGFDPSCARLTCSLQSDLKELAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFK GKY+ KK CLEPTSFTVKA+ VSKNAPPEFQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKTGKYNLKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  PDG  183



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 153/184 (83%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+ AT +Q  K+   PS G    RS Q+VGK+ G+D S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSAHLRSTQSVGKSFGLDTSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+A T +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+A T +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>ref|XP_003637254.1| Oxygen-evolving enhancer protein, partial [Medicago truncatula]
Length=255

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +FKPGKY+AKKFCLEPTSFTVKA+ V+KN P  FQNTKLMTR TYTLDEIEGPFEVSSDG
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSSDG  180



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 152/183 (83%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AAT +QP K+  +PS     RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            E F+FK GKY+ KKFC EPTSFTVKA SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV 
Sbjct  121  ETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = +3

Query  51   AATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAG  227
            AATLMQPTKVG   ++  RS Q+V KA GV+   AR+TCSLQ++IKELA   +DAAK+AG
Sbjct  2    AATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCTDAAKIAG  61

Query  228  FALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  407
            FALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGK
Sbjct  62   FALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGK  121

Query  408  YSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            Y+AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  122  YTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDG  175



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 155/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+A+T +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSASTFLQSAKIITAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            SSDG
Sbjct  181  SSDG  184



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+ KPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVG-VTPSIGRSYQTVGKALGVD-PSPARITCSLQSQIKELAHNF  203
            MAASLQ AATLMQPTKVG ++ S  RS Q V K  G++  + +R+TCSLQ+ +K+LA   
Sbjct  1    MAASLQAAATLMQPTKVGRISSSQLRSSQNVSKTFGLECGAGSRVTCSLQADLKDLAQKC  60

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  383
            +DA K+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG++
Sbjct  61   ADATKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLD  120

Query  384  NFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
            +FAFKPGKY+AKK CLEPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS 
Sbjct  121  SFAFKPGKYNAKKICLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSP  180

Query  564  DG  569
            DG
Sbjct  181  DG  182



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   276 bits (707),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT  Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  16   MAASLQSAATFFQSAKISTAPSRGSAHLRSAQTVGKSFGLETSSARLTCSYQSDIKDFAG  75

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  76   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  135

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTR T TLDEIEGPFEV
Sbjct  136  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTCTLDEIEGPFEV  195

Query  558  SSDG  569
            SSDG
Sbjct  196  SSDG  199



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   276 bits (705),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 152/183 (83%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ A T +QP K+  +PS     RS QTV K+ G++ SPAR+TCSL S  K+ A  
Sbjct  1    MATSLQAATTFLQPAKIAASPSRSVHLRSNQTVAKSFGLESSPARLTCSLHSDFKDFAGK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKVAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPP+FQNTKLMTR TYTLDEIEGPFEV 
Sbjct  121  EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>emb|CBI19622.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 153/182 (84%), Gaps = 3/182 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASL  AATL QPTK G+    G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFK G Y+ KKFCLEPTSFTVKA+ VSKNAP EFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SD  566
            SD
Sbjct  181  SD  182



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            MAASLQ AAT MQPTK+G T ++  +S Q++ KA G++P+ A+I+CSL + +K+ A    
Sbjct  1    MAASLQAAATFMQPTKLGRTNTLQLKSPQSISKAFGLEPAGAKISCSLHADLKDFAQKCV  60

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61   DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FAFKPGKY+AKK CLEPTSFTVKA+ V+KNAP EFQNTKLMTR TYTLDEIEGPFEVSSD
Sbjct  121  FAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSD  180

Query  567  G  569
            G
Sbjct  181  G  181



>gb|ABG25041.1| 33kDa precursor protein of oxygen-evolving complex [Nicotiana 
tabacum]
Length=179

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +3

Query  102  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  281
            RS Q+V KA GV+P+ AR+TCS Q+++K+LA  F+DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEPAAARLTCSSQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGV  62

Query  282  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQ  461
            PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKA 
Sbjct  63   PKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFAFKPGKYNAKKFCLEPTSFTVKAG  122

Query  462  SVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            SV+KNAPP+FQ TKLMTR TYTLDEIEGPFEVSSDG
Sbjct  123  SVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDG  158



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MA+SLQ AAT MQPTKV +     +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1    MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            A KLAGFALATSALLVSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGVE+F
Sbjct  61   ATKLAGFALATSALLVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVESF  120

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            AFKPGKY+AKK CLEPTSFTVKA+ V+KNAP EFQNTKLMTR TYTLDEIEGPFEV+ DG
Sbjct  121  AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVTPDG  180



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 152/184 (83%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFIQSAKIATAPSRGGASLRSSQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+ SGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCSDAVKIAGFALATSALVASGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FK GKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKAGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            S+DG
Sbjct  181  SADG  184



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +FKPGKY+AKKFCLEPTSFTVKA+ V+KN P  FQNTKLMTR TYTLDEIEGPFEVSSDG
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSSDG  180



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 156/183 (85%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AATLMQPTKVGV+       RS Q V ++ G +P+ +R+TCSLQS +K+LA  
Sbjct  1    MATSLQAAATLMQPTKVGVSARSSLQLRSAQNVSRSFGFEPAGSRLTCSLQSDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             +DAAK+AGFALATSAL+ SGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPT++GG 
Sbjct  61   CTDAAKIAGFALATSALVASGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTLDGGS  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFK GKY+AKKFCLEPTSFTVKA+ VSKN+P EFQ TKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKSGKYTAKKFCLEPTSFTVKAEGVSKNSPAEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
             DG
Sbjct  181  QDG  183



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 151/184 (82%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+ AT +Q  K+   PS G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKYS KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYSGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   274 bits (700),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 154/183 (84%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKV-GVTPSIG--RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASL +AAT +QPTK+   T   G  RS  +V K  G++ S AR+TCS+QS +++ A  
Sbjct  1    MAASLHSAATFLQPTKISAATSRYGHLRSSPSVAKTFGLESSSARLTCSIQSDLRDFAGK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             +DAAK+AGFALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CTDAAKIAGFALATSALVSSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            + FAFKPGKYS KKFC EPTSFTVKA+ VSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  DEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  194
            MAASLQ AATLMQP K+G   S      R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
            +  +DAAKLAGFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61   NKCADAAKLAGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++FAFK GKY+ KKFCLEPTSFTVKA+ V+KNAPPEFQ TKLMTR TYTLDEIEGP E
Sbjct  121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  180

Query  555  VSSDG  569
            VSSDG
Sbjct  181  VSSDG  185



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 151/184 (82%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+ AT +Q  K+   PS G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   273 bits (699),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 151/184 (82%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+ AT +Q  K+   PS G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   273 bits (699),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 151/184 (82%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+ AT +Q  K+   PS G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 160/182 (88%), Gaps = 2/182 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPAR-ITCSLQSQIKELAHNF  203
            MAASLQ AAT MQPTK+  + ++  +S Q++ KA G++P  A+ +TCSLQ+ +K+LAH  
Sbjct  1    MAASLQAAATFMQPTKLSRSNTLQQKSTQSISKAFGLEPVGAKKVTCSLQADLKDLAHKC  60

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  383
             DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG++
Sbjct  61   VDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLD  120

Query  384  NFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
            +FAFKPGKY+AKK CLEPTSFTVKA+ V+KNAP EFQNTKLMTR TYTLDEIEGPFEVSS
Sbjct  121  SFAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSS  180

Query  564  DG  569
            DG
Sbjct  181  DG  182



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   274 bits (701),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 153/185 (83%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGR-----SYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MA SL  AAT +QP K+  + S  R     S QTVGK+ G++ S AR+TCSLQS +K+ A
Sbjct  44   MATSLHAAATFLQPAKIAASSSPSRNVYLRSNQTVGKSFGLESSSARLTCSLQSDLKDFA  103

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  104  GKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  163

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPFE
Sbjct  164  GSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  223

Query  555  VSSDG  569
            V SDG
Sbjct  224  VGSDG  228



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 153/182 (84%), Gaps = 3/182 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASL  AATL QPTK G+    G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFK G Y+ KKFCLEPTSFTVKA+ VSKNAP EFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SD  566
            SD
Sbjct  181  SD  182



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 150/184 (82%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+ AT +Q  K+   PS G    RS Q VGK+ G++ S AR+TCS QS  K    
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKNFTG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 153/182 (84%), Gaps = 3/182 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASL  AATL QPTK G+    G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFK G Y+ KKFCLEPTSFTVKA+ VSKNAP EFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  561  SD  566
            SD
Sbjct  181  SD  182



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 151/184 (82%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+ AT +Q  K+   PS G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALA+SAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALASSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  194
            MAASLQ AATLMQP K+G   S      R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
            +  +DAAKL GFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61   NKCADAAKLTGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++FAFK GKY+ KKFCLEPTSFTVKA+ V+KNAPPEFQ TKLMTR TYTLDEIEGP E
Sbjct  121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  180

Query  555  VSSDG  569
            VSSDG
Sbjct  181  VSSDG  185



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MA+SLQ AAT MQPTKV +     +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1    MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            A KLAGFALATSALLVSGA+AEGVPKRLTFDEI+SKTY+EVKG+GTANQCPTI+GG+E+F
Sbjct  61   ATKLAGFALATSALLVSGASAEGVPKRLTFDEIRSKTYLEVKGTGTANQCPTIDGGLESF  120

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            AFKPGKY+AKK CLEPTSFTVKA+ V+KNAP EFQNTKLMTR TYTLDEIEGPFEV+ DG
Sbjct  121  AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVTPDG  180



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AAT MQPTKVG+     +S Q + KA G++P+ A++ CSL+  +K+ A    D
Sbjct  1    MAASLQAAATFMQPTKVGMATRNLKSTQCISKAFGLEPAAAKLICSLKPDLKDFAQKCVD  60

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            AFK GKY A+K CLEPTSFTVKA+ V+KNAP EFQNTKLMTR TYTLDEIEGPFEVSSDG
Sbjct  121  AFKAGKYKAQKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDG  180



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (83%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPS--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AATLMQP KV  T     G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPAKVAATGRNLAGQQLRTGSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               +DA KLAGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   QKCADATKLAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV+ FAFKPGKY  KK CLEPTSFTVKA+ VSKN+PPEFQ TKLMTR TYTLDEIEGPFE
Sbjct  121  GVDEFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VS  G
Sbjct  181  VSPSG  185



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 159/187 (85%), Gaps = 10/187 (5%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-------RSYQTVGKALGVDPSPARITCSLQSQIKE  188
            MAASLQTAATL   TKVG+ P+ G       RS Q V KA GV+P+ AR+TCSLQS  K+
Sbjct  1    MAASLQTAATLT--TKVGM-PARGGGGSLQLRSAQAVSKAFGVEPAGARLTCSLQSDFKD  57

Query  189  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  368
            LA    DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI
Sbjct  58   LAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTI  117

Query  369  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGP  548
            +GGV++FAFK GKY+ KK CLEPTSFTVKA+SV+KNAPPEFQNTKLMTR TYTLDEIEGP
Sbjct  118  DGGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGP  177

Query  549  FEVSSDG  569
            FEV++DG
Sbjct  178  FEVANDG  184



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 156/181 (86%), Gaps = 5/181 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFS  206
            MA+SLQ AAT MQPTK        +S Q + KA G++P+   ++TCSLQ+ +K+LAH   
Sbjct  1    MASSLQAAATFMQPTKFLQL----KSTQAISKAFGLEPAGVNKVTCSLQADLKDLAHKCV  56

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+E+
Sbjct  57   DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLES  116

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FAFK GKY+AKKFCLEPTSFTVKA+ V+KNAPPEFQNTKLMTR TYTLDEIEGPFEVSSD
Sbjct  117  FAFKQGKYNAKKFCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  176

Query  567  G  569
            G
Sbjct  177  G  177



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 5/184 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+AAT +Q  K+   PS G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AE  PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAE-APKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  119

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+ KPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  120  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  179

Query  558  SSDG  569
            +SDG
Sbjct  180  ASDG  183



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 154/185 (83%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQ-TAATLMQPTKVGVT-PSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MA SL+ T AT +QP K+  + PS     RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            G E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPP+FQNTKLMTR TYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VSSDG
Sbjct  181  VSSDG  185



