BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051I11

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01376.1|  unnamed protein product                                165   3e-45   Coffea canephora [robusta coffee]
ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...    166   4e-45   Sesamum indicum [beniseed]
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-41   Solanum lycopersicum
gb|KDO84283.1|  hypothetical protein CISIN_1g037458mg                   150   2e-41   Citrus sinensis [apfelsine]
ref|XP_009764865.1|  PREDICTED: polyadenylate-binding protein RBP...    155   5e-41   Nicotiana sylvestris
ref|XP_009605325.1|  PREDICTED: polyadenylate-binding protein RBP...    154   8e-41   Nicotiana tomentosiformis
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...    154   9e-41   Vitis vinifera
ref|XP_006434825.1|  hypothetical protein CICLE_v10001214mg             150   2e-40   
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg             153   3e-40   Prunus persica
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...    152   4e-40   Prunus mume [ume]
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...    152   4e-40   Prunus mume [ume]
ref|XP_006434824.1|  hypothetical protein CICLE_v10001214mg             150   8e-40   
gb|EYU36286.1|  hypothetical protein MIMGU_mgv1a005576mg                151   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg             150   3e-39   Citrus clementina [clementine]
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...    150   3e-39   Citrus sinensis [apfelsine]
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...    150   4e-39   
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...    149   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...    150   4e-39   
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...    147   3e-38   
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...    146   5e-38   Glycine max [soybeans]
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...    146   5e-38   Glycine max [soybeans]
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                    146   6e-38   Glycine soja [wild soybean]
ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...    146   8e-38   Solanum tuberosum [potatoes]
ref|XP_009765294.1|  PREDICTED: polyadenylate-binding protein RBP...    146   9e-38   Nicotiana sylvestris
emb|CAC69852.1|  nucleic acid binding protein                           146   1e-37   Nicotiana tabacum [American tobacco]
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g             144   4e-37   Phaseolus vulgaris [French bean]
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...    143   6e-37   
ref|XP_009629702.1|  PREDICTED: polyadenylate-binding protein RBP...    144   7e-37   Nicotiana tomentosiformis
gb|KJB59840.1|  hypothetical protein B456_009G275200                    143   8e-37   Gossypium raimondii
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    143   9e-37   Glycine max [soybeans]
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...    143   9e-37   Pyrus x bretschneideri [bai li]
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...    143   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_002510266.1|  nuclear acid binding protein, putative             143   1e-36   Ricinus communis
gb|KJB58433.1|  hypothetical protein B456_009G209600                    142   1e-36   Gossypium raimondii
ref|XP_007017334.1|  RNA-binding protein 47C isoform 6                  140   2e-36   
gb|KEH40057.1|  polyadenylate-binding protein RBP47C                    139   3e-36   Medicago truncatula
gb|KHG01821.1|  Polyadenylate-binding RBP47C -like protein              140   6e-36   Gossypium arboreum [tree cotton]
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             141   6e-36   Phaseolus vulgaris [French bean]
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                  140   7e-36   
gb|KDP38389.1|  hypothetical protein JCGZ_04314                         141   7e-36   Jatropha curcas
gb|KJB58432.1|  hypothetical protein B456_009G209600                    141   7e-36   Gossypium raimondii
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                  140   9e-36   
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...    140   9e-36   Cucumis melo [Oriental melon]
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP...    140   1e-35   Cucumis sativus [cucumbers]
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                    139   1e-35   Glycine soja [wild soybean]
ref|XP_007017335.1|  RNA-binding protein 47C isoform 7                  139   1e-35   
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                  140   1e-35   
gb|KJB63806.1|  hypothetical protein B456_010G017300                    138   3e-35   Gossypium raimondii
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                  139   3e-35   
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                  139   3e-35   
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                    139   4e-35   Medicago truncatula
gb|AFK35123.1|  unknown                                                 139   4e-35   Medicago truncatula
gb|KHG24367.1|  Polyadenylate-binding RBP47                             138   5e-35   Gossypium arboreum [tree cotton]
gb|EYU25396.1|  hypothetical protein MIMGU_mgv1a006186mg                139   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    138   7e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    138   7e-35   Nelumbo nucifera [Indian lotus]
gb|KJB63805.1|  hypothetical protein B456_010G017300                    137   1e-34   Gossypium raimondii
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                     137   1e-34   Eucalyptus grandis [rose gum]
ref|XP_004499084.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-34   Cicer arietinum [garbanzo]
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-34   Populus euphratica
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-34   Populus euphratica
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                     137   2e-34   Eucalyptus grandis [rose gum]
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-34   Populus euphratica
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-34   Populus euphratica
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-34   Populus euphratica
ref|XP_010061775.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-34   Eucalyptus grandis [rose gum]
gb|KHG27259.1|  Polyadenylate-binding RBP47                             135   4e-34   Gossypium arboreum [tree cotton]
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...    135   6e-34   Tarenaya hassleriana [spider flower]
ref|XP_004291135.1|  PREDICTED: polyadenylate-binding protein RBP...    135   6e-34   Fragaria vesca subsp. vesca
ref|XP_006374988.1|  RNA-binding protein 47                             135   1e-33   
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C               134   2e-33   Morus notabilis
gb|EPS64859.1|  nucleic acid binding protein                            133   2e-33   Genlisea aurea
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...    134   2e-33   Phaseolus vulgaris [French bean]
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    133   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_002302445.2|  RNA-binding protein 47                             133   4e-33   
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    133   4e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...    132   7e-33   Cicer arietinum [garbanzo]
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...    131   3e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...    128   1e-31   Phoenix dactylifera
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...    128   2e-31   
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...    129   2e-31   Vitis vinifera
gb|KEH35744.1|  polyadenylate-binding protein RBP47C                    126   2e-31   Medicago truncatula
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47     127   3e-31   Elaeis guineensis
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...    127   4e-31   Phoenix dactylifera
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...    127   7e-31   Cucumis melo [Oriental melon]
gb|KGN55171.1|  hypothetical protein Csa_4G639100                       125   1e-30   Cucumis sativus [cucumbers]
ref|XP_003603009.1|  RNA-binding protein                                125   2e-30   Medicago truncatula
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...    124   2e-30   Oryza brachyantha
ref|XP_004141245.1|  PREDICTED: polyadenylate-binding protein RBP...    125   3e-30   Cucumis sativus [cucumbers]
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47     125   3e-30   Populus euphratica
ref|XP_009390905.1|  PREDICTED: polyadenylate-binding protein RBP...    125   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001063403.1|  Os09g0462700                                       125   5e-30   
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...    124   5e-30   Populus euphratica
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...    124   1e-29   Vitis vinifera
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    123   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_006393576.1|  hypothetical protein EUTSA_v10011476mg             123   1e-29   
emb|CBI32444.3|  unnamed protein product                                122   2e-29   Vitis vinifera
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    123   2e-29   Brachypodium distachyon [annual false brome]
ref|XP_002313840.2|  RNA-binding protein 47                             123   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    122   2e-29   Phoenix dactylifera
gb|AFW58430.1|  nucleic acid binding protein                            119   3e-29   
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    122   3e-29   
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...    122   3e-29   
emb|CDO97156.1|  unnamed protein product                                122   3e-29   Coffea canephora [robusta coffee]
ref|XP_010539063.1|  PREDICTED: polyadenylate-binding protein RBP...    122   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    122   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001144988.1|  uncharacterized protein LOC100278143               122   5e-29   Zea mays [maize]
ref|XP_004952707.1|  PREDICTED: polyadenylate-binding protein RBP...    122   6e-29   Setaria italica
ref|NP_001132004.1|  uncharacterized protein LOC100193409               121   6e-29   Zea mays [maize]
dbj|BAG87507.1|  unnamed protein product                                120   6e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...    121   6e-29   Setaria italica
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...    121   7e-29   Zea mays [maize]
ref|NP_001052934.2|  Os04g0449900                                       121   7e-29   