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   268 bits (684),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KELAH   +
Sbjct  1    MAASLQAAATLMQPTKLRSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVE  60

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +FKPGKY+AKK CLEPTSFTVK++ V+KN P  FQNTKLMTR TYTLDEIEGPFEVS+DG
Sbjct  121  SFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADG  180



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   268 bits (684),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            MAASLQ + T +QPTKV    ++  RS   V KA GV+P+  R+  SLQS +KELA+   
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTPNVCKAFGVEPASGRLCLSLQSDLKELANKCV  60

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            DA KLAG ALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV+ 
Sbjct  61   DATKLAGLALATSALIASGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVDT  120

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FAFK GKY+AKKFCLEPT F VKA+ VSKNAPP+FQNTKLMTR TYTLDE+EGPFEVSSD
Sbjct  121  FAFKAGKYNAKKFCLEPTKFAVKAEGVSKNAPPDFQNTKLMTRLTYTLDEMEGPFEVSSD  180

Query  567  G  569
            G
Sbjct  181  G  181



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   268 bits (684),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 149/184 (81%), Gaps = 4/184 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ+ AT +Q  K+   PS G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTAN  PTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANHSPTIDGG  120

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  558  SSDG  569
            +SDG
Sbjct  181  ASDG  184



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 154/185 (83%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQ-TAATLMQPTKVGVT-PSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MA SL+ T AT +QP K+  + PS     RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            G E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPP+FQNTKLMTR TYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VSSDG
Sbjct  181  VSSDG  185



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 148/183 (81%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQP K+G   S     R    V +A GVD    RI+CSLQS ++E+A  
Sbjct  1    MAASLQAAATLMQPAKIGGRASASLPSRQASHVARAFGVDAGAGRISCSLQSDVREVASK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CIDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++F FK GKY  KKFCLEPTSFTVKA+ ++KNAPPEFQ TKLMTR TYTLDEIEGP EV 
Sbjct  121  DSFPFKAGKYQMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVG  180

Query  561  SDG  569
            SDG
Sbjct  181  SDG  183



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 154/185 (83%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQ-TAATLMQPTKVGVT-PSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MA SL+ T AT +QP K+  + PS     RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSSGLESSPARLTCSIHSDFKDFV  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            G E F+FKPGKY+ KKFC EPTSFTVKA SVSKNAPP+FQNTKLMTR TYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VSSDG
Sbjct  181  VSSDG  185



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 152/185 (82%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPS--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AATLMQP+ VG T     G+  +T   + K  G +P+ AR+TCSLQ+ +++L 
Sbjct  1    MAASLQAAATLMQPSTVGATRRSLAGQQLRTSSHLSKTFGFEPAGARLTCSLQTDLRDLV  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               +DA KLAGFALATSALLV+GANAEGVP RLT+DEIQSKTYMEVKG GTANQCPTIEG
Sbjct  61   QKCADATKLAGFALATSALLVAGANAEGVPSRLTYDEIQSKTYMEVKGIGTANQCPTIEG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++FAFKPGKY  KKFCLEPTSFTVKA+SV+KNAPPEFQ TKLMT  TYTLDEIEGP E
Sbjct  121  GVDSFAFKPGKYQMKKFCLEPTSFTVKAESVNKNAPPEFQKTKLMTCLTYTLDEIEGPLE  180

Query  555  VSSDG  569
            VS DG
Sbjct  181  VSPDG  185



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 159/183 (87%), Gaps = 3/183 (2%)
 Frame = +3

Query  30   MAASLQ-TAATLMQPTKVG--VTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAAS+  TAATLMQP+K+    T S  RS Q++ KA G++ + AR+TCSL S +K+++  
Sbjct  1    MAASVHATAATLMQPSKLASRTTTSQLRSSQSLSKAFGLESAGARLTCSLHSDLKDVSRK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
            F+DAAK+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   FADAAKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFK GKY AKKFCLEPTSFTVKA+ VSKN+PPEFQNTKLMTR TYTLDEIEGPFEV 
Sbjct  121  DSFAFKAGKYQAKKFCLEPTSFTVKAEGVSKNSPPEFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  561  SDG  569
            +DG
Sbjct  181  ADG  183



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160493.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = +3

Query  57   TLMQPTKVG--VTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  230
            TLMQP+K+    T S  RS Q++ KA G++ S  R+TCSL S +K+++  F+DAAK+AGF
Sbjct  11   TLMQPSKLASRTTTSHLRSSQSLSKAFGLESSGPRLTCSLHSDLKDVSRKFADAAKIAGF  70

Query  231  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  410
            ALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFK GKY
Sbjct  71   ALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKAGKY  130

Query  411  SAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             AKKFCLEPTSFTVKA+ VSKNAPPEFQNTKLMTR TYTLDEIEGPFEV +DG
Sbjct  131  QAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVGADG  183



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 152/188 (81%), Gaps = 8/188 (4%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG--------RSYQTVGKALGVDPSPARITCSLQSQIK  185
            MA SLQ AAT +QP K+  + S          RS QTV K+ G++ S AR TCSLQS +K
Sbjct  1    MATSLQAAATFLQPAKIAASSSSSSPSRNVHLRSNQTVAKSFGLESSSARRTCSLQSDLK  60

Query  186  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  365
            + A   S+AAK+AGF LATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPT
Sbjct  61   DFAGKCSEAAKIAGFTLATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPT  120

Query  366  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEG  545
            I+GG E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEG
Sbjct  121  IDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEG  180

Query  546  PFEVSSDG  569
            PFEV SDG
Sbjct  181  PFEVGSDG  188



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AATLMQP K+G  P+       R    V +A GVD +  R++CSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRPASSAALPSRPSSHVARAFGVD-AGCRVSCSLQSDIREVA  59

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT++G
Sbjct  60   SKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTVDG  119

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV+ F FK GKY+ KKFCLEPTSFTVKA+ ++KNAPPEFQ TKLMTR TYTLDEIEGP E
Sbjct  120  GVDTFPFKSGKYNVKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  179

Query  555  VSSDG  569
            VS+DG
Sbjct  180  VSADG  184



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   264 bits (674),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 150/173 (87%), Gaps = 4/173 (2%)
 Frame = +3

Query  63   MQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  230
            MQPTKVG   +      RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  231  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  410
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  411  SAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDG  173



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   265 bits (677),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            MA S+Q  ATLMQP ++  T S+  RS    GK+LG++    R TCSL + +K+LA   +
Sbjct  1    MATSMQAVATLMQPARLRSTASVPIRSVPAAGKSLGIESGAGRFTCSLNTDLKQLAVKLA  60

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            DAAK+AGFALATSAL+ SGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61   DAAKIAGFALATSALVASGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FAFK GKY+AKK CLEPTSFTVKA+ V+KNAPP+FQ TKLMTR TYTLDEIEGPFEVSSD
Sbjct  121  FAFKAGKYNAKKLCLEPTSFTVKAEGVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSD  180

Query  567  G  569
            G
Sbjct  181  G  181



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 152/186 (82%), Gaps = 6/186 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  191
            MA SLQ AAT +QP K+  + S        RS QT+GK+ G++ S AR+TCSL S +K+ 
Sbjct  1    MATSLQAAATFLQPAKIAASSSPPSRSVHLRSNQTIGKSFGLESSSARLTCSLHSDLKDF  60

Query  192  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  371
            A   S+ AK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AGKCSEVAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  372  GGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPF  551
            GG E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPF
Sbjct  121  GGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPF  180

Query  552  EVSSDG  569
            EV  DG
Sbjct  181  EVGPDG  186



>gb|ABG25040.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
Length=179

 Score =   259 bits (663),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  102  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  281
            RS Q+V KA GV+    R+TCSLQ++IKELA   +DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGV  62

Query  282  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQ  461
            PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKA+
Sbjct  63   PKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAE  122

Query  462  SVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             VSKN+ P+FQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  123  GVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDG  158



>gb|AFW90569.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=293

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 150/173 (87%), Gaps = 4/173 (2%)
 Frame = +3

Query  63   MQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  230
            MQPTKVG   +      RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  231  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  410
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  411  SAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDG  173



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AATLMQPTK+       +S Q++ KA G++ S +++TCSLQ+  K+LAH   +
Sbjct  1    MAASLQAAATLMQPTKLRSNSFQLKSTQSISKAFGLEHSGSKVTCSLQTDFKDLAHKCVE  60

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            A K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLDSF  120

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            AFK GKY+AKKFCLEPTSFTVKA+ V+KN P  FQNTKLMTR TYTLDEIEGPFEVS DG
Sbjct  121  AFKAGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSPDG  180



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 150/184 (82%), Gaps = 11/184 (6%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MAASLQ AATL     +GV PS      RS Q+V KA GV+P+  R+TCSLQ   K+LA 
Sbjct  1    MAASLQAAATL-----IGVIPSRNNLQFRSSQSVSKAFGVEPATVRLTCSLQVDFKDLAQ  55

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              SDAAK+AGFA ATSAL+  GANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56   KCSDAAKVAGFAFATSALV--GANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  113

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             E FAFKPGKY+AKKFCLEPTSFTVKA+ V+KN+PP FQ TKLMTR TYTLDEIEGP EV
Sbjct  114  FETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPAFQKTKLMTRLTYTLDEIEGPLEV  173

Query  558  SSDG  569
            SSDG
Sbjct  174  SSDG  177



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 151/185 (82%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGR-----SYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MA SL  AAT +QP K+  + S  R     S QTVGK+ G++ S  R+TCSL S +KE A
Sbjct  1    MATSLHAAATFLQPAKIAASSSPSRNVHFRSNQTVGKSFGLESSSPRLTCSLHSDLKEFA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               S++AK+A FALATSAL+VSGA+AEG P+RLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSESAKIACFALATSALVVSGASAEGAPRRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTR TYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            V SDG
Sbjct  181  VGSDG  185



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 154/192 (80%), Gaps = 7/192 (4%)
 Frame = +3

Query  15   PV*STMAASLQT--AATLMQPTKVG-VTPSIG----RSYQTVGKALGVDPSPARITCSLQ  173
            P  +TMAASLQ   AATLMQP K+G   PS      R    + +A GVD   ARITCSLQ
Sbjct  34   PATTTMAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQ  93

Query  174  SQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTAN  353
            S ++++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTAN
Sbjct  94   SDVRDVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTAN  153

Query  354  QCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLD  533
            QCPTI+GGV++F FKPGKY  KK CLEPTSFTVKA+ ++KNAPPEFQ TKLMTR TYTLD
Sbjct  154  QCPTIDGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLD  213

Query  534  EIEGPFEVSSDG  569
            EIEGP EV+SDG
Sbjct  214  EIEGPLEVASDG  225



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 154/185 (83%), Gaps = 5/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVT-PSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MAASLQ AA LMQP K+G T  S+     R++  + KA G +P+ A +TCSLQ+ +++LA
Sbjct  1    MAASLQAAAMLMQPAKIGATGRSLAGQQLRTFSHLSKAFGFEPAGAGLTCSLQTDLRDLA  60

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
               +DA KLAGFA ATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   LKCADATKLAGFAHATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++FAFKPGKY  K+FCLEPTSFTVKA+ ++KN+P EFQ TKLMTR TYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQMKRFCLEPTSFTVKAEGINKNSPAEFQKTKLMTRLTYTLDEIEGPFE  180

Query  555  VSSDG  569
            VS DG
Sbjct  181  VSPDG  185



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   263 bits (671),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 157/184 (85%), Gaps = 8/184 (4%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV----TPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAH  197
            MA SLQ AATLMQPTK+G+    T    +S Q++ KA G++ + A++TCSLQ    ++AH
Sbjct  1    MAVSLQAAATLMQPTKIGINNRSTTLHLKSTQSISKAFGLEHNGAKLTCSLQ----DIAH  56

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
             F+D+AK+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTIEGG
Sbjct  57   RFADSAKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGG  116

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             ++F+FK GKY+AKKFCLEPTSFTVK++ ++KN+P +FQNTKLMTR TYTLDEIEGPFEV
Sbjct  117  SDSFSFKSGKYNAKKFCLEPTSFTVKSEGITKNSPLDFQNTKLMTRLTYTLDEIEGPFEV  176

Query  558  SSDG  569
            S DG
Sbjct  177  SPDG  180



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 151/187 (81%), Gaps = 7/187 (4%)
 Frame = +3

Query  30   MAASLQT--AATLMQPTKVG-VTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKE  188
            MAASLQ   AATLMQP K+G   PS      R    + +A GVD   ARITCSLQS +++
Sbjct  1    MAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVRD  60

Query  189  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  368
            +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPTI
Sbjct  61   VASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPTI  120

Query  369  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGP  548
            +GGV++F FKPGKY  KK CLEPTSFTVKA+ ++KNAPPEFQ TKLMTR TYTLDEIEGP
Sbjct  121  DGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGP  180

Query  549  FEVSSDG  569
             EV+SDG
Sbjct  181  LEVASDG  187



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AATLM P K+G   S  R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             FK GKY  KKFCLEPTSFTVKA+ + KN PP FQ TKLMTR TYTLDE+EGP EV +DG
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AATLM P K+G   S  R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATLM-PAKIGGRASSVRPSSHVARAFGVDAA-ARITCSLQSDIREVASKCAD  58

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             FK GKY  KKFCLEPTSFTVKA+ + KN PP FQ TKLMTR TYTLDE+EGP EV +DG
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   258 bits (658),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 144/180 (80%), Gaps = 11/180 (6%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AAT +  +K+   PS G   ++           +RITCS+QS +K+ A   SD
Sbjct  1    MAASLQAAATFLHQSKISAAPSRGGHLRS-----------SRITCSIQSDLKDFAGKCSD  49

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
             AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG E F
Sbjct  50   TAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGSETF  109

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             FK G+YS KKFC EPTSFTVKA+ +SKNAPPEFQNTKLMTR TYTLDEIEGPF+VSSDG
Sbjct  110  EFKAGQYSGKKFCFEPTSFTVKAEGISKNAPPEFQNTKLMTRLTYTLDEIEGPFDVSSDG  169



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   258 bits (659),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 153/186 (82%), Gaps = 7/186 (4%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV-----TPSIGRSYQTVGKALGVDPS-PARITCSLQSQIKEL  191
            MAASLQ AAT+MQPTKVGV        + RS Q+V K  GV+ +  AR+TCS+ +  K+L
Sbjct  1    MAASLQAAATMMQPTKVGVQGRSTNVQLLRSSQSVCKVFGVEQTGSARLTCSV-TDAKDL  59

Query  192  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  371
            A   + AAK+AGFALATSAL+VSGA+AEG PKRLTFDEI+SKTY+EVKG+GTANQCPTIE
Sbjct  60   AQKCAVAAKVAGFALATSALVVSGASAEGPPKRLTFDEIRSKTYLEVKGTGTANQCPTIE  119

Query  372  GGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPF  551
            GGV+ FAFKPGKY  KKFCLEPTSFTVKA SVSKNA PEFQ TKLMTR TYTLDEIEGPF
Sbjct  120  GGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNASPEFQRTKLMTRLTYTLDEIEGPF  179

Query  552  EVSSDG  569
            EVS DG
Sbjct  180  EVSPDG  185



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AATLM P K+G   S  R    V +A GVD + ARITCSLQS I+E+A   ++
Sbjct  1    MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAE  58

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             FK GKY  KKFCLEPTSFTVKA+ + KN PP FQ TKLMTR TYTLDE+EGP EV +DG
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178



>gb|ADB07372.1| chloroplast managanese stabilizing protein [Capsicum annuum]
Length=281

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 145/173 (84%), Gaps = 4/173 (2%)
 Frame = +3

Query  63   MQPTKVGVTPSIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  230
            MQPTK+G   +      RS Q+V K  GV+   AR+TCSLQ  +K+ A   +DAAK+AGF
Sbjct  1    MQPTKIGGVSARNNLQLRSSQSVNKTFGVEQGAARLTCSLQCDLKDFAQKCTDAAKIAGF  60

Query  231  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  410
            ALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPT++GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTVDGGVDSFAFKPGKY  120

Query  411  SAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +AKK CLEPTSFTVKA+ V+KN+ PEFQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  121  NAKKLCLEPTSFTVKAEGVNKNSAPEFQKTKLMTRLTYTLDEIEGPFEVSPDG  173



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 145/181 (80%), Gaps = 1/181 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTP-SIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            MAA LQ A T +QP +V   P +  +    V K  GV+P  +R++CSL   +K L   F 
Sbjct  1    MAAFLQAAVTTVQPARVDPPPRAAAKLRMCVSKYFGVEPVASRVSCSLHDDLKNLTLKFV  60

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            D  K+AGF+LA SAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  61   DTTKIAGFSLAASALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLES  120

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FA KPGKY AKKFCLEPTSFTVKA+ VSKN+ P+FQNTKLMTR TYTLDEIEGPFEV+SD
Sbjct  121  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASD  180

Query  567  G  569
            G
Sbjct  181  G  181



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   255 bits (651),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 148/181 (82%), Gaps = 1/181 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            MA SLQ + T +QPTKV    S+  RS   V KA GVDP+  R++ SLQS +K+LA    
Sbjct  1    MATSLQASTTFLQPTKVASRNSLQLRSSPNVCKAFGVDPTAGRVSLSLQSDLKDLASKCV  60

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            DA KLAG ALATSAL+ SGA+A+G  KRLT+DEIQSKTY+EVKG+GTANQCPTIEGG+E+
Sbjct  61   DATKLAGLALATSALIASGASADGGTKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGLES  120

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            F FK GKY+AKKFCLEPT FTVKA+ +SKNAPP+FQ+TKLMTR TYTLDE+EGPFEVSSD
Sbjct  121  FGFKAGKYTAKKFCLEPTKFTVKAEGISKNAPPDFQDTKLMTRLTYTLDEMEGPFEVSSD  180

Query  567  G  569
            G
Sbjct  181  G  181



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   255 bits (651),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 145/189 (77%), Gaps = 14/189 (7%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRS---------YQTVGKALGVDPSPARITCSLQSQI  182
            MAASLQ AATLMQP K+G     GR+            + +A GVD   ARITCSLQS  
Sbjct  1    MAASLQAAATLMQPAKIG-----GRAPSASLPSRSSSHLARAFGVDAGAARITCSLQSDF  55

Query  183  KELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCP  362
            + +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCP
Sbjct  56   RGVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCP  115

Query  363  TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIE  542
            T +GGVE F FK GKY  KK CLEPTSFTVKA+ ++KNAPPEFQ TKLMTR TYTLDEIE
Sbjct  116  TTDGGVEAFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIE  175

Query  543  GPFEVSSDG  569
            GP EV SDG
Sbjct  176  GPLEVGSDG  184



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 11/187 (6%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRS-------YQTVGKALGVDPSPARITCSLQSQIKE  188
            MA SLQ AATLMQPTKV    S   S        Q++ KA G++ + A++TC+LQ    +
Sbjct  1    MATSLQAAATLMQPTKVAAITSTRSSSTLQLKPTQSISKAFGLESTGAKLTCNLQ----D  56

Query  189  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  368
             A+  ++ AK+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI
Sbjct  57   FANKCAETAKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTI  116

Query  369  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGP  548
            EGGV++FAFK GKYSAKK CLEPTSFTVKA+ V+KN+P +FQNTKLMTR TYTLDEIEGP
Sbjct  117  EGGVDSFAFKAGKYSAKKICLEPTSFTVKAEGVTKNSPLDFQNTKLMTRLTYTLDEIEGP  176

Query  549  FEVSSDG  569
            FEVS DG
Sbjct  177  FEVSPDG  183



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 146/190 (77%), Gaps = 19/190 (10%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGR----------SYQTVGKALGVDPSPARITCSLQSQ  179
            MAASLQ AATLMQP K+G     GR          S Q   +A GVD   ARITCSLQ  
Sbjct  1    MAASLQAAATLMQPAKIG-----GRAPFASLPSRPSSQLACRAFGVDAGAARITCSLQ--  53

Query  180  IKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQC  359
              ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQC
Sbjct  54   --DVASRCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQC  111

Query  360  PTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEI  539
            PTI+GGVE+F FK GKY  KK CLEPTSFTVKA+ ++KNAPPEFQ TKLMTR TYTLDEI
Sbjct  112  PTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEI  171

Query  540  EGPFEVSSDG  569
            EGP EV SDG
Sbjct  172  EGPLEVGSDG  181



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 143/176 (81%), Gaps = 2/176 (1%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  209
            MAASLQ AAT+M P K+G   S  R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATVM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  210  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  389
            AAK+AGFALATSALLVSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  390  AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             FK GKY  KKFCLEPTSFTVKA+ + KN PP FQ TKLMTR TYTLDE+EGP EV
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEV  174



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 153/186 (82%), Gaps = 7/186 (4%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPS-----IGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  191
            MAA LQ A T MQ T+V VTP+     +  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1    MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  192  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  371
              +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60   IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  372  GGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPF  551
            GGV++FA KPGKY AKKFCLEPTSFTVKA+ VSKN+ P+FQNTKLMTR TYTLDEIEGPF
Sbjct  120  GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPF  179

Query  552  EVSSDG  569
            EV+SDG
Sbjct  180  EVASDG  185



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNF  203
            MA+SLQ AATL+ P KVG       RS   + KA G D S A R+TCS+ S ++++A   
Sbjct  1    MASSLQAAATLI-PAKVGAPARTHLRSNSHLSKAFGFDNSTAGRLTCSINSDLRDIAQKC  59

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  383
            +DAAKLAGFALATSAL++SGA+AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG E
Sbjct  60   TDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTE  119

Query  384  NFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
            +F +K GKY+ KK CLEPTSFTVKA+ ++KNAPPEFQ TKLMTR TYTLDEIEGPFEV+ 
Sbjct  120  SFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAP  179

Query  564  DG  569
            DG
Sbjct  180  DG  181



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPS-----IGRSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MAA LQ A T +Q T++ VTP+     +  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1    MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
             +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60   QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++F+ KPGKY A+KFCLEPTSFTVKA+ VSKN+ P+FQNTKLMTR TYTLDEIEGPFE
Sbjct  120  GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  179

Query  555  VSSDG  569
            V+SDG
Sbjct  180  VASDG  184



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 153/186 (82%), Gaps = 7/186 (4%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPS-----IGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  191
            MAA LQ A T MQ T+V VTP+     +  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1    MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  192  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  371
              +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60   IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  372  GGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPF  551
            GGV++FA KPGKY AKKFCLEPTSFTVKA+ VSKN+ P+FQNTKLMTR TYTLDEIEGPF
Sbjct  120  GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPF  179

Query  552  EVSSDG  569
            EV+SDG
Sbjct  180  EVASDG  185



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPS-----IGRSYQTVGKALGVDPSPARITCSLQSQIKELA  194
            MAA LQ A T +Q T++ VTP+     +  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1    MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  195  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  374
             +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60   QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            GV++F+ KPGKY A+KFCLEPTSFTVKA+ VSKN+ P+FQNTKLMTR TYTLDEIEGPFE
Sbjct  120  GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  179

Query  555  VSSDG  569
            V+SDG
Sbjct  180  VASDG  184



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 151/181 (83%), Gaps = 6/181 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPT-KVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            MAASLQ AAT M PT +V +     +S  ++ KA G++ + ++++CSLQ+ +K+ A   +
Sbjct  1    MAASLQAAATFMTPTSRVQL-----KSSPSICKAFGIESTGSKVSCSLQADLKDFAQKCT  55

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            DAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV  
Sbjct  56   DAAKIAGFALATSALVVSGASAEGSPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVNG  115

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FA KPGKY+A+KFCLEPTSFTVKA+ +SKN+ PEFQ TKLMTR TYTLDEIEGP EVSSD
Sbjct  116  FAVKPGKYNAQKFCLEPTSFTVKAEGISKNSAPEFQKTKLMTRLTYTLDEIEGPLEVSSD  175