dbj|BAJ85879.1|  predicted protein                                      122   7e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF87959.1|  unknown                                                 121   7e-29   Zea mays [maize]
gb|EAY94326.1|  hypothetical protein OsI_16094                          121   7e-29   Oryza sativa Indica Group [Indian rice]
emb|CAH67097.1|  H0818E04.14                                            121   7e-29   Oryza sativa [red rice]
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280          121   8e-29   Sorghum bicolor [broomcorn]
emb|CAL25353.1|  ACBF-like dna binding protein                          117   1e-28   Platanus x hispanica [London plane tree]
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...    120   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47     120   2e-28   Malus domestica [apple tree]
gb|ACG32072.1|  nucleic acid binding protein                            120   2e-28   Zea mays [maize]
gb|KJB79290.1|  hypothetical protein B456_013G042300                    119   2e-28   Gossypium raimondii
ref|XP_008678713.1|  PREDICTED: polyadenylate-binding protein RBP...    120   2e-28   Zea mays [maize]
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...    120   2e-28   Glycine max [soybeans]
ref|NP_001150649.1|  nucleic acid binding protein                       120   2e-28   Zea mays [maize]
gb|ACF85767.1|  unknown                                                 120   2e-28   Zea mays [maize]
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g             120   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...    119   3e-28   Glycine max [soybeans]
gb|KDO49120.1|  hypothetical protein CISIN_1g013061mg                   118   4e-28   Citrus sinensis [apfelsine]
gb|KDO49118.1|  hypothetical protein CISIN_1g013061mg                   119   4e-28   Citrus sinensis [apfelsine]
gb|KDO49121.1|  hypothetical protein CISIN_1g013061mg                   118   4e-28   Citrus sinensis [apfelsine]
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                     119   5e-28   Eucalyptus grandis [rose gum]
gb|KDO49119.1|  hypothetical protein CISIN_1g013061mg                   119   5e-28   Citrus sinensis [apfelsine]
ref|XP_006423053.1|  hypothetical protein CICLE_v10028454mg             119   5e-28   
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47     119   5e-28   
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...    119   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004153285.1|  PREDICTED: polyadenylate-binding protein RBP...    115   6e-28   
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...    119   6e-28   Setaria italica
gb|KJB79289.1|  hypothetical protein B456_013G042300                    119   6e-28   Gossypium raimondii
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...    119   7e-28   Citrus sinensis [apfelsine]
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                   119   7e-28   Citrus sinensis [apfelsine]
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg             119   7e-28   Citrus clementina [clementine]
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...    118   8e-28   Brachypodium distachyon [annual false brome]
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g             118   8e-28   Phaseolus vulgaris [French bean]
gb|KJB79291.1|  hypothetical protein B456_013G042300                    118   8e-28   Gossypium raimondii
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g             118   9e-28   Phaseolus vulgaris [French bean]
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...    118   1e-27   
ref|XP_006648763.1|  PREDICTED: polyadenylate-binding protein RBP...    117   2e-27   
gb|EPS57677.1|  hypothetical protein M569_17140                         117   2e-27   Genlisea aurea
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    120   2e-27   Elaeis guineensis
ref|XP_003608019.1|  RNA Binding Protein                                117   2e-27   Medicago truncatula
ref|XP_002452313.1|  hypothetical protein SORBIDRAFT_04g023540          117   2e-27   Sorghum bicolor [broomcorn]
gb|AFK40720.1|  unknown                                                 117   2e-27   Medicago truncatula
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...    117   3e-27   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47     117   3e-27   Sesamum indicum [beniseed]
gb|KDP23018.1|  hypothetical protein JCGZ_01681                         116   4e-27   Jatropha curcas
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...    116   4e-27   Cicer arietinum [garbanzo]
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    116   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB47423.1|  hypothetical protein B456_008G025400                    116   4e-27   Gossypium raimondii
gb|KJB47422.1|  hypothetical protein B456_008G025400                    116   5e-27   Gossypium raimondii
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47     115   6e-27   Solanum lycopersicum
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...    115   6e-27   Phoenix dactylifera
ref|NP_001275480.1|  DNA binding protein ACBF-like                      115   7e-27   Solanum tuberosum [potatoes]
ref|XP_007042377.1|  RNA-binding protein 47A                            115   8e-27   
ref|XP_004145357.1|  PREDICTED: polyadenylate-binding protein RBP...    115   8e-27   
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...    115   8e-27   Solanum lycopersicum
ref|XP_004168889.1|  PREDICTED: polyadenylate-binding protein RBP...    115   8e-27   
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47     115   9e-27   Solanum tuberosum [potatoes]
ref|XP_010052834.1|  PREDICTED: polyadenylate-binding protein RBP...    114   9e-27   Eucalyptus grandis [rose gum]
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Nicotiana tomentosiformis
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47     115   1e-26   Nicotiana tomentosiformis
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Nicotiana sylvestris
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Nicotiana sylvestris
ref|XP_006343293.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Solanum tuberosum [potatoes]
gb|AAC49850.1|  DNA binding protein ACBF                                115   1e-26   Nicotiana tabacum [American tobacco]
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     115   1e-26   Cucumis melo [Oriental melon]
ref|XP_010500273.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Camelina sativa [gold-of-pleasure]
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg                115   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_003575198.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_010052833.1|  PREDICTED: polyadenylate-binding protein RBP...    114   1e-26   Eucalyptus grandis [rose gum]
ref|XP_009789022.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Nicotiana sylvestris
ref|XP_009595795.1|  PREDICTED: polyadenylate-binding protein RBP...    114   2e-26   Nicotiana tomentosiformis
gb|AAB92518.1|  putative RNA binding protein                            115   2e-26   Nicotiana tabacum [American tobacco]
ref|XP_002518798.1|  nuclear acid binding protein, putative             114   2e-26   Ricinus communis
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...    114   2e-26   Solanum tuberosum [potatoes]
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...    114   2e-26   Solanum tuberosum [potatoes]
ref|XP_010461546.1|  PREDICTED: polyadenylate-binding protein RBP...    114   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   Nicotiana tomentosiformis
ref|NP_001275430.1|  DNA-binding protein-like                           114   3e-26   Solanum tuberosum [potatoes]
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2          114   3e-26   Solanum lycopersicum
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1          114   3e-26   
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   Nicotiana tomentosiformis
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg             114   3e-26   Prunus persica
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   Prunus mume [ume]
ref|XP_006845940.1|  hypothetical protein AMTR_s00157p00080130          112   3e-26   
ref|NP_001234487.1|  DNA-binding protein                                114   3e-26   
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   Prunus mume [ume]
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   Eucalyptus grandis [rose gum]
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...    114   4e-26   Fragaria vesca subsp. vesca
gb|KDP39118.1|  hypothetical protein JCGZ_00875                         113   4e-26   Jatropha curcas
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...    114   4e-26   Fragaria vesca subsp. vesca
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...    113   5e-26   Nicotiana sylvestris
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...    113   6e-26   Nicotiana sylvestris
ref|NP_001130489.1|  uncharacterized protein LOC100191587               113   7e-26   Zea mays [maize]
ref|XP_010327242.1|  PREDICTED: polyadenylate-binding protein RBP...    112   7e-26   
ref|XP_001777334.1|  predicted protein                                  112   8e-26   
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             112   8e-26   Phaseolus vulgaris [French bean]
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    112   8e-26   Phaseolus vulgaris [French bean]
gb|EPS64177.1|  hypothetical protein M569_10604                         112   1e-25   Genlisea aurea
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    112   1e-25   Phaseolus vulgaris [French bean]
emb|CDX95176.1|  BnaC09g16940D                                          112   1e-25   
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   Sesamum indicum [beniseed]
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   Solanum lycopersicum
emb|CDP04386.1|  unnamed protein product                                110   1e-25   Coffea canephora [robusta coffee]
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   Solanum lycopersicum
ref|XP_011096085.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   Sesamum indicum [beniseed]
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   Sesamum indicum [beniseed]
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   Sesamum indicum [beniseed]
emb|CDY52067.1|  BnaA09g53390D                                          112   2e-25   Brassica napus [oilseed rape]
ref|XP_009114049.1|  PREDICTED: polyadenylate-binding protein RBP...    112   2e-25   Brassica rapa
ref|XP_004153512.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-25   
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg             111   2e-25   Eutrema salsugineum [saltwater cress]
gb|KJB69302.1|  hypothetical protein B456_011G015300                    110   2e-25   Gossypium raimondii