Query  567  G  569
            G
Sbjct  176  G  176



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  200
            MAASLQ + T +QPTKV    ++  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61   CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY+AKKFCLEPT F VKA+ +SKN+ P+FQNTKLMTR TYTLDEIEGPFEVS
Sbjct  120  DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVS  179

Query  561  SDG  569
            SDG
Sbjct  180  SDG  182



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  200
            MAASLQ + T +QPTKV    ++  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61   CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY+AKKFCLEPT F VKA+ +SKN+ P+FQNTKLMTR TYTLDEIEGPFEVS
Sbjct  120  DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVS  179

Query  561  SDG  569
            SDG
Sbjct  180  SDG  182



>ref|XP_009387680.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like, 
partial [Musa acuminata subsp. malaccensis]
Length=170

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 140/170 (82%), Gaps = 6/170 (4%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG-----RSYQTVGKALGVDPSP-ARITCSLQSQIKEL  191
            MAASLQ AATLMQP KVG T         RS   + KA G++P+  AR+TCSLQS ++E+
Sbjct  1    MAASLQAAATLMQPAKVGATSRTAAGVQLRSSSHLTKAFGLEPAASARLTCSLQSDVREM  60

Query  192  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  371
            A   +D  KLAGFALA SAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AQKCADGVKLAGFALAASALVVTGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  372  GGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRST  521
            GGVE+FAFKPGKY+ KK CLEPTSFTVKA++VSKNAPPEFQ TKLMTR T
Sbjct  121  GGVESFAFKPGKYNTKKLCLEPTSFTVKAEAVSKNAPPEFQKTKLMTRLT  170



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   248 bits (632),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 147/188 (78%), Gaps = 16/188 (9%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPAR--------ITCSLQSQIK  185
            MAASLQ AATLMQP K      +GRS  +    L   PS AR        I+CSL S ++
Sbjct  1    MAASLQAAATLMQPAK------MGRSASSSSAVL--LPSSARPSSHAARTISCSLTSDLR  52

Query  186  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  365
            E+A   +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT
Sbjct  53   EVATKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPT  112

Query  366  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEG  545
            I+GGV+ F FK GKY  KKFCLEPTSFTVKA+ ++KNAPPEFQ TKLMTR TYTLDEIEG
Sbjct  113  IDGGVDAFPFKAGKYEMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEG  172

Query  546  PFEVSSDG  569
            P EV++DG
Sbjct  173  PLEVAADG  180



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 143/183 (78%), Gaps = 19/183 (10%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV---TPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AATLMQP KV     T  + RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFKPGKY AKKFCLEPTSFTV                KLMTR TYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTV----------------KLMTRLTYTLDEIEGPFEVS  164

Query  561  SDG  569
            +DG
Sbjct  165  TDG  167



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 144/181 (80%), Gaps = 3/181 (2%)
 Frame = +3

Query  30   MAASLQTAATLMQ-PTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  206
            M ASLQ A T +  P++     ++   +Q V K+ GV+   +R+ CSL   +K LA    
Sbjct  1    MVASLQAAVTTVALPSRAAA--NLRPPFQCVSKSFGVEQVTSRVYCSLHDDLKSLALKCV  58

Query  207  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  386
            +  K+AG ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+++
Sbjct  59   ETTKIAGLALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLDS  118

Query  387  FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            FA KPGKY AKKFCLEPTSFTVKA+ VSKN+ P+FQNTKLMTR TYTLDEIEGPFEV+SD
Sbjct  119  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASD  178

Query  567  G  569
            G
Sbjct  179  G  179



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 138/183 (75%), Gaps = 23/183 (13%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGVTPSIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MAASLQ AATLMQPTKVGV        RS Q+V KA G++P+ AR TCSLQ+ +K L   
Sbjct  1    MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKGLGSQ  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
                                GA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   --------------------GASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  100

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVS  560
            ++FAFK GKY  KKFCLEPTSFTVKA+ VSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS
Sbjct  101  DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  160

Query  561  SDG  569
            SDG
Sbjct  161  SDG  163



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  150  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  329
            AR+TCSLQS  K+LA    DA K+AG ALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+E
Sbjct  8    ARLTCSLQSDFKDLAQKCVDATKIAGIALATSALVVSGASAEGVPKRLTYDEIQSKTYLE  67

Query  330  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLM  509
            VKG+GTANQCPTIEGGV++FAFK GKY+ KK CLEPTSFTVKA+SV+KN+PPEFQNTKLM
Sbjct  68   VKGTGTANQCPTIEGGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNSPPEFQNTKLM  127

Query  510  TRSTYTLDEIEGPFEVSSDG  569
            TR TYTLDEIEGPFEV++DG
Sbjct  128  TRLTYTLDEIEGPFEVANDG  147



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 143/182 (79%), Gaps = 14/182 (8%)
 Frame = +3

Query  24   STMAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNF  203
            +T+A    TAA L  P++     S+ +S++ V +         R++CSL   +K L+ N 
Sbjct  5    TTVALQSLTAAKLHPPSQ-----SVSKSFKPVTR---------RVSCSLHDDLKNLSLNC  50

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  383
             +A K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIEGG+E
Sbjct  51   VEATKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIEGGLE  110

Query  384  NFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
            +FA KPGKY AKK CLEPTSFTVKA+ VSKNA P FQNTKLMTR TYTLDEIEGPF+V+S
Sbjct  111  SFAIKPGKYYAKKVCLEPTSFTVKAEGVSKNAKPVFQNTKLMTRLTYTLDEIEGPFDVAS  170

Query  564  DG  569
            DG
Sbjct  171  DG  172



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   230 bits (586),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +3

Query  102  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  281
            RS Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGV
Sbjct  14   RSSQSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGV  71

Query  282  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQ  461
            PKRLT+ EIQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKA+
Sbjct  72   PKRLTYKEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAE  131

Query  462  SVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             VS+NA P FQNTKLMTR TYTLDEIEGPFEV+SDG
Sbjct  132  DVSRNATPVFQNTKLMTRLTYTLDEIEGPFEVASDG  167



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 140/182 (77%), Gaps = 14/182 (8%)
 Frame = +3

Query  24   STMAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNF  203
            +T+A    TAA L  P++     S+ +S++ V +         R++CSL   +K L  N 
Sbjct  5    TTVALQSLTAAKLHPPSQ-----SVSKSFKPVTR---------RVSCSLHDDLKNLTLNC  50

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  383
             +A K+AGFALATSAL+VSGA+AEGVPKRLT+ +IQSKTYMEVKG+GTANQCPTIEGG+E
Sbjct  51   VEATKIAGFALATSALVVSGASAEGVPKRLTYKDIQSKTYMEVKGTGTANQCPTIEGGLE  110

Query  384  NFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
            +FA KPGKY AKK CLEPTSFTVKA+ VS+NA P F NTKLMTR TYTLDEIEGPFEV+S
Sbjct  111  SFAIKPGKYYAKKVCLEPTSFTVKAEGVSRNATPFFLNTKLMTRLTYTLDEIEGPFEVAS  170

Query  564  DG  569
            DG
Sbjct  171  DG  172



>gb|AEH95324.1| 33 kDa manganese stabilizing chloroplast protein [Allium cepa]
Length=238

 Score =   219 bits (557),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  383
            +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV+
Sbjct  2    TDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVD  61

Query  384  NFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
            +FAFKPGKY+AKKFCLEPTSFTVKA+ VSKN+ P+FQ TKLMTR TYT+DEIEGPFEVS 
Sbjct  62   SFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTMDEIEGPFEVSP  121

Query  564  D  566
            D
Sbjct  122  D  122



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 138/182 (76%), Gaps = 4/182 (2%)
 Frame = +3

Query  36   ASLQTAATLMQPTKVGVTPSIGRSYQTVGK---ALGVDP-SPARITCSLQSQIKELAHNF  203
            ++LQ AATL+QPTK+ VT S  R   +      A G +P + AR++CSLQ  +KE A   
Sbjct  9    SALQAAATLLQPTKLSVTRSSSRLSSSSSHVSRAFGFEPATSARVSCSLQDDVKEFAEKC  68

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  383
            + A K+A   LA SAL+ SGA AEG PKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGVE
Sbjct  69   AGATKIAAVTLAASALVASGAGAEGPPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGVE  128

Query  384  NFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
             F FK GKY  KK C+EPTSFTVKA+S +KN PP+FQ T+LMTR TYTLDEIEGP EVSS
Sbjct  129  GFPFKAGKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTRLMTRLTYTLDEIEGPLEVSS  188

Query  564  DG  569
            DG
Sbjct  189  DG  190



>gb|KJB43587.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=262

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 127/157 (81%), Gaps = 4/157 (3%)
 Frame = +3

Query  30   MAASLQTAATLMQPTKVGV---TPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  200
            MA SLQ AATLMQP KV     T  + RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  201  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  380
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  381  ENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEF  491
            ++FAFKPGKY AKKFCLEPTSFTVK Q V+   P  F
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVK-QLVASGKPDSF  156



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = +3

Query  33   AASLQTAATLMQPTKVGVTPSIGRSYQTVGK----ALGVDP-SPARITCSLQSQIKELAH  197
             ++LQ AATL+QPTK+ VT +      +       A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            VE F FKPGKY  KK C+EPTSFTVKA+  +KN PP+FQ T+LMTR TYTLDEIEGP EV
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEV  187

Query  558  SSDG  569
            S DG
Sbjct  188  SQDG  191



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = +3

Query  33   AASLQTAATLMQPTKVGVTPSIGRSYQTVGK----ALGVDP-SPARITCSLQSQIKELAH  197
             ++LQ AATL+QPTK+ VT +      +       A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            VE F FKPGKY  KK C+EPTSFTVKA+  +KN PP+FQ T+LMTR TYTLDEIEGP EV
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEV  187

Query  558  SSDG  569
            S DG
Sbjct  188  SHDG  191



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = +3

Query  33   AASLQTAATLMQPTKVGVTPSIGRSYQTVGK----ALGVDP-SPARITCSLQSQIKELAH  197
             ++LQ AATL+QPTK+ VT +      +       A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            VE F FKPGKY  KK C+EPTSFTVKA+  +KN PP+FQ T+LMTR TYTLDEIEGP EV
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEV  187

Query  558  SSDG  569
            S DG
Sbjct  188  SHDG  191



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = +3

Query  33   AASLQTAATLMQPTKVGVTPSIGRSYQTVGK----ALGVDP-SPARITCSLQSQIKELAH  197
             ++LQ AATL+QPTK+ VT +      +       A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  198  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  377
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  378  VENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
            VE F FKPGKY  KK C+EPTSFTVKA+  +KN PP+FQ T+LMTR TYTLDEIEGP EV
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEV  187

Query  558  SSDG  569
            S DG
Sbjct  188  SQDG  191



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   197 bits (500),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  258  SGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEP  437
            SGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY AKKFCLEP
Sbjct  19   SGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEP  78

Query  438  TSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            TSFTVKA+SV+KNAPP+FQNTKLMTR TYTLDEIEGPFEVS DG
Sbjct  79   TSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDG  122



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  252  LVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCL  431
            L  GA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG+++FAFKPGKY+AKK CL
Sbjct  9    LSQGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLDSFAFKPGKYNAKKICL  68

Query  432  EPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            EPTSFTVKA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS DG
Sbjct  69   EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDG  114



>gb|AIS72812.1| oxygen evolving activity, partial [Rhizophora apiculata]
Length=147

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  264  ANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTS  443
            A AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FAFKPGKY+ KK CLEPTS
Sbjct  1    AGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFAFKPGKYNVKKLCLEPTS  60

Query  444  FTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            FTVKA+ V+KNAPPEFQNTKLMTR TYTLDEIEGPFEVS DG
Sbjct  61   FTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDG  102



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 105/114 (92%), Gaps = 2/114 (2%)
 Frame = +3

Query  234  LATSALLVS--GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  407
            + T +L+V   GA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFKPGK
Sbjct  2    VVTYSLIVKFKGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKPGK  61

Query  408  YSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            Y+AKK CLEPTSFTVKA+ V+KNAP EFQNTKLMTR TYTLDEIEGPFEVSSDG
Sbjct  62   YNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDG  115



>gb|ACE98011.1| putative protein, partial [Populus tremula]
 gb|ACE98012.1| putative protein, partial [Populus tremula]
 gb|ACE98013.1| putative protein, partial [Populus tremula]
 gb|ACE98014.1| putative protein, partial [Populus tremula]
 gb|ACE98015.1| putative protein, partial [Populus tremula]
 gb|ACE98016.1| putative protein, partial [Populus tremula]
 gb|ACE98017.1| putative protein, partial [Populus tremula]
 gb|ACE98018.1| putative protein, partial [Populus tremula]
 gb|ACE98019.1| putative protein, partial [Populus tremula]
 gb|ACE98020.1| putative protein, partial [Populus tremula]
 gb|ACE98021.1| putative protein, partial [Populus tremula]
 gb|ACE98022.1| putative protein, partial [Populus tremula]
 gb|ACE98023.1| putative protein, partial [Populus tremula]
 gb|ACE98024.1| putative protein, partial [Populus tremula]
 gb|ACE98025.1| putative protein, partial [Populus tremula]
 gb|ACE98026.1| putative protein, partial [Populus tremula]
 gb|ACE98027.1| putative protein, partial [Populus tremula]
 gb|ACE98028.1| putative protein, partial [Populus tremula]
 gb|ACE98029.1| putative protein, partial [Populus tremula]
 gb|ACE98030.1| putative protein, partial [Populus tremula]
 gb|ACE98031.1| putative protein, partial [Populus tremula]
 gb|ACE98032.1| putative protein, partial [Populus tremula]
 gb|ACE98033.1| putative protein, partial [Populus tremula]
 gb|ACE98034.1| putative protein, partial [Populus tremula]
 gb|ACE98035.1| putative protein, partial [Populus tremula]
 gb|ACE98036.1| putative protein, partial [Populus tremula]
 gb|ACE98037.1| putative protein, partial [Populus tremula]
 gb|ACE98038.1| putative protein, partial [Populus tremula]
 gb|ACE98039.1| putative protein, partial [Populus tremula]
 gb|ACE98040.1| putative protein, partial [Populus tremula]
 gb|ACE98041.1| putative protein, partial [Populus tremula]
 gb|ACE98042.1| putative protein, partial [Populus tremula]
 gb|ACE98043.1| putative protein, partial [Populus tremula]
 gb|ACE98044.1| putative protein, partial [Populus tremula]
 gb|ACE98045.1| putative protein, partial [Populus tremula]
 gb|ACE98046.1| putative protein, partial [Populus tremula]
Length=170

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  273  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  452
            EGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAFK GKY+AKKFCLEPTSFTV
Sbjct  1    EGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAFKAGKYNAKKFCLEPTSFTV  60

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            KA+SVSKNAPPEFQNTKLMTR TYTLDEIEGPFEVS DG
Sbjct  61   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDG  99



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +3

Query  273  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  452
            EGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EGGV++FAFKPGKY+ KKFCLEPTSFTV
Sbjct  1    EGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEGGVDSFAFKPGKYNMKKFCLEPTSFTV  60

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            KA+ V+KNAPPEFQ TKLMTR TYTLDEIEGP EVSSDG
Sbjct  61   KAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDG  99



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  285  KRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQS  464
            KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV++FAFKPGKY+AKKFCLEPT F VKA+ 
Sbjct  4    KRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEG  63

Query  465  VSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +SKN+ P+FQNTKLMTR TYTLDEIEGPFEVSSDG
Sbjct  64   ISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDG  98



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 107/150 (71%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  TVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRL  293
            ++  A G+ P+ AR++C+L+  +K +  N    AK A   LA+SAL+   A AEGVP+RL
Sbjct  32   SMSNAFGLKPAVARVSCNLEENVKSIVDN----AKAAAIVLASSALVAGAAFAEGVPQRL  87

Query  294  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSK  473
            TFDE+ ++TYM+VKGSGTANQCP +  G + FAFK G Y+ +KFCLEPTSFTVKA+S  K
Sbjct  88   TFDEVNAQTYMDVKGSGTANQCPIVAEGSDKFAFKDGNYTMRKFCLEPTSFTVKAESQFK  147

Query  474  NAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
                 FQ TKLMTR TYTLDEIEGP  V +
Sbjct  148  GGNEGFQPTKLMTRLTYTLDEIEGPLTVQN  177



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  318  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQN  497
            TY+EVKG+GTANQCPTIEGGV+ FAFKPGKY  KKFCLEPTSFTVKA SVSKNAPPEFQ 
Sbjct  1    TYLEVKGTGTANQCPTIEGGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNAPPEFQR  60

Query  498  TKLMTRSTYTLDEIEGPFEVSSDG  569
            TKLMTR TYTLDEIEGPFEVS DG
Sbjct  61   TKLMTRLTYTLDEIEGPFEVSPDG  84



>ref|XP_004243178.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Solanum lycopersicum]
Length=177

 Score =   155 bits (393),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  150  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  329
            +R++ SL++ +K+ +H   D + +AGF+LATS+L+VSGANAE VPKRLT DEIQ+KTYME
Sbjct  64   SRLSFSLEADLKDFSHKCIDTSMIAGFSLATSSLVVSGANAERVPKRLTLDEIQTKTYME  123

Query  330  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEF  491
            VKG+ TANQCPTI+GGV NFAFK GKY+AKKF LE T F VK + VSKN+  EF
Sbjct  124  VKGTVTANQCPTIDGGVNNFAFKLGKYNAKKFYLETTPFIVKEEGVSKNSALEF  177



>gb|ABV57472.1| chloroplast PsbO [Phyllostachys edulis]
Length=160

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  312  SKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEF  491
            SKTYMEVKG+GTANQCPTI+GGV++F FKPGKY  KKFCLEPTSFTVKA+ V+KNAPPEF
Sbjct  1    SKTYMEVKGTGTANQCPTIDGGVDSFPFKPGKYYMKKFCLEPTSFTVKAEGVAKNAPPEF  60

Query  492  QNTKLMTRSTYTLDEIEGPFEVSSDG  569
            Q TKLMTR TYTLDEIEGP EV +DG
Sbjct  61   QKTKLMTRLTYTLDEIEGPLEVGADG  86



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = +3

Query  117  VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLT  296
            V  A G+ P+ +R++CS++  ++ +     D AK A   LA+SAL+   A AEG P+RLT
Sbjct  33   VNSAFGLKPAASRVSCSVEETVRRVV----DGAKAAALVLASSALVAGAALAEGTPQRLT  88

Query  297  FDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKN  476
            FDEI ++TYM+VKGSGTANQCP +  G + F+FK GKY+ KK C+EPTSFTVKA+S  K 
Sbjct  89   FDEINAQTYMDVKGSGTANQCPIVPEGSDKFSFKDGKYTMKKLCMEPTSFTVKAESPFKG  148

Query  477  APPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
                FQNTKLMTR TYTLDEIEGP  VS+
Sbjct  149  GSEGFQNTKLMTRLTYTLDEIEGPLTVSN  177



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  324  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTK  503
            MEVKG+GTANQCPTI+GG + FAFKPGKYS KKFC EPTSFTVKA+ VSKNAPPEFQNTK
Sbjct  1    MEVKGTGTANQCPTIDGGSDEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTK  60

Query  504  LMTRSTYTLDEIEGPFEVSSDG  569
            LMTR TYTLDEIEGPFEVSSDG
Sbjct  61   LMTRLTYTLDEIEGPFEVSSDG  82



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 119/178 (67%), Gaps = 6/178 (3%)
 Frame = +3

Query  24   STMAASLQTAATLMQPTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNF  203
            S  +AS +T+  L   +K+    +I  +  ++  A G+ P+ AR++C+L+  ++ +    
Sbjct  4    SVASASCKTSVALASNSKLEKVQTIKSA--SLSSAFGLTPAAARVSCNLEENVRSVV---  58

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  383
             D AK A   LA+SAL+   A AEGVP+RLTFDEI ++TYM+VKGSGTANQCP +  G  
Sbjct  59   -DGAKAAALVLASSALMAGAALAEGVPQRLTFDEINAQTYMDVKGSGTANQCPIVAEGSG  117

Query  384  NFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEV  557
             F+FK G+Y+ +K CLEPTSFTVKA+S  K     +Q TKLMTR TYTLDEIEGP  V
Sbjct  118  QFSFKDGEYTMRKLCLEPTSFTVKAESPFKGGSEGYQQTKLMTRLTYTLDEIEGPLTV  175



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 103/147 (70%), Gaps = 2/147 (1%)
 Frame = +3

Query  129  LGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEI  308
             G+    +R++CSL  +        +DAAK A  ALATSALL   A A   P RLTFDEI
Sbjct  45   FGLSKCNSRLSCSLDEEASSFVSKVADAAKGAAVALATSALLAQAAVA--APPRLTFDEI  102

Query  309  QSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPE  488
             SKTY+EVKG+GTANQCP I GG++ F+FKPGKY  +K CLEPT F VKA+S  K    E
Sbjct  103  NSKTYLEVKGTGTANQCPAIGGGLDGFSFKPGKYQMQKLCLEPTEFRVKAESQFKGGDTE  162

Query  489  FQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            F  TKLMTR TYTLDEIEGPFEVSSDG
Sbjct  163  FTKTKLMTRLTYTLDEIEGPFEVSSDG  189



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  324  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTK  503
            MEVKG+GTANQCPTI+GGVE+F FK GKY  KK CLEPTSFTVKA+ ++KNAPPEFQ TK
Sbjct  1    MEVKGTGTANQCPTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTK  60

Query  504  LMTRSTYTLDEIEGPFEVSSDG  569
            LMTR TYTLDEIEGP EV SDG
Sbjct  61   LMTRLTYTLDEIEGPLEVGSDG  82



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 2/150 (1%)
 Frame = +3

Query  117  VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLT  296
            V +A G+  + A+++CS +  ++      +DA K A  ALA++AL+ S A A  VP RL 
Sbjct  30   VSQAFGLKTASAKVSCSAEENVRGFVQKCADAGKAAALALASTALVASSAQA-AVP-RLN  87

Query  297  FDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKN  476
            FDE+QS TY EVKGSG ANQCP I GGV+ FAFK GKY   K CLEPT+FTVKA+S  K 
Sbjct  88   FDELQSLTYSEVKGSGIANQCPIIAGGVDGFAFKSGKYQVSKMCLEPTAFTVKAESQFKG  147

Query  477  APPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
               EFQ TKLMTR TYTLDEIEGP EV+ +
Sbjct  148  QGEEFQKTKLMTRLTYTLDEIEGPLEVNGN  177



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 116/189 (61%), Gaps = 18/189 (10%)
 Frame = +3

Query  30   MAASLQTAA---TLMQPTKVGVTPSIGRSYQ----TVGKALGV--DPSPARITCSLQSQI  182
            MAAS+  A    +L+QP    +  S G S      +V KA G+  +   AR+TCS++  +
Sbjct  1    MAASVVAAKAGPSLLQPK---LDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIV  57

Query  183  KELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCP  362
            K      +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP
Sbjct  58   KRA----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCP  111

Query  363  TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIE  542
             + GG E F FKPG YS KKFCLEPTSFTVK +S  K    ++ +TKLMTR TYTLDEIE
Sbjct  112  ILSGGDEGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLDEIE  171

Query  543  GPFEVSSDG  569
                V   G
Sbjct  172  ADLSVDEKG  180



>gb|ACT83791.1| putative photosystem II oxygen evolving system 33 kDa subunit 
[Lemna minor]
Length=151

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  330  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLM  509
            VKG+GTANQCPTI+GGV+ F FK GKY+ KKFCLEPTSFTVKA+ VSKN+ PEFQ TKLM
Sbjct  1    VKGTGTANQCPTIDGGVDGFPFKAGKYNLKKFCLEPTSFTVKAEGVSKNSAPEFQKTKLM  60

Query  510  TRSTYTLDEIEGPFEVSSDG  569
            TR TYTLDEIEGP EVSSDG
Sbjct  61   TRLTYTLDEIEGPLEVSSDG  80



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 115/189 (61%), Gaps = 18/189 (10%)
 Frame = +3