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     111   2e-25   Solanum lycopersicum
sp|Q9LEB4.1|RBP45_NICPL  RecName: Full=Polyadenylate-binding prot...    111   3e-25   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009600135.1|  PREDICTED: polyadenylate-binding protein RBP45     111   3e-25   Nicotiana tomentosiformis
emb|CDY66423.1|  BnaAnng22220D                                          111   3e-25   Brassica napus [oilseed rape]
ref|XP_009795696.1|  PREDICTED: polyadenylate-binding protein RBP45     111   3e-25   Nicotiana sylvestris
gb|KFK27100.1|  hypothetical protein AALP_AA8G334500                    111   3e-25   Arabis alpina [alpine rockcress]
gb|KFK27101.1|  hypothetical protein AALP_AA8G334500                    110   3e-25   Arabis alpina [alpine rockcress]
ref|XP_001784132.1|  predicted protein                                  111   3e-25   
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...    110   3e-25   Solanum tuberosum [potatoes]
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...    110   4e-25   Solanum tuberosum [potatoes]
gb|KJB69305.1|  hypothetical protein B456_011G015300                    109   4e-25   Gossypium raimondii
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...    110   4e-25   Nicotiana tomentosiformis
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454             110   4e-25   
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...    110   4e-25   Nicotiana sylvestris
gb|KJB69304.1|  hypothetical protein B456_011G015300                    109   4e-25   Gossypium raimondii
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...    110   4e-25   Nicotiana sylvestris
emb|CDX70874.1|  BnaC03g09580D                                          110   4e-25   
gb|KJB81765.1|  hypothetical protein B456_013G160200                    109   5e-25   Gossypium raimondii
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             110   5e-25   Phaseolus vulgaris [French bean]
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    110   5e-25   Solanum tuberosum [potatoes]
ref|XP_010278713.1|  PREDICTED: polyadenylate-binding protein RBP...    109   5e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010673626.1|  PREDICTED: polyadenylate-binding protein RBP...    110   5e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004158014.1|  PREDICTED: polyadenylate-binding protein RBP...    108   5e-25   
emb|CDX88893.1|  BnaA03g07560D                                          110   5e-25   
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    110   6e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...    110   6e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    110   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    110   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010479152.1|  PREDICTED: polyadenylate-binding protein RBP...    110   7e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006449040.1|  hypothetical protein CICLE_v10015407mg             108   8e-25   
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    109   8e-25   Glycine max [soybeans]
gb|KJB81761.1|  hypothetical protein B456_013G160200                    110   8e-25   Gossypium raimondii
gb|KJB81764.1|  hypothetical protein B456_013G160200                    110   8e-25   Gossypium raimondii
gb|KJB69303.1|  hypothetical protein B456_011G015300                    109   9e-25   Gossypium raimondii
ref|XP_006594429.1|  PREDICTED: polyadenylate-binding protein RBP...    108   9e-25   Glycine max [soybeans]
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    109   9e-25   Glycine max [soybeans]
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     109   9e-25   
ref|XP_006401514.1|  hypothetical protein EUTSA_v10013710mg             109   1e-24   Eutrema salsugineum [saltwater cress]
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg             109   1e-24   Prunus persica
gb|EYU42664.1|  hypothetical protein MIMGU_mgv1a008163mg                109   1e-24   Erythranthe guttata [common monkey flower]
gb|KJB81762.1|  hypothetical protein B456_013G160200                    108   1e-24   Gossypium raimondii
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                   109   1e-24   Citrus sinensis [apfelsine]
ref|XP_006401513.1|  hypothetical protein EUTSA_v10013710mg             109   1e-24   Eutrema salsugineum [saltwater cress]
gb|KJB69301.1|  hypothetical protein B456_011G015300                    109   1e-24   Gossypium raimondii
gb|KJB21879.1|  hypothetical protein B456_004G019500                    109   1e-24   Gossypium raimondii
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    109   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB21880.1|  hypothetical protein B456_004G019500                    109   1e-24   Gossypium raimondii
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    109   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                   109   1e-24   Citrus sinensis [apfelsine]
gb|KHG00069.1|  Polyadenylate-binding RBP47B' -like protein             109   1e-24   Gossypium arboreum [tree cotton]
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             109   1e-24   Citrus clementina [clementine]
gb|KDO75474.1|  hypothetical protein CISIN_1g015091mg                   108   1e-24   Citrus sinensis [apfelsine]
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    109   1e-24   
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg             108   1e-24   
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    109   1e-24   
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              109   1e-24   
emb|CBI16387.3|  unnamed protein product                                109   1e-24   
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_010448184.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
gb|KFK43438.1|  hypothetical protein AALP_AA1G125300                    108   2e-24   
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             108   2e-24   
gb|KEH36838.1|  polyadenylate-binding protein RBP47B                    107   2e-24   
ref|XP_006283830.1|  hypothetical protein CARUB_v10004931mg             108   2e-24   
ref|XP_010438672.1|  PREDICTED: polyadenylate-binding protein RBP45C    108   2e-24   
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     108   2e-24   
ref|XP_007020874.1|  RNA-binding family protein                         108   2e-24   
gb|KJB13665.1|  hypothetical protein B456_002G088100                    108   2e-24   
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    109   2e-24   
emb|CDY28101.1|  BnaC06g02820D                                          108   2e-24   
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     108   2e-24   
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    109   2e-24   
emb|CDX92304.1|  BnaA05g21030D                                          108   2e-24   
emb|CDY50959.1|  BnaA06g37550D                                          108   2e-24   
ref|XP_009147873.1|  PREDICTED: polyadenylate-binding protein RBP47A    108   2e-24   
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
gb|KJB13666.1|  hypothetical protein B456_002G088100                    108   2e-24   
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein              108   2e-24   
gb|KJB13664.1|  hypothetical protein B456_002G088100                    108   2e-24   
ref|XP_006346222.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
emb|CDY16528.1|  BnaA08g02390D                                          108   2e-24   
emb|CDX99265.1|  BnaC05g33800D                                          108   2e-24   
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45                110   2e-24   
ref|XP_009107272.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    108   2e-24   
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_009109155.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
gb|KDP22083.1|  hypothetical protein JCGZ_25914                         108   2e-24   
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
gb|KDO75475.1|  hypothetical protein CISIN_1g015091mg                   107   2e-24   
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     108   2e-24   
gb|KDP20762.1|  hypothetical protein JCGZ_21233                         108   2e-24   
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    108   2e-24   
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_002518499.1|  nuclear acid binding protein, putative             108   3e-24   
gb|KGN64531.1|  hypothetical protein Csa_1G063550                       108   3e-24   
emb|CDY14290.1|  BnaA08g14210D                                          108   3e-24   
dbj|BAE71244.1|  putative DNA binding protein                           108   3e-24   
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     108   3e-24   
ref|XP_002885294.1|  RNA-binding protein 47B                            108   3e-24   
ref|XP_002313332.2|  hypothetical protein POPTR_0009s05920g             108   3e-24   
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|NP_175383.1|  RNA-binding protein 47A                               108   4e-24   
ref|XP_004164285.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    108   4e-24   
ref|XP_011037672.1|  PREDICTED: polyadenylate-binding protein RBP...    107   4e-24   
ref|XP_011025522.1|  PREDICTED: polyadenylate-binding protein RBP...    108   4e-24   
ref|XP_004244127.1|  PREDICTED: polyadenylate-binding protein RBP45     108   4e-24   
ref|XP_002894197.1|  hypothetical protein ARALYDRAFT_474095             108   4e-24   
gb|KGN50253.1|  hypothetical protein Csa_5G162020                       108   4e-24   
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...    108   4e-24   
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    107   4e-24   
gb|AIN39817.1|  hypothetical protein                                    107   4e-24   
ref|NP_001078604.1|  polyadenylate-binding protein RBP47B'              107   4e-24   
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...    108   4e-24   
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...    108   4e-24   
ref|XP_010500505.1|  PREDICTED: polyadenylate-binding protein RBP...    108   4e-24   
gb|KHG16958.1|  Polyadenylate-binding RBP45B -like protein              108   4e-24   
ref|NP_197436.1|  polyadenylate-binding protein RBP47B'                 107   4e-24   
ref|XP_007015035.1|  RNA-binding family protein isoform 3               107   4e-24   
ref|XP_002871881.1|  hypothetical protein ARALYDRAFT_488820             107   4e-24   
ref|XP_010433418.1|  PREDICTED: polyadenylate-binding protein RBP45C    107   4e-24   
ref|XP_010479396.1|  PREDICTED: polyadenylate-binding protein RBP...    108   4e-24   
ref|XP_007015034.1|  RNA-binding family protein isoform 2               107   4e-24   
gb|KFK26199.1|  hypothetical protein AALP_AA8G215500                    107   4e-24   
ref|XP_002513488.1|  nuclear acid binding protein, putative             107   4e-24   