Query  30   MAASLQTAA---TLMQPTKVGVTPSIGRSYQ----TVGKALGV--DPSPARITCSLQSQI  182
            MAAS+  A    +L+QP    +  S G S      +V KA G+  +   AR+TCS++  +
Sbjct  1    MAASVVAAKAGPSLLQPK---LDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIV  57

Query  183  KELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCP  362
            K      +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP
Sbjct  58   KRA----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCP  111

Query  363  TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIE  542
             + GG   F FKPG YS KKFCLEPTSFTVK +S  K    ++ +TKLMTR TYTLDEIE
Sbjct  112  ILSGGDGGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLDEIE  171

Query  543  GPFEVSSDG  569
                V   G
Sbjct  172  ADLSVDEKG  180



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQ  461
            PKRLT+DE+Q++TY+EVKGSGTANQCP + GG E F FKPG YS KKFCLEPTSFTVK +
Sbjct  1    PKRLTYDEVQAQTYLEVKGSGTANQCPILSGGDEGFKFKPGSYSVKKFCLEPTSFTVKKE  60

Query  462  SVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            S  K    ++ +TKLMTR TYTLDEIE    V   G
Sbjct  61   SPFKGGGDQYVDTKLMTRLTYTLDEIEADLSVDEKG  96



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  270  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  449
            AEGVP+RLTFDEI ++TY++VKGSGTANQCP +  G + F  K G Y  KK CLEPTSFT
Sbjct  28   AEGVPQRLTFDEINAQTYLDVKGSGTANQCPIVAEGSDKFNLKDGNYQMKKLCLEPTSFT  87

Query  450  VKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSS  563
            VKA+S  K    ++Q TKLMTR TYTLDEIEGP  +S+
Sbjct  88   VKAESQFKQGGEDYQPTKLMTRLTYTLDEIEGPLTISN  125



>gb|ADC54897.1| oxygen-evolving enhancer protein, partial [Cladophora coelothrix]
Length=235

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LT+D+ QS TYM++KG+G AN CP I+GG +N    KPG YS  KFC+EPTSF V+ +S+
Sbjct  1    LTYDQFQSLTYMQIKGTGLANTCPIIDGGSDNPKDIKPGTYSMYKFCMEPTSFKVQEESM  60

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             + AP  F +TKL+TR TYTLDE+EG F V SDG
Sbjct  61   QRGAPSFFSDTKLLTRLTYTLDEMEGKFVVGSDG  94



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +3

Query  237  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  416
            AT +L V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  
Sbjct  45   ATVSLGVAGAVLAQSASAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKL  104

Query  417  KKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            ++FC+EPTSFTVK +S  K    EFQ T+LMTR TYTLD + G F+V SDG
Sbjct  105  ERFCMEPTSFTVKEESQFKAGESEFQKTRLMTRLTYTLDGMTGDFKVGSDG  155



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +3

Query  237  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  416
            A+ AL V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y+ 
Sbjct  44   ASVALGVAGAVLAQSAGAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKEIKAGDYAL  103

Query  417  KKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            ++FC+EPTSFTVK +S  K    EF  T+LMTR TYTLD + G F+V SDG
Sbjct  104  ERFCMEPTSFTVKEESQFKQGESEFSKTRLMTRLTYTLDGMTGSFKVGSDG  154



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 84/140 (60%), Gaps = 9/140 (6%)
 Frame = +3

Query  156  ITCSLQSQIKELAHNFS-DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEV  332
            + C L   ++      + +  K+A   +  S+L+++GA+     + LT+DE+Q  TY++V
Sbjct  37   VVCGLSENVQSAVAAAAANVGKMA--VVVGSSLMLAGAS-----QALTYDELQGLTYLQV  89

Query  333  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLM  509
            KGSG AN CP +EGG  N    K G Y+  KFCLEPTSFTVK +S  K    +F  TKLM
Sbjct  90   KGSGIANTCPVLEGGSSNLKDLKAGDYNISKFCLEPTSFTVKEESQFKGGDTDFVKTKLM  149

Query  510  TRSTYTLDEIEGPFEVSSDG  569
            TR TYTLDEI G F V   G
Sbjct  150  TRLTYTLDEISGKFSVDGSG  169



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  452
            G    L+FDE+Q  TY++VKGSG AN CPT++GG  N    KPG YS  KFC+EPTSFTV
Sbjct  53   GSANALSFDELQGLTYLQVKGSGIANTCPTLDGGSANIKDLKPGSYSLGKFCMEPTSFTV  112

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K +S  K    +F +TKLMTR TYTLDE+ G F+V   G
Sbjct  113  KEESQFKGGDSDFVSTKLMTRLTYTLDEMSGSFKVDGSG  151



>ref|XP_010550781.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=195

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 91/149 (61%), Gaps = 20/149 (13%)
 Frame = +3

Query  30   MAASLQTAATLMQ--PTKVGVTPSIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNF  203
            MAASLQ  A  +   P++        RS  +V KA G+  S AR+TCSL S + + A   
Sbjct  1    MAASLQATAAFLSAAPSRCVRL----RSSPSVAKAFGLGSSSARLTCSLHSDLSDFARKC  56

Query  204  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG---SGTANQCPTIEG  374
            SDAAK+AGFALATSAL+VSGANAEGVPKRLTFDE    T MEVKG   +GTAN      G
Sbjct  57   SDAAKIAGFALATSALVVSGANAEGVPKRLTFDE----TCMEVKGITTTGTAN------G  106

Query  375  GVENFAFKPGKYSAKKFCLEPTSFTVKAQ  461
              E F F+P    A +F ++    T K++
Sbjct  107  HSEKFGFEPTMAEA-RFAVDEHDRTSKSR  134



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  452
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K +S  K    EF  TKLMTR TYTLD + G F+V SDG
Sbjct  107  KEESQFKGGDSEFVKTKLMTRLTYTLDAMSGSFKVGSDG  145



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  452
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K +S  K    EF  TKLMTR TYTLD + G F+V SDG
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDG  145



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  452
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K +S  K    EF  TKLMTR TYTLD + G F+V SDG
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDG  145



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVS  470
            +T+DE+Q  TY++VKG+G AN CP ++GG  + + K G Y+ +KFC+EPTSFTVK  S  
Sbjct  65   VTYDELQGLTYLQVKGTGLANTCPVVDGGESSKSIKAGDYALEKFCMEPTSFTVKEDSAF  124

Query  471  KNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K    EF  TKLMTR TYTLD + G F+V SDG
Sbjct  125  KAGESEFTKTKLMTRLTYTLDGMTGSFKVGSDG  157



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAQSV  467
            LTFDE+Q  TY++VKG+G AN CP I+GG  N    KPG YS +K CLEPTSFTVK ++ 
Sbjct  54   LTFDELQGLTYLQVKGTGIANTCPVIDGGSTNLKDLKPGTYSFEKLCLEPTSFTVKEENA  113

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
               +  EF +TKLMTR TYTLDEI G   V S+G
Sbjct  114  KGES--EFVSTKLMTRLTYTLDEISGKLTVGSNG  145



>ref|XP_003082811.1| photosystem II oxygen-evolving complex protein 1 precursor-Chlamydomonas 
reinhardtii (ISS) [Ostreococcus tauri]
Length=180

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVS  470
            +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK +S  
Sbjct  9    VTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQF  68

Query  471  KNAPPEFQNTKLMTRSTYTLDEIEGPFE  554
            K    EFQ T+LMTR TYTLD + G F+
Sbjct  69   KAGESEFQKTRLMTRLTYTLDGMTGDFK  96



>gb|AFK37254.1| unknown [Medicago truncatula]
Length=66

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  508  MSLVFWNSGGAFLLTLCAFTVNDVGSKQNFLALYFPGLNAKFSTPPSMVGHWLAVPLPFT  329
            MSLVFWN+ G FL+T  A TVN+VGS+QNFLALYFPGL    STPPSMVGHW AVP+P T
Sbjct  1    MSLVFWNASGVFLVTPSALTVNEVGSRQNFLALYFPGLKENESTPPSMVGHWFAVPVPLT  60

Query  328  SIYVLL  311
            S YVLL
Sbjct  61   SKYVLL  66



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTV  452
            G    LT+DE+Q  TY++VKGSG AN CP +E G  N    K G Y  +K C+EPTSFTV
Sbjct  45   GSANALTYDELQGLTYLQVKGSGIANTCPVVEAGTTNLNELKAGNYKFQKMCMEPTSFTV  104

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K +S  +    EF  TKLMTR TYTLDE+ G F+V   G
Sbjct  105  KEESQFRGGDSEFVKTKLMTRLTYTLDEMSGTFKVDGSG  143



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 65/103 (63%), Gaps = 6/103 (6%)
 Frame = +3

Query  261  GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPT  440
            GANA      LT++E+Q+ TYM+VKG+G AN CP +EG   N     G Y  +K CLEPT
Sbjct  61   GANA------LTYNELQNLTYMQVKGTGIANTCPIVEGAAGNIKLGSGTYKIEKMCLEPT  114

Query  441  SFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            SFTVK +S  K    E+  TKLMTR TYTLDEI G   V + G
Sbjct  115  SFTVKEESQFKGGADEYVQTKLMTRLTYTLDEISGALTVGAAG  157



>gb|ADC54900.1| oxygen-evolving enhancer protein, partial [Entransia fimbriata]
Length=151

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  318  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQN  497
            TY +VKG+G ANQCP +         KPGKY+ +K CLEPTSFTVKA    K++P  FQ 
Sbjct  1    TYXQVKGTGIANQCPKLGSAEPGLKVKPGKYAVEKLCLEPTSFTVKAPGPLKDSPVAFQK  60

Query  498  TKLMTRSTYTLDEIEGPFEVSSDG  569
            TKLMTR TYTLDE EG  +V SDG
Sbjct  61   TKLMTRLTYTLDENEGTLDVGSDG  84



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  452
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  52   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  111

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K +SV K    EF  TKLMTR TYTLD + G  +V SDG
Sbjct  112  KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDG  150



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  452
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  48   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  107

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K +SV K    EF  TKLMTR TYTLD + G  +V SDG
Sbjct  108  KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDG  146



>gb|ADC54902.1| oxygen-evolving enhancer protein, partial [Klebsormidium flaccidum]
Length=142

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  342  GTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRST  521
            G AN C  I GG + F  K GKY+ KK CLEPTSFTVKA+S  K+   +FQ TKLMTR T
Sbjct  1    GVANTCAIIAGGEDGFKVKAGKYTLKKLCLEPTSFTVKAESQFKDKKEDFQKTKLMTRLT  60

Query  522  YTLDEIEGPFEVSSDG  569
            YTLDEIEGP EV +DG
Sbjct  61   YTLDEIEGPLEVGNDG  76



>gb|ACU65446.1| putative oxygen-evolving enhancer [Tragopogon dubius]
Length=77

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +3

Query  60   LMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFAL  236
             MQPTKVGV+  +  +S Q++ KA GVDP+ AR++CSLQS +K+ AH  +DAAK+AGFAL
Sbjct  1    FMQPTKVGVSGRLQLKSSQSICKAFGVDPATARVSCSLQSDLKDFAHKCTDAAKIAGFAL  60

Query  237  ATSALLVSGANAEGVPK  287
            ATSAL+VSGA+AEG PK
Sbjct  61   ATSALVVSGASAEGSPK  77



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  405  KYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            KY+ KKFCLEPTSFTVKA+ V+KNAPPEFQ TKLMTR TYTLDEIEGP EVSSDG
Sbjct  1    KYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDG  55



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  270  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  449
            A G  + +T+DE+Q  TY++VKG+G AN CP +E G    + K G Y+ +KFC+EPTSFT
Sbjct  57   AAGSAQAVTYDELQGLTYLQVKGTGLANTCPVVETGGSGSSIKGGDYALEKFCMEPTSFT  116

Query  450  VKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            VK +S  K    EF  TKLMTR TYTLD + G F+V SDG
Sbjct  117  VKEESAFKAGESEFVKTKLMTRLTYTLDGMTGSFKVGSDG  156



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVS  470
            +T+DE+Q  TY++VKG+G AN CP +E G    A K G Y   KFC+EPTSFTVK +   
Sbjct  95   VTYDELQGLTYLQVKGTGLANTCPVVESGSGPKALKAGDYKFDKFCVEPTSFTVKEEKA-  153

Query  471  KNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             +   EF  TKLMTR TYTLD + G F+V SDG
Sbjct  154  -DGSTEFAKTKLMTRLTYTLDAMSGDFKVGSDG  185



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVS  470
            L++D++ + TY++VKG+G AN CP IE  V N   K G YS ++ C+EPTSFTVK +S  
Sbjct  23   LSYDDLNALTYLQVKGTGIANTCPVIEKNV-NDKIKAGDYSIEQLCMEPTSFTVKEESQF  81

Query  471  KNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K    EF  TKL+TR TYTLD+I G F+V +DG
Sbjct  82   KAGEAEFVKTKLLTRLTYTLDDISGKFKVGADG  114



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +3

Query  294  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAQSVS  470
            TFDE+Q  TY++VKGSG AN CPT+ GG  N    K G YS  K CLEPTSF VK ++  
Sbjct  65   TFDELQGLTYLQVKGSGIANTCPTLSGGSSNIKDLKSGTYSVNKMCLEPTSFKVKEEAQF  124

Query  471  KNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            KN   +F  TKL+TR TYTLDEI G  ++   G
Sbjct  125  KNGEADFVPTKLVTRLTYTLDEISGQMKIDGSG  157



>gb|ACU65447.1| putative oxygen-evolving enhancer [Tragopogon pratensis]
Length=77

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +3

Query  60   LMQPTKVGVTPSIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFAL  236
             MQPTKVGV+  +  +S Q++ KA GV+P+ AR++CSLQS +K+ AH  +DAAK+AGFAL
Sbjct  1    FMQPTKVGVSGRLQLKSSQSICKAFGVEPATARVSCSLQSDLKDFAHKCTDAAKIAGFAL  60

Query  237  ATSALLVSGANAEGVPK  287
            ATSAL+VSGA+AEG PK
Sbjct  61   ATSALVVSGASAEGSPK  77



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  243  SALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAK  419
            +++L   ANA      LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  +
Sbjct  40   TSMLAGAANA------LTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLE  93

Query  420  KFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +FC+EPT+F+VK +S  K     F  TKLMTR TYTLD + G F+V   G
Sbjct  94   RFCMEPTAFSVKEESQFKGGETNFVATKLMTRLTYTLDGMTGTFKVDGSG  143



>gb|AFK26084.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena stellata]
Length=248

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  29   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  88

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
                 PEF+ TKLMTR TYTLD I    +V  DG
Sbjct  89   DSKPKPEFEKTKLMTRLTYTLDGIRADLQVGGDG  122



>gb|AFK26083.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena pseudostellata]
Length=249

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  30   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  89

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
                 PEF+ TKLMTR TYTLD I    +V  DG
Sbjct  90   DSKPKPEFEKTKLMTRLTYTLDGIRADLQVGGDG  123



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAQSV  467
            L +D++Q  TY++VKGSG AN CP +  G  N    P G Y+  K CLEPTSF VK +S 
Sbjct  115  LDYDQLQGLTYLQVKGSGLANTCPDLNSGTTNLKELPAGDYAVSKLCLEPTSFKVKEESQ  174

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             K    +F +TKLMTR TYTLD+I G  ++ SDG
Sbjct  175  FKGGAADFVDTKLMTRLTYTLDDISGKLKLGSDG  208



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  420  KFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            KFCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  1    KFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDG  50



>gb|AFK26079.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Cryptoglena skujae]
Length=236

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  19   LTFDEIQSLSYLEVKGSGLANTCPIIADGTGAKLSLKSGNYKINNMCLEPSSFQVKVPS-  77

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +   P EF+ TKLMTR TYTLD I    +V  DG
Sbjct  78   TDGKPTEFEKTKLMTRLTYTLDGIRADLQVGGDG  111



>gb|AFK26085.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Monomorphina pyrum]
Length=237

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  20   LTFDEIQSLSYLEVKGSGLANTCPXIADGTGAKLSLKSGNYKINNMCLEPSSFQVKTPS-  78

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +   P EF+ TKLMTR TYTLD I    +V  DG
Sbjct  79   TDGKPSEFEKTKLMTRLTYTLDGIRADLQVGGDG  112



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAQSV  467
            LT+D++Q  TY++VKG+G AN CP I GG  N    P G Y   +FCLEPTSFTVK  S 
Sbjct  67   LTYDQLQGLTYLQVKGTGVANTCPVISGGSTNPKDIPAGNYKFSEFCLEPTSFTVKEDSQ  126

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             K    E   TKLMTR TYTLD++ G   + SDG
Sbjct  127  FKAGESELVKTKLMTRLTYTLDDMSGKMTIGSDG  160



>gb|AEW08532.1| hypothetical protein CL304Contig1_01, partial [Pinus radiata]
 gb|AFG43487.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43488.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43489.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
Length=87

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  402  GKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            GKY  KK C+EPTSFTVKA+  +KN PP+FQ T+LMTR TYTLDEIEGP EVSSDG
Sbjct  1    GKYEMKKLCMEPTSFTVKAEGTNKNLPPDFQKTRLMTRLTYTLDEIEGPLEVSSDG  56



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  423  FCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            FCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDG  49



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  423  FCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            FCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDG  49



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  423  FCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            FCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDG  49



>gb|ADC54906.1| oxygen-evolving enhancer protein, partial [Phyllodictyon orientale]
Length=148

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  333  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLM  509
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK +S+ + A PE+  TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGNYSMYKFCMEPTSFKVKEESIIRGAAPEYSKTKLL  61

Query  510  TRSTYTLDEIEGPFEVSSDG  569
            TR TY+LDE+EG F V SDG
Sbjct  62   TRLTYSLDEMEGKFIVGSDG  81



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  423  FCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            FCLEPTSFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDG  49



>gb|ADC54905.1| oxygen-evolving enhancer protein, partial [Ostreococcus tauri]
Length=148

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  318  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQN  497
            T  + KG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK +S  K    EFQ 
Sbjct  2    TXXQXKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQFKAGESEFQK  61

Query  498  TKLMTRSTYTLDEIEGPFEVSSDG  569
            T+LMTR TYTLD + G F+V SDG
Sbjct  62   TRLMTRLTYTLDGMTGDFKVGSDG  85



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVS  470
            +TFDE+Q  TY++VKG+G AN CPT+  G +    K G Y     C+EPT+F VK +S  
Sbjct  63   VTFDELQGLTYLQVKGTGVANTCPTLSTGGDGSTLKAGSYQISGMCIEPTAFKVKEESQF  122

Query  471  KNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            K    EF  TKLMTR TYTLD + G   V SDG
Sbjct  123  KEGTSEFVKTKLMTRLTYTLDGLSGKMTVGSDG  155



>gb|ADC54893.1| oxygen-evolving enhancer protein, partial [Boodlea composita]
Length=148

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query  318  TYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQ  494
            T  + KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK +S+ +   PE+ 
Sbjct  2    TXXQXKGTGLANTCPIIDGGSDNPKDLKAGTYSMYKFCMEPTSFQVKEESIIRGGAPEYS  61

Query  495  NTKLMTRSTYTLDEIEGPFEVSSDG  569
             TKL+TR TY+LDE+EG F V SDG
Sbjct  62   KTKLLTRLTYSLDEMEGKFVVGSDG  86



>gb|AFB34200.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
 gb|AFB34201.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
Length=87

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  402  GKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            GKY  KK C+EPTSFTVKA+S +KN PP+FQ TKLMTR TYTLDEIEGP +VS DG
Sbjct  1    GKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTKLMTRLTYTLDEIEGPLDVSPDG  56



>gb|ADC54908.1| oxygen-evolving enhancer protein, partial [Siphonocladus tropicus]
Length=145

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +3

Query  327  EVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTK  503
            + KG+G AN CP I+GG +N    KPG Y+  KFC+EPTSFTVK Q++ +   P +  TK
Sbjct  1    QXKGTGLANTCPIIDGGSDNPKDIKPGSYAMYKFCMEPTSFTVKEQALIRGGEPFYSKTK  60

Query  504  LMTRSTYTLDEIEGPFEVSSDG  569
            L+TR TY+LDE+EG F V SDG
Sbjct  61   LLTRLTYSLDEMEGKFIVGSDG  82



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFT  449
            G  K LT+DE Q  +Y++VKGSG AN CP +  G  +   A KPG Y   KFC+EPT F 
Sbjct  81   GASKALTYDEFQGLSYLDVKGSGMANTCPVLSSGTTDVKTALKPGNYKFDKFCIEPTKFQ  140

Query  450  VKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            VK + V K    EF +TKLMTR TYTLD + G  +V S G
Sbjct  141  VK-EDVGK-GKKEFIDTKLMTRLTYTLDAMSGSMKVGSGG  178



>gb|KIY92168.1| Oxygen-evolving enhancer protein 1,chloroplastic [Monoraphidium 
neglectum]
Length=153

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +3

Query  276  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  452
            G    LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  ++FC+EPT+F+V
Sbjct  44   GAANALTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLERFCMEPTAFSV  103

Query  453  KAQSVSKNAPPEFQNTKLMTRSTYTLDEIE  542
            K +S  K     F  TKLMTR TYTLD + 
Sbjct  104  KEESQFKGGETNFVATKLMTRLTYTLDGVR  133



>gb|ADC54913.1| oxygen-evolving enhancer protein, partial [Valonia utricularis]
Length=147

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  333  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLM  509
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK +SV++   P + +TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGSYSMYKFCMEPTSFKVKEESVARGGAPSYSSTKLL  61

Query  510  TRSTYTLDEIEGPFEVSSDG  569
            TR TY+LDE+EG F V SDG
Sbjct  62   TRLTYSLDEMEGKFIVGSDG  81



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  142  LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  201

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             K    EF+ TKLMTR TYTLD I     V  DG
Sbjct  202  EKQQVTEFERTKLMTRLTYTLDAISADLNVGGDG  235



>emb|CCI69514.1| oxygen-evolving enhancer protein, partial [Scotinosphaera sp. 
CAUP H5307]
Length=173

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +3

Query  333  KGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKL  506
            + SG AN C  IEGG  N   A KPG Y  ++FCLEPTSFTVK +S  K   PEF  TKL
Sbjct  11   RDSGVANTCAVIEGGSSNVRSALKPGSYKLERFCLEPTSFTVKEESSFKGGEPEFVKTKL  70

Query  507  MTRSTYTLDEIEGPFEVSSDG  569
            MTR TYTLD I G  +V+SDG
Sbjct  71   MTRLTYTLDSISGSLKVNSDG  91



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  96   LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  155

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             K    EF+ TKLMTR TYTLD I     V  DG
Sbjct  156  EKQQVTEFERTKLMTRLTYTLDAISADLNVGGDG  189



>gb|AFK26080.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Discoplastis spathirhyncha]
Length=239

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query  297  FDEIQSKTYMEVKGSGTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSK  473
            +DEIQS +Y+EVKGSG AN CP I EG     A K G Y     CLEP+SF VK  S   
Sbjct  21   YDEIQSLSYLEVKGSGLANTCPIIAEGSGNKLALKAGNYKINNMCLEPSSFQVKVPSPDG  80

Query  474  NAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
                +F+ TKLMTR TYTLD I     V  DG
Sbjct  81   KTVTDFEKTKLMTRLTYTLDGIRADLTVGGDG  112



>emb|CAH04962.1| oxygen-evolving enhancer protein 1 [Cyanophora paradoxa]
Length=347

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 6/106 (6%)
 Frame = +3

Query  255  VSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE-NFAFKPGK-YSAKKFC  428
            VS ANAEG    LTFD++ S  Y+++KG+G +N CPT+      N + + GK Y     C
Sbjct  86   VSQANAEG----LTFDQLNSANYLKLKGTGISNTCPTLGASARGNISLEKGKEYYLTDLC  141