ref|NP_001168324.1|  hypothetical protein                               107   5e-24   
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
ref|XP_006400492.1|  hypothetical protein EUTSA_v10013617mg             107   5e-24   
ref|XP_010495305.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
gb|KJB32439.1|  hypothetical protein B456_005G240800                    107   5e-24   
ref|XP_010454207.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
ref|XP_010461802.1|  PREDICTED: polyadenylate-binding protein RBP...    108   5e-24   
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
ref|NP_973984.1|  RNA-binding protein 47C                               107   5e-24   
ref|XP_009131734.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
gb|KJB32440.1|  hypothetical protein B456_005G240800                    106   5e-24   
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
ref|XP_011037673.1|  PREDICTED: polyadenylate-binding protein RBP...    106   5e-24   
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
gb|AAG13046.1|AC011807_5  Putative RNA binding protein                  108   5e-24   
ref|XP_010101438.1|  Polyadenylate-binding protein RBP45B               107   6e-24   
gb|KJB32436.1|  hypothetical protein B456_005G240800                    106   6e-24   
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...    107   6e-24   
ref|XP_006406534.1|  hypothetical protein EUTSA_v10020763mg             106   6e-24   
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    107   6e-24   
ref|XP_009118182.1|  PREDICTED: polyadenylate-binding protein RBP...    107   6e-24   
ref|XP_006307520.1|  hypothetical protein CARUB_v10009143mg             107   6e-24   
gb|KJB32437.1|  hypothetical protein B456_005G240800                    107   7e-24   
emb|CDY13992.1|  BnaC09g38340D                                          107   7e-24   
ref|XP_010675694.1|  PREDICTED: polyadenylate-binding protein RBP45     107   7e-24   
gb|KFK36144.1|  hypothetical protein AALP_AA4G083000                    107   7e-24   
ref|XP_009118181.1|  PREDICTED: polyadenylate-binding protein RBP...    107   7e-24   
ref|XP_007150369.1|  hypothetical protein PHAVU_005G147800g             107   7e-24   
gb|AAM67293.1|  nuclear acid binding protein, putative                  107   7e-24   
emb|CDX92537.1|  BnaA10g15760D                                          107   7e-24   
ref|XP_009120895.1|  PREDICTED: polyadenylate-binding protein RBP...    107   7e-24   
ref|XP_009120896.1|  PREDICTED: polyadenylate-binding protein RBP...    107   7e-24   
gb|KEH36837.1|  polyadenylate-binding protein RBP47B                    105   8e-24   
gb|KHN46301.1|  Polyadenylate-binding protein RBP47C                    106   8e-24   
dbj|BAK03410.1|  predicted protein                                      107   8e-24   
ref|NP_188544.1|  RNA-binding protein 47B                               107   8e-24   
gb|KJB32435.1|  hypothetical protein B456_005G240800                    107   8e-24   
ref|XP_002891364.1|  ATRBP47C                                           107   8e-24   
ref|XP_011037671.1|  PREDICTED: polyadenylate-binding protein RBP...    106   8e-24   
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     107   9e-24   
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...    107   9e-24   
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170          107   9e-24   
emb|CDY29263.1|  BnaC01g19150D                                          107   9e-24   
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...    107   9e-24   
dbj|BAB02953.1|  DNA/RNA binding protein-like                           107   9e-24   
gb|KJB32438.1|  hypothetical protein B456_005G240800                    106   9e-24   
gb|KFK31829.1|  hypothetical protein AALP_AA6G163800                    106   1e-23   
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...    107   1e-23   
ref|XP_006850190.1|  hypothetical protein AMTR_s00022p00247520          107   1e-23   
gb|KFK31830.1|  hypothetical protein AALP_AA6G163800                    106   1e-23   
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...    107   1e-23   
ref|XP_002305583.2|  RNA-binding protein 45                             106   1e-23   
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
ref|XP_010494212.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g             106   1e-23   
gb|KJB09397.1|  hypothetical protein B456_001G139100                    106   1e-23   
ref|XP_002979510.1|  hypothetical protein SELMODRAFT_111082             106   1e-23   
dbj|BAD05744.1|  putative RNA Binding Protein 45                        106   1e-23   
ref|XP_002977811.1|  hypothetical protein SELMODRAFT_232989             106   1e-23   
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
gb|KJB09396.1|  hypothetical protein B456_001G139100                    106   1e-23   
ref|XP_010420736.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
ref|XP_010523211.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
gb|KFK29206.1|  hypothetical protein AALP_AA7G103000                    106   2e-23   
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...    106   2e-23   
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...    106   2e-23   
ref|XP_009137630.1|  PREDICTED: polyadenylate-binding protein RBP...    106   2e-23   
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...    106   2e-23   
ref|NP_175180.1|  RNA-binding protein 47C                               106   2e-23   
gb|KJB09398.1|  hypothetical protein B456_001G139100                    105   2e-23   
emb|CDY46671.1|  BnaA03g48370D                                          106   2e-23   
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    105   2e-23   
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg             105   2e-23   
dbj|BAJ87828.1|  predicted protein                                      105   2e-23   
emb|CDX92786.1|  BnaC07g40440D                                          105   2e-23   
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg             106   2e-23   
ref|XP_006393234.1|  hypothetical protein EUTSA_v10011485mg             106   2e-23   
dbj|BAJ85753.1|  predicted protein                                      105   2e-23   
gb|KFK39248.1|  hypothetical protein AALP_AA3G219800                    105   2e-23   
gb|KFK39249.1|  hypothetical protein AALP_AA3G219800                    105   2e-23   
gb|EYU27806.1|  hypothetical protein MIMGU_mgv1a007668mg                105   2e-23   
emb|CDY34835.1|  BnaA09g47610D                                          105   2e-23   
ref|XP_010481964.1|  PREDICTED: polyadenylate-binding protein RBP...    105   2e-23   
gb|EYU33637.1|  hypothetical protein MIMGU_mgv1a007175mg                105   2e-23   
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             105   3e-23   
gb|KJB22074.1|  hypothetical protein B456_004G028000                    105   3e-23   
emb|CDY34639.1|  BnaC08g41980D                                          106   3e-23   
gb|KCW70174.1|  hypothetical protein EUGRSUZ_F03462                     104   3e-23   
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...    105   3e-23   
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570          105   3e-23   
ref|XP_003610417.1|  RNA-binding protein                                105   3e-23   
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    105   3e-23   
ref|XP_002863750.1|  hypothetical protein ARALYDRAFT_331131             105   3e-23   
gb|ACR34003.1|  unknown                                                 105   4e-23   
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    105   4e-23   
ref|NP_001152183.1|  LOC100285821                                       105   4e-23   
ref|XP_003610418.1|  RNA-binding protein                                104   4e-23   
ref|XP_009414748.1|  PREDICTED: polyadenylate-binding protein RBP...    105   4e-23   
emb|CDY32840.1|  BnaC08g02620D                                          105   4e-23   
gb|KHN12758.1|  Polyadenylate-binding protein RBP47C                    104   4e-23   
ref|XP_007026047.1|  RNA-binding family protein                         105   4e-23   
ref|XP_003543537.1|  PREDICTED: polyadenylate-binding protein RBP...    104   5e-23   
gb|KHG22988.1|  Polyadenylate-binding RBP45C -like protein              104   5e-23   
dbj|BAE71189.1|  putative DNA binding protein                           103   5e-23   
gb|ABR18422.1|  unknown                                                 104   5e-23   
ref|XP_003543536.1|  PREDICTED: polyadenylate-binding protein RBP...    104   5e-23   
ref|XP_003597428.1|  RNA-binding protein                                104   5e-23   
ref|XP_004486966.1|  PREDICTED: polyadenylate-binding protein RBP...    104   6e-23   
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    104   6e-23   
ref|XP_009142977.1|  PREDICTED: polyadenylate-binding protein RBP...    104   6e-23   
gb|KFK35996.1|  hypothetical protein AALP_AA4G064500                    105   6e-23   
emb|CBI19566.3|  unnamed protein product                                103   6e-23   
ref|XP_004486967.1|  PREDICTED: polyadenylate-binding protein RBP...    104   7e-23   
ref|NP_567764.1|  polyadenylate-binding protein RBP45C                  104   7e-23   
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...    104   7e-23   
ref|XP_002316998.2|  RNA-binding protein 45                             104   7e-23   
ref|XP_010540323.1|  PREDICTED: polyadenylate-binding protein RBP47B    104   7e-23   
ref|XP_009145104.1|  PREDICTED: polyadenylate-binding protein RBP...    104   7e-23   
emb|CDY19874.1|  BnaC09g31400D                                          104   8e-23   
emb|CDY29341.1|  BnaA05g16080D                                          104   8e-23   
gb|AFK41944.1|  unknown                                                 104   8e-23   
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C    103   9e-23   
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...    103   9e-23   
ref|XP_006297697.1|  hypothetical protein CARUB_v10013726mg             104   9e-23   
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...    103   9e-23   
dbj|BAJ93453.1|  predicted protein                                      103   1e-22   
ref|XP_006297696.1|  hypothetical protein CARUB_v10013726mg             104   1e-22   
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg             103   1e-22   
ref|XP_002867529.1|  hypothetical protein ARALYDRAFT_913848             103   1e-22   
ref|XP_010442131.1|  PREDICTED: polyadenylate-binding protein RBP...    103   1e-22   
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...    103   1e-22   
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...    104   1e-22   
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C    103   1e-22   
emb|CAB36546.1|  putative DNA binding protein                           103   1e-22   



>emb|CDP01376.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 106/132 (80%), Gaps = 8/132 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG--------SNG  399
            MQYPAAA VM H MMPA HYPPHYMPYH H LHHPPP       QQ           SNG
Sbjct  1    MQYPAAAMVMPHHMMPAPHYPPHYMPYHHHHLHHPPPPQPQGPPQQQQQQQGGGGGGSNG  60

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            ENRTIW+GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEF+SHAAAEK 
Sbjct  61   ENRTIWVGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFFSHAAAEKV  120

Query  580  LQSYTCILMPNT  615
            LQ+Y CI+MPNT
Sbjct  121  LQAYPCIIMPNT  132



>ref|XP_011083821.1| PREDICTED: polyadenylate-binding protein RBP47-like [Sesamum 
indicum]
Length=432

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAAA VMQH MM A      Y P++PH   + PP  Q  ++   GGSNGENRTIW+G
Sbjct  42   MQYPAAAMVMQHGMM-AAPQYVPYHPHNPHQYRYHPPPPQQSKKSNVGGSNGENRTIWVG  100

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DL NWMDEDYLRSCFASTGEV+SIKVIRNKQTGFSEGYGFVEF +HAAAEK LQSY+CI 
Sbjct  101  DLRNWMDEDYLRSCFASTGEVSSIKVIRNKQTGFSEGYGFVEFLTHAAAEKVLQSYSCIA  160

Query  604  MPNT  615
            MPNT
Sbjct  161  MPNT  164



>ref|XP_004238180.1| PREDICTED: polyadenylate-binding protein RBP47-like [Solanum 
lycopersicum]
Length=451

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 127/189 (67%), Gaps = 11/189 (6%)
 Frame = +1

Query  61   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  240
            MQ++ G ESQ+NKQPP    P  +A     A+Q     + A    V  AA A  QQ PWV
Sbjct  1    MQSNNGNESQDNKQPP---PPSSQAATSPAAQQG---VSAAAVVPVAAAAPAGAQQQPWV  54

Query  241  pMQYPAAATVMQHQMMPAT-----hypphympyhphflhhppphaqpqqqqqhGGSNGEN  405
             MQYPAAA VMQH MMPA      + P H   +H    H P   +  QQ    G +N EN
Sbjct  55   AMQYPAAAMVMQHPMMPAPHYPPHYMPFHPQHHHHLIHHPPHSPSPHQQGGGGGSNNNEN  114

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            RTIW+GDLHNWMDEDYLRSCFA+T EVASIKVIRNKQTGFSEGYGFVEF++HA+AEK LQ
Sbjct  115  RTIWVGDLHNWMDEDYLRSCFATTNEVASIKVIRNKQTGFSEGYGFVEFFTHASAEKVLQ  174

Query  586  SYTCILMPN  612
            +Y+C+ MPN
Sbjct  175  TYSCMTMPN  183



>gb|KDO84283.1| hypothetical protein CISIN_1g037458mg, partial [Citrus sinensis]
Length=196

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  414
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  36   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  95

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  96   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  155

Query  595  CILMPNT  615
             ILMPNT
Sbjct  156  SILMPNT  162



>ref|XP_009764865.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
sylvestris]
Length=423

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 114/184 (62%), Gaps = 30/184 (16%)
 Frame = +1

Query  61   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  240
            M+T+ GPE+ ENKQP  P  P+  A    +A     VT                 Q PWV
Sbjct  1    METNNGPETPENKQPSPP--PQQAAVSEAEANVVPVVT-----------------QQPWV  41

Query  241  pMQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  420
             MQYPAAA VMQH              Y P+  HH     Q QQQ + GGSN ENRTIW+
Sbjct  42   AMQYPAAAMVMQHPPH-----------YIPYHPHHHHHPPQQQQQNRGGGSNNENRTIWV  90

Query  421  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  600
            GDLHNWMDEDYLR+CFAST EVASIK+IRNK TGF EGYGFVEF SHAAAEK LQ+Y+ +
Sbjct  91   GDLHNWMDEDYLRTCFASTNEVASIKIIRNKHTGFLEGYGFVEFNSHAAAEKVLQTYSSM  150

Query  601  LMPN  612
             MPN
Sbjct  151  TMPN  154



>ref|XP_009605325.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 116/185 (63%), Gaps = 33/185 (18%)
 Frame = +1

Query  61   MQTDKGPESQENKQP-PSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppw  237
            M+T+ GPE+ ENKQP P P++   EAE    A     VT                 Q PW
Sbjct  1    METNNGPETPENKQPSPPPQQAVSEAE----ANVVPVVT-----------------QQPW  39

Query  238  vpMQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIW  417
            V MQYPAAA VMQH              Y P+  HH     Q QQQ + GGSN ENRTIW
Sbjct  40   VAMQYPAAAMVMQHPPH-----------YIPYHPHHHHHPPQQQQQNKGGGSNNENRTIW  88

Query  418  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  597
            +GDLHNWMDEDYLR+CFAST EVASIK+IRNK TGF EGYGFVEF SHAAAEK LQ+Y+ 
Sbjct  89   VGDLHNWMDEDYLRTCFASTNEVASIKIIRNKHTGFLEGYGFVEFNSHAAAEKVLQTYSS  148

Query  598  ILMPN  612
            + MPN
Sbjct  149  MTMPN  153



>ref|XP_003634360.1| PREDICTED: polyadenylate-binding protein RBP47-like [Vitis vinifera]
Length=418

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAAA VMQHQMMP  HYP H++ YH     +   H Q  QQQQ  GSN +NRTIW+G
Sbjct  32   MQYPAAAMVMQHQMMPPQHYPQHFVAYHHQPHQYQHQHQQQHQQQQ--GSNADNRTIWVG  89