Query  429  LEPTSFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSD  566
            ++PT   VKA+S+ K    EFQ T+L+TR+TYT+D++EGP  V SD
Sbjct  142  IQPTEILVKAESLQKGKGEEFQPTRLVTRATYTIDKVEGPIFVDSD  187



>gb|AFK26081.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena archaeoplastidiata]
Length=237

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LT+DE+QS +Y+E+KGSG +N CP I  G  N  + K G Y     CLEP SF V++ S 
Sbjct  20   LTYDEMQSLSYLEMKGSGLSNTCPIIADGTGNKLSLKAGDYKILNMCLEPASFQVRSPS-  78

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +   P EF+ TKLMTR TYTLD I    +V  DG
Sbjct  79   ADGKPSEFEKTKLMTRLTYTLDGIRANLKVGGDG  112



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 4/94 (4%)
 Frame = +3

Query  294  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAQSV  467
            TFDE Q  +Y++VKGSG AN CP +  G  +   + KPG Y  +KFC+EP+SF VK + V
Sbjct  91   TFDEFQGLSYLDVKGSGMANTCPVLSSGTSDVKGSLKPGTYKFEKFCIEPSSFQVK-EDV  149

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             K    EF NTKLMTR TYTLD + G  +V S G
Sbjct  150  GK-GKKEFINTKLMTRLTYTLDAMSGTMKVGSGG  182



>gb|ADC54894.1| oxygen-evolving enhancer protein, partial [Bornetella sphaerica]
Length=142

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +3

Query  333  KGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLM  509
            KG+G AN CPTIE G  +  A   G Y   KFC+EPTSFTVK +S  K    EF NTKLM
Sbjct  1    KGTGIANTCPTIETGTTDLSALXAGDYKFSKFCMEPTSFTVKEESQFKGGETEFVNTKLM  60

Query  510  TRSTYTLDEIEGPFEVSSD  566
            TR TYTLD++ G F+V SD
Sbjct  61   TRLTYTLDDMSGTFKVGSD  79



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 75/147 (51%), Gaps = 17/147 (12%)
 Frame = +3

Query  135  VDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQS  314
            V P   R+  S  + +K +A         AG A A     VS     G    LTFDE Q 
Sbjct  47   VAPRQTRVFASKPNAMKNIA---------AGLAAAG----VSSIGFLGASNALTFDEFQG  93

Query  315  KTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPE  488
             +Y +VKGSG AN CP +  G  +   + K G Y   KFC+EPTSF VK + V K    E
Sbjct  94   LSYTDVKGSGMANTCPILNSGTTDVKGSLKAGTYKFDKFCIEPTSFQVK-EDVGKG-KKE  151

Query  489  FQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            F + KLMTR TYTLD + G  +V S G
Sbjct  152  FIDVKLMTRLTYTLDAMSGSMKVGSGG  178



>gb|AFK26082.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena granulata]
Length=239

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAQSV  467
            LT++E+QS +Y+E+KG+G +N CP I  G       K GKY     CLEP++F VK    
Sbjct  20   LTYNEMQSLSYLEMKGTGLSNTCPIITDGTGTKLNLKAGKYEINNMCLEPSAFQVKVPPT  79

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
                 PEF+ TKLMTR TYTLD I     V  DG
Sbjct  80   DVRPNPEFERTKLMTRLTYTLDGIRADLTVGGDG  113



>gb|ADE06500.1| oxygen-evolving enhancer [Tragopogon porrifolius]
Length=61

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  105  SYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVP  284
            S Q++ KA GV+P+ AR++CSLQS +K+ AH  +DAAK+AGFALATSAL+VSGA+AEG P
Sbjct  1    SSQSICKAFGVEPATARVSCSLQSDLKDFAHKCTDAAKIAGFALATSALVVSGASAEGSP  60

Query  285  K  287
            K
Sbjct  61   K  61



>gb|ADC54904.1| oxygen-evolving enhancer protein, partial [Nephroselmis olivacea]
Length=142

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = +3

Query  327  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKL  506
            + KG+G AN CP IE  V +   K G Y+ ++ CLEPTSFTVK +S  K+   EF  TKL
Sbjct  1    QXKGTGIANTCPVIEKDVSD-KIKGGDYAMEQLCLEPTSFTVKEESQFKDGKSEFVKTKL  59

Query  507  MTRSTYTLDEIEGPFEVSSDG  569
            MTR TYTLD+I G F+V +DG
Sbjct  60   MTRLTYTLDDITGKFKVGADG  80



>ref|XP_005652213.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27669.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
Length=270

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAQSV  467
            +T+D++Q+ +Y EV+G+G A  CP IE G  N A  KPG Y  K  CLEPT   V+ + +
Sbjct  10   ITYDQLQNMSYNEVRGTGLAAVCPLIEEGSTNLADLKPGTYKLKNLCLEPTKIQVQEEGL  69

Query  468  SKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            +K + P++ NTKL+TR T  L +IE   +V  +G
Sbjct  70   TKGSGPQWSNTKLLTRQTTNLSDIEADLKVGPNG  103



>emb|CCI69513.1| oxygen-evolving enhancer protein, partial [Chlorochytrium lemnae]
Length=143

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +3

Query  333  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLM  509
            KGSG AN CP IEGG  N    KPG Y+  K C+EPTSFTVK  S  K    EF  TKLM
Sbjct  1    KGSGIANTCPVIEGGSTNLKDLKPGXYTFDKLCMEPTSFTVKEDSQFKGGETEFVKTKLM  60

Query  510  TRSTYTLDEIEGPFEVSSDG  569
            TR TYTLD + G  +V   G
Sbjct  61   TRLTYTLDAMSGTMKVDGSG  80



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +3

Query  294  TFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAQSVS  470
            T+DEIQS +YME+KG+G +N CP I    E+    + G Y     CLEP+SF VK  S  
Sbjct  106  TYDEIQSLSYMEMKGTGLSNTCPIIADSSESKLNLRAGNYKINNMCLEPSSFQVKVPSPD  165

Query  471  KNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
                 +F+ TKLMTR TYTLD I     V  DG
Sbjct  166  GKTVTDFEKTKLMTRLTYTLDGIRADLAVGGDG  198



>gb|ADC54890.1| oxygen-evolving enhancer protein, partial [Acetabularia acetabulum]
Length=143

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  342  GTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRS  518
            G AN C  IE G  + +  KPG Y   KFC+EP+SFTVK +S  K    EF NTKLMTR 
Sbjct  1    GVANTCAVIESGSTDLSVLKPGNYKFTKFCMEPSSFTVKEESQFKGGETEFVNTKLMTRL  60

Query  519  TYTLDEIEGPFEVSSDG  569
            TYTLD++ G F V+S+G
Sbjct  61   TYTLDDMNGQFAVASNG  77



>gb|ADC54903.1| oxygen-evolving enhancer protein, partial [Mesostigma viride]
Length=151

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +3

Query  318  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQN  497
            T  + KG+G AN C  I+          GKY   K CLEPTS  VK +S+ K   P+F  
Sbjct  2    TXXQXKGTGLANTCAVIDNASTELKVAGGKYKVAKMCLEPTSVKVKEESILKGGAPQFVE  61

Query  498  TKLMTRSTYTLDEIEGPFEVSSDG  569
            TKL+TR TYTLDEI G   V +DG
Sbjct  62   TKLLTRMTYTLDEISGSMTVGNDG  85



>gb|ADC54901.1| oxygen-evolving enhancer protein, partial [Ignatius tetrasporus]
Length=145

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +3

Query  327  EVKGSGTANQCPTIEGGVEN--FAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNT  500
            ++KGSG AN CP IEGG  N     K G Y    FC+EPTSF VK +S  K    EF NT
Sbjct  1    QIKGSGIANTCPVIEGGSSNPKSDLKSGTYKFDNFCMEPTSFQVKEESQFKGGNEEFVNT  60

Query  501  KLMTRSTYTLDEIEGPFEVS  560
            KLMTR TYTLD + G   ++
Sbjct  61   KLMTRLTYTLDAMSGEIRIN  80



>gb|ADC54898.1| oxygen-evolving enhancer protein, partial [Codium sp. HEC 15711]
Length=151

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +3

Query  318  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQN  497
            TY ++KG+G AN CPT+  G +  A KPG Y+    C+EPTS  VK +S  K+   +F  
Sbjct  1    TYXQIKGTGLANTCPTLSTGDDAKALKPGSYAVSSMCIEPTSIQVKDESQFKDGVADFVK  60

Query  498  TKLMTRSTYTLDEIEGPFEVSSDG  569
            TKLMTR TYTLD + G   V   G
Sbjct  61   TKLMTRLTYTLDGLGGKMTVGGSG  84



>gb|AGI15762.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=158

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  441  SFTVKAQSVSKNAPPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            SFTVKA+SVSKNAPPEFQ TKLMTR TYTLDEIEGPFEVS DG
Sbjct  1    SFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDG  43



>gb|ADC54912.1| oxygen-evolving enhancer protein, partial [Ulva intestinalis]
Length=151

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = +3

Query  318  TYMEVKGSGTANQCPTIE---GGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPE  488
            TY ++KG+G AN CPT+E   G V +   KPG Y   +FC+EP+  TVK +S  K    E
Sbjct  1    TYXQIKGTGRANACPTLEETNGSVSDL--KPGNYKLDRFCMEPSKITVKEESQFKGGVTE  58

Query  489  FQNTKLMTRSTYTLDEIEGPFEVSSDG  569
            F NTKL+TR TYTLD++ G   +   G
Sbjct  59   FVNTKLVTRLTYTLDQMSGTVTIGPGG  85



>gb|ADC54899.1| oxygen-evolving enhancer protein, partial [Derbesia sp. 2773-1]
Length=142

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  333  KGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMT  512
            KG+G AN CPT+E G +  + K G Y+    C+EPT+F VK +S  ++ P  F +TKLMT
Sbjct  1    KGTGIANTCPTLETGEDGKSLKAGTYTVSGMCIEPTAFQVKEESEFRDQPAAFVDTKLMT  60

Query  513  RSTYTLDEIEGPFEVSSDG  569
            R TYTLD + G   V  DG
Sbjct  61   RLTYTLDGLGGKMTVGGDG  79



>gb|ADC54891.1| oxygen-evolving enhancer protein, partial [Ulvella repens]
Length=140

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  342  GTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKLMTRS  518
            G AN C T+ EG  E  A K G Y+  +FC+EPT FTVK +S  K    EF NTKLMTR 
Sbjct  1    GVANTCATLDEGSAEGSALKQGTYALSQFCMEPTKFTVKEESQFKGGVTEFVNTKLMTRL  60

Query  519  TYTLDEIEGPFEVSSDG  569
            TYTLD++ G   V + G
Sbjct  61   TYTLDQMSGTMTVGAGG  77



>gb|ADC54895.1| oxygen-evolving enhancer protein, partial [Bryopsis sp. EE4]
Length=144

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +3

Query  327  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAQSVSKNAPPEFQNTKL  506
            + KG+G AN CPT+  G +  + K G Y     C+EPTS TVK +S  K+   EF  TKL
Sbjct  1    QXKGTGVANTCPTLATGGDGSSLKAGSYQVTGMCIEPTSITVKEESQFKDGVSEFVKTKL  60

Query  507  MTRSTYTLDEIEGPFEVSSDG  569
            MTR TYTLD + G   V  DG
Sbjct  61   MTRLTYTLDGLSGKMTVGGDG  81



>dbj|BAJ61711.1| oxygen-evolving enhancer protein, partial [Pyrenomonas helgolandii]
Length=335

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 4/97 (4%)
 Frame = +3

Query  291  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG-KYSAKKFCLEPTSFTVKAQSV  467
            L+  +++S TY ++KG+G AN+CP +E   ++   + G KY     CLEP SF ++ + V
Sbjct  73   LSSADVRSLTYQQIKGTGLANRCPEVEVNGDSIELQKGTKYKITDLCLEPKSFQIEEEIV  132

Query  468  SKNA---PPEFQNTKLMTRSTYTLDEIEGPFEVSSDG  569
             K       EF +TKLMTR+TYTL  +EGP     DG
Sbjct  133  KKRTGETKKEFVDTKLMTRATYTLAGVEGPLFYDKDG  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515