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLHNWMDE+YL SCFA+TGE+AS+KVIRNKQTG SEGYGFVEF+SHAAAEK LQ Y  +L
Sbjct  90   DLHNWMDENYLHSCFAATGELASMKVIRNKQTGSSEGYGFVEFFSHAAAEKVLQGYAGVL  149

Query  604  MPNT  615
            MPNT
Sbjct  150  MPNT  153



>ref|XP_006434825.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 ref|XP_006434828.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48065.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48068.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=289

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  414
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  95   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  154

Query  595  CILMPNT  615
             ILMPNT
Sbjct  155  SILMPNT  161



>ref|XP_007222286.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
 gb|EMJ23485.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
Length=438

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  408
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  41   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  100

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIW+GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+
Sbjct  101  TIWVGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQT  160

Query  589  YTCILMPNT  615
            YT ILMPNT
Sbjct  161  YTGILMPNT  169



>ref|XP_008220170.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=442

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  408
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  42   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  101

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIW+GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+
Sbjct  102  TIWVGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQT  161

Query  589  YTCILMPNT  615
            YT ILMPNT
Sbjct  162  YTGILMPNT  170



>ref|XP_008220171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=441

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  408
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  42   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  101

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIW+GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+
Sbjct  102  TIWVGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQT  161

Query  589  YTCILMPNT  615
            YT ILMPNT
Sbjct  162  YTGILMPNT  170



>ref|XP_006434824.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 ref|XP_006434826.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48064.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48066.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=352

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  414
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  95   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  154

Query  595  CILMPNT  615
             ILMPNT
Sbjct  155  SILMPNT  161



>gb|EYU36286.1| hypothetical protein MIMGU_mgv1a005576mg [Erythranthe guttata]
Length=478

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 118/198 (60%), Gaps = 26/198 (13%)
 Frame = +1

Query  55   LKMQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqpp  234
            LKMQTD G ESQ        R    E   + D       + G G   V  AAAA      
Sbjct  111  LKMQTDNGSESQ--------RTSSKENNSNND-------SGGGGNSKVAAAAAAAVPGQQ  155

Query  235  wvpMQYPAAATVMQHQMMPA-----------Thypphympyhphflhhppphaqpqqqqq  381
            WV MQYPAAA VM H M+PA            H+P H+ P  P                 
Sbjct  156  WVAMQYPAAAMVMPHGMIPAPHYASPHYMPYHHHPLHHHPPLPPSPLPQHQSGGGNGNGN  215

Query  382  hGGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
             GGSNGENRTIW+GDLHNWMDEDYL +CFASTGEV+SIK+IRNKQTGFSEGYGF+EF SH
Sbjct  216  GGGSNGENRTIWVGDLHNWMDEDYLGNCFASTGEVSSIKIIRNKQTGFSEGYGFIEFLSH  275

Query  562  AAAEKALQSYTCILMPNT  615
            AAAEK LQS++CI MP+T
Sbjct  276  AAAEKILQSFSCIAMPST  293



>ref|XP_006434827.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48067.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=432

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  414
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  95   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  154

Query  595  CILMPNT  615
             ILMPNT
Sbjct  155  SILMPNT  161



>ref|XP_006473363.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Citrus 
sinensis]
Length=433

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  414
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  36   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  95

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  96   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  155

Query  595  CILMPNT  615
             ILMPNT
Sbjct  156  SILMPNT  162



>ref|XP_008361011.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=443

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphym--pyhphflhhppphaqpqqqqqhGGSNGENRTIW  417
            MQYPAAA VMQHQMMP  HY        ++  +  +         QQQ  GS+GEN+TIW
Sbjct  46   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGENKTIW  105

Query  418  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  597
            +GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+Y  
Sbjct  106  VGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQNYAG  165

Query  598  ILMPNT  615
            ILMPNT
Sbjct  166  ILMPNT  171



>ref|XP_009367486.1| PREDICTED: polyadenylate-binding protein RBP47-like, partial 
[Pyrus x bretschneideri]
Length=410

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphy---mpyhphflhhppphaqpqqqqqhGGSNGENRTI  414
            MQYPAAA VMQHQMMP  HY         Y  +  +    H Q  QQQQ G S GEN+TI
Sbjct  11   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGGENKTI  70

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
            W+GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+Y 
Sbjct  71   WVGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQNYA  130

Query  595  CILMPNT  615
             ILMPNT
Sbjct  131  GILMPNT  137



>ref|XP_008393835.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=444

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphym--pyhphflhhppphaqpqqqqqhGGSNGENRTIW  417
            MQYPAAA VMQHQMMP  HY        ++  +  +         QQQ  GS+GEN+TIW
Sbjct  46   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGENKTIW  105

Query  418  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  597
            +GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+Y  
Sbjct  106  VGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQNYAG  165

Query  598  ILMPNT  615
            ILMPNT
Sbjct  166  ILMPNT  171



>ref|XP_008357395.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Malus domestica]
Length=444

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP----AThypphympyhphflhhppphaqpqqqqqhGGSNGENRT  411
            MQYP  A VMQHQMMP    AT  PP       H           QQQQQ G  +GEN+T
Sbjct  45   MQYPTTAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHIQHLQQQQQLGSGSGENKT  104

Query  412  IWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSY  591
            IW+GDLH+WMDE+YL +CFASTGEVASIK+IRNKQT  SEGYGFVEF+SHA AEK LQ+Y
Sbjct  105  IWVGDLHHWMDENYLHTCFASTGEVASIKLIRNKQTLLSEGYGFVEFFSHATAEKVLQNY  164

Query  592  TCILMPNT  615
              ILMPNT
Sbjct  165  AGILMPNT  172



>ref|XP_003523906.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=409

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAAA VMQH MMP  HY P       H      P A         GS+ EN+T+W+G
Sbjct  32   MQYPAAAMVMQHHMMPPQHYAPPQPYMAYHQYQQQVPQAHHL------GSSAENKTVWVG  85

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSH  A+K LQ+Y  IL
Sbjct  86   DLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHGTADKVLQNYAGIL  145

Query  604  MPNT  615
            MPNT
Sbjct  146  MPNT  149



>ref|XP_003544447.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=425

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP---------AThypphympyhphflhhppphaqpqqqqqhGGSN  396
            MQYPAAA VM H M+P            +  H+   +           Q Q      GS 
Sbjct  34   MQYPAAAMVMPHHMLPPQHYAPPPYVPFHHHHHHHQYAAPHVPNQHQQQQQHHHHQNGSG  93

Query  397  GENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEK  576
            GEN+TIWIGDLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSHA AEK
Sbjct  94   GENKTIWIGDLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHATAEK  153

Query  577  ALQSYTCILMPNT  615
             LQ+Y  ILMPNT
Sbjct  154  VLQNYAGILMPNT  166



>gb|KHN22302.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=411

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAAA VMQH MMP  HY       +  + H+              GS+ EN+T+W+G
Sbjct  30   MQYPAAAMVMQHHMMPPQHYLHAPPQPYMAYHHYQQQLPHALHAHHQ-GSSAENKTVWVG  88

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL  CFAS GE++SIKVIRNKQTG SEGYGFVEFYSH  AEK LQ+Y  IL
Sbjct  89   DLHHWMDENYLHRCFASNGEISSIKVIRNKQTGLSEGYGFVEFYSHGTAEKVLQNYAGIL  148

Query  604  MPNT  615
            MPNT
Sbjct  149  MPNT  152



>ref|XP_006354957.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Solanum 
tuberosum]
Length=438

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 96/128 (75%), Gaps = 5/128 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAT-----hypphympyhphflhhppphaqpqqqqqhGGSNGENR  408
            MQYPAAA VMQH MMP+      + P H   +H    H P   +  QQ    G +N ENR
Sbjct  43   MQYPAAAMVMQHPMMPSPHYPPHYMPFHPQHHHHLIHHPPHSPSPHQQGGGGGSNNNENR  102

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIW+GDLHNWMDEDYLRSCFA+T EVASIKVIRNKQTGFSEGYGFVEF++HA+AEK LQ+
Sbjct  103  TIWVGDLHNWMDEDYLRSCFATTNEVASIKVIRNKQTGFSEGYGFVEFFTHASAEKVLQT  162

Query  589  YTCILMPN  612
            Y+C+ MPN
Sbjct  163  YSCMTMPN  170



>ref|XP_009765294.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
sylvestris]
Length=456

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 130/196 (66%), Gaps = 21/196 (11%)
 Frame = +1

Query  61   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  240
            MQ + G ESQENKQ P P+  +  A +     Q+Q V+ G       V      QQ PWV
Sbjct  1    MQKNNGTESQENKQQPPPQPSQPTASQ----PQQQGVSGGT------VVPVVAAQQQPWV  50

Query  241  pMQYPAAATVMQHQMMPAThypphympyhphflhhppph-----------aqpqqqqqhG  387
             MQYPAAA VMQH MMPA HYPPHYMPYHPH  HH   H            Q      + 
Sbjct  51   AMQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  110

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
             +N ENRTIW+GDL NWMDEDYLR+CFAST EVASIKVIRNKQTGFSEGYGFVEF++HAA
Sbjct  111  NNNNENRTIWVGDLLNWMDEDYLRNCFASTNEVASIKVIRNKQTGFSEGYGFVEFFTHAA  170

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y+C+ MPN 
Sbjct  171  AEKVLQTYSCMTMPNV  186



>emb|CAC69852.1| nucleic acid binding protein [Nicotiana tabacum]
Length=456

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 130/196 (66%), Gaps = 21/196 (11%)
 Frame = +1

Query  61   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  240
            MQ + G ESQENKQ P P+  +  A +     Q+Q V+ G       V      QQ PWV
Sbjct  1    MQKNNGTESQENKQQPPPQPSQPTASQ----PQQQGVSGGT------VVPVVAAQQQPWV  50

Query  241  pMQYPAAATVMQHQMMPAThypphympyhphflhhppph-----------aqpqqqqqhG  387
             MQYPAAA VMQH MMPA HYPPHYMPYHPH  HH   H            Q      + 
Sbjct  51   AMQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  110

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
             +N ENRTIW+GDL NWMDEDYLR+CFAST EVASIKVIRNKQTGFSEGYGFVEF++HAA
Sbjct  111  NNNNENRTIWVGDLLNWMDEDYLRNCFASTNEVASIKVIRNKQTGFSEGYGFVEFFTHAA  170

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y+C+ MPN 
Sbjct  171  AEKVLQTYSCMTMPNV  186



>ref|XP_007136663.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
 gb|ESW08657.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
Length=420

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqq-qqqhGGSNGENRTIWI  420
            MQYPAAA VMQH MMP  HY     P  P+  +H      P      H GS+ EN+T+W+
Sbjct  37   MQYPAAAMVMQHHMMPPQHYAAPPPPPQPYVAYHQYQQQLPHVPHAHHQGSSAENKTVWV  96

Query  421  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  600
            GDLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSH  AEK LQ+Y  I
Sbjct  97   GDLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHGTAEKVLQNYAGI  156

Query  601  LMPNT  615
            LMPNT
Sbjct  157  LMPNT  161



>ref|XP_003528246.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Glycine 
max]
Length=410

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAAA VMQH MMP  HY P     +  + H+              GS+ EN+T+W+G
Sbjct  25   MQYPAAAMVMQHHMMPPQHYAPPPPQPYMAYHHYQQQLPHALHAHHQ-GSSAENKTVWVG  83

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL  CFAS GE++SIKVIRNKQTG SEGYGFVEFYSH  AEK LQ+Y  IL
Sbjct  84   DLHHWMDENYLHRCFASNGEISSIKVIRNKQTGLSEGYGFVEFYSHGTAEKVLQNYAGIL  143

Query  604  MPNT  615
            MPNT
Sbjct  144  MPNT  147



>ref|XP_009629702.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=456

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 128/197 (65%), Gaps = 23/197 (12%)
 Frame = +1

Query  61   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  240
            MQ + G ESQENKQPP        ++      Q+Q V+ G       +      QQ PWV
Sbjct  1    MQKNNGTESQENKQPPPQPSQPTASQP-----QQQGVSGGT------IVPVVAAQQQPWV  49

Query  241  pMQYPAAATVMQHQMMPAThypphympyhphflhhppp------------haqpqqqqqh  384
            PMQYPAAA VMQH MMPA HYPPHYMPYHPH  HH                 Q      +
Sbjct  50   PMQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  109

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
              +N ENRTIW+GDL NWMDEDYLR+CFAST EVASIKVIRNKQTGFSEGYGFVEF++HA
Sbjct  110  NNNNNENRTIWVGDLLNWMDEDYLRNCFASTNEVASIKVIRNKQTGFSEGYGFVEFFTHA  169

Query  565  AAEKALQSYTCILMPNT  615
            AAEK LQ+Y+C+ MPN 
Sbjct  170  AAEKVLQTYSCMTMPNV  186



>gb|KJB59840.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
 gb|KJB59841.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
Length=419

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAAA VMQHQMM    +         H++ +   H     QQ  GG +GEN+T+W+G
Sbjct  32   MQYPAAAMVMQHQMM-QPQHFVASPLPPQHYMPYHHLHLNGHAQQGSGGGSGENKTVWVG  90

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DL++WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK LQSY+ IL
Sbjct  91   DLYHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQSYSSIL  150

Query  604  MPNT  615
            MPNT
Sbjct  151  MPNT  154



>ref|XP_003549410.2| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=413

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 88/124 (71%), Gaps = 7/124 (6%)
 Frame = +1

Query  244  MQYPAAAT-VMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  420
            MQYPAAA  VM H M+P            P ++ +   +A   Q Q   GS GEN+TIWI
Sbjct  36   MQYPAAAAMVMPHHMLPP------QHYAPPPYVPYHHQYAAQPQHQHQNGSGGENKTIWI  89

Query  421  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  600
            GDLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSHA AEK LQ+Y  I
Sbjct  90   GDLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHATAEKVLQNYAGI  149

Query  601  LMPN  612
            LMPN
Sbjct  150  LMPN  153



>ref|XP_009370172.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Pyrus x bretschneideri]
Length=440

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP----AThypphympyhphflhhppphaqpqqqqqhGGSNGENRT  411
            MQYP AA VMQHQMMP    AT  PP       H           QQQQ   GS GEN+T
Sbjct  42   MQYPTAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSGS-GENKT  100

Query  412  IWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSY  591
            IW+GDLH+WMDE YL +CFASTGE+ASIK+IRNKQT  SEGYGFVEF+SHA AE  LQ+Y
Sbjct  101  IWVGDLHHWMDESYLHTCFASTGEIASIKLIRNKQTLLSEGYGFVEFFSHATAENVLQNY  160

Query  592  TCILMPNT  615
              ILMPNT
Sbjct  161  AGILMPNT  168



>ref|XP_009370171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Pyrus x bretschneideri]
Length=441

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP----AThypphympyhphflhhppphaqpqqqqqhGGSNGENRT  411
            MQYP AA VMQHQMMP    AT  PP       H           QQQQ   GS GEN+T
Sbjct  42   MQYPTAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSGS-GENKT  100

Query  412  IWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSY  591
            IW+GDLH+WMDE YL +CFASTGE+ASIK+IRNKQT  SEGYGFVEF+SHA AE  LQ+Y
Sbjct  101  IWVGDLHHWMDESYLHTCFASTGEIASIKLIRNKQTLLSEGYGFVEFFSHATAENVLQNY  160

Query  592  TCILMPNT  615
              ILMPNT
Sbjct  161  AGILMPNT  168



>ref|XP_002510266.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF52453.1| nuclear acid binding protein, putative [Ricinus communis]
Length=443

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 9/133 (7%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSN---------  396
            MQYPAAA VMQHQM+P  HY P    ++    H    H     Q Q    N         
Sbjct  46   MQYPAAAMVMQHQMLPPQHYAPPPPQHYMTAYHQYHHHHPHPHQPQQHHQNQGSSGGGGG  105

Query  397  GENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEK  576
            GENRT+WIGDLH+WMDE+YL +CFASTGE+ SIKVIRNKQTG SEGYGFVEFY+HA AEK
Sbjct  106  GENRTVWIGDLHHWMDENYLHTCFASTGEIVSIKVIRNKQTGLSEGYGFVEFYTHATAEK  165

Query  577  ALQSYTCILMPNT  615
             LQ+Y  ILMPNT
Sbjct  166  VLQNYAGILMPNT  178



>gb|KJB58433.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=385

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 94/131 (72%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSN--G  399
            MQYP  A VMQHQMM           P HYMPYH H   +   H   Q  QQ  GSN  G
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHAQQQQGSNDGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDLH+WMDE+YL SCFAS GE++SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTIWVGDLHHWMDENYLHSCFASIGEISSIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y+ ILMPN
Sbjct  156  LQNYSGILMPN  166



>ref|XP_007017334.1| RNA-binding protein 47C isoform 6 [Theobroma cacao]
 gb|EOY14559.1| RNA-binding protein 47C isoform 6 [Theobroma cacao]
Length=306

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y  ILMPN
Sbjct  156  LQNYGGILMPN  166



>gb|KEH40057.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=309

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  408
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            T+WIGDLH+WMDE YL  CFASTGE+ S+KVIRNK +G SEGYGF EF+SHA AEK LQ+
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTGEITSVKVIRNKHSGISEGYGFAEFFSHATAEKVLQN  157

Query  589  YTCILMPN  612
            Y  ILMPN
Sbjct  158  YAGILMPN  165



>gb|KHG01821.1| Polyadenylate-binding RBP47C -like protein [Gossypium arboreum]
Length=385

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAAA VMQHQMM    +         H++ +   H     QQ  GG +GEN+T+W+G
Sbjct  32   MQYPAAAMVMQHQMM-QPQHFVAPPLPPQHYMPYHHLHLNGHAQQGSGGGSGENKTVWVG  90

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DL++WMDE+YL SCFASTGE+ASIKVIRNKQTG  EGYGFVEF+SHA AEK LQSY+ +L
Sbjct  91   DLYHWMDENYLHSCFASTGEIASIKVIRNKQTGLPEGYGFVEFFSHATAEKVLQSYSSVL  150

Query  604  MPNT  615
            MPNT
Sbjct  151  MPNT  154



>ref|XP_007160823.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
 gb|ESW32817.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
Length=415

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYP A  VM H M+P       +        HH          Q   GS+GEN+T+WIG
Sbjct  39   MQYPTA-MVMPHHMLPP-----QHYAPPYVPFHHHQYAPPHVPHQHQNGSSGENKTVWIG  92

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSHA AEK LQ+Y  IL
Sbjct  93   DLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHATAEKVLQNYAGIL  152

Query  604  MPNT  615
            MPNT
Sbjct  153  MPNT  156



>ref|XP_007017333.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
 gb|EOY14558.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
Length=380

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y  ILMPN
Sbjct  156  LQNYGGILMPN  166



>gb|KDP38389.1| hypothetical protein JCGZ_04314 [Jatropha curcas]
Length=437

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 95/129 (74%), Gaps = 5/129 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypph-----ympyhphflhhppphaqpqqqqqhGGSNGENR  408
            MQYPAAA VMQHQM+P  HY P         YH +  HHP     PQQ       + EN+
Sbjct  42   MQYPAAAMVMQHQMIPPQHYAPPPPQHYMAAYHQYHHHHPHLQHTPQQHHHQNQGSSENK  101

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            T+WIGDLH+WMDE+YL +CFASTGE+AS+KVIRNKQTG SEGYGFVEF++HA AEK LQ+
Sbjct  102  TVWIGDLHHWMDENYLHTCFASTGEIASLKVIRNKQTGLSEGYGFVEFFTHATAEKVLQN  161

Query  589  YTCILMPNT  615
            Y+ ILMPNT
Sbjct  162  YSGILMPNT  170



>gb|KJB58432.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=432

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 94/131 (72%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSN--G  399
            MQYP  A VMQHQMM           P HYMPYH H   +   H   Q  QQ  GSN  G
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHAQQQQGSNDGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDLH+WMDE+YL SCFAS GE++SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTIWVGDLHHWMDENYLHSCFASIGEISSIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y+ ILMPN
Sbjct  156  LQNYSGILMPN  166



>ref|XP_007017332.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
 gb|EOY14557.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
Length=387

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y  ILMPN
Sbjct  156  LQNYGGILMPN  166



>ref|XP_008444645.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=429

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhp--pphaqpqqqqqhGGSNGENRTIW  417
            MQYPAAA +MQH MMP  HY P   P++  +  +P        Q QQ H GS  EN+TIW
Sbjct  36   MQYPAAAMIMQHPMMPPQHYVPPPSPHYIPYRQYPPPHQLNGQQHQQPHQGSTSENKTIW  95

Query  418  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  597
            +GDL +WMDE+YL SCFASTGE++S+KVIRNKQTG SEGYGFVEF+SH  AEK LQ+Y+ 
Sbjct  96   VGDLQHWMDENYLHSCFASTGEISSLKVIRNKQTGISEGYGFVEFFSHTTAEKVLQNYSS  155

Query  598  ILMPNT  615
            ILMPNT
Sbjct  156  ILMPNT  161



>ref|XP_004152729.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160013.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 gb|KGN62542.1| hypothetical protein Csa_2G360590 [Cucumis sativus]
Length=429

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhp--pphaqpqqqqqhGGSNGENRTIW  417
            MQYPAAA +MQH MMP  HY P   P++  +  +P        Q QQ H GS  EN+TIW
Sbjct  36   MQYPAAAMIMQHPMMPPQHYVPPPSPHYIPYRQYPPPHQLNGQQHQQPHQGSTSENKTIW  95

Query  418  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  597
            +GDL +WMDE+YL SCFASTGE++S+KVIRNKQTG SEGYGFVEF+SH  AEK LQ+Y+ 
Sbjct  96   VGDLQHWMDENYLHSCFASTGEISSLKVIRNKQTGISEGYGFVEFFSHTTAEKVLQNYSS  155

Query  598  ILMPNT  615
            ILMPNT
Sbjct  156  ILMPNT  161



>gb|KHN04518.1| Polyadenylate-binding protein RBP47C, partial [Glycine soja]
Length=376

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = +1

Query  253  PAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDLH  432
            PAAA VMQH MMP  HY P       H                  GS+ EN+T+W+GDLH
Sbjct  1    PAAAMVMQHHMMPPQHYAPPQPYMAYHQYQQQQVPQAHHL-----GSSAENKTVWVGDLH  55

Query  433  NWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCILMPN  612
            +WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSH  A+K LQ+Y  ILMPN
Sbjct  56   HWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHGTADKVLQNYAGILMPN  115

Query  613  T  615
            T
Sbjct  116  T  116



>ref|XP_007017335.1| RNA-binding protein 47C isoform 7 [Theobroma cacao]
 gb|EOY14560.1| RNA-binding protein 47C isoform 7 [Theobroma cacao]
Length=339

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y  ILMPN
Sbjct  156  LQNYGGILMPN  166



>ref|XP_007017330.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
 gb|EOY14555.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
Length=394

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y  ILMPN
Sbjct  156  LQNYGGILMPN  166



>gb|KJB63806.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=343

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 95/132 (72%), Gaps = 8/132 (6%)
 Frame = +1

Query  244  MQYP---AAATVMQHQMM-----PAThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  32   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHHGHALSQQQQQGSGGGG  91

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  92   ENKTVWVGDLHHWMDENYLHSCFASTGEIVSIKVIRNKQTGLSEGYGFVEFFSHAMAEKV  151

Query  580  LQSYTCILMPNT  615
            LQ+Y+ +LMPNT
Sbjct  152  LQNYSGMLMPNT  163



>ref|XP_007017329.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
 gb|EOY14554.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
Length=435

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y  ILMPN
Sbjct  156  LQNYGGILMPN  166



>ref|XP_007017331.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
 gb|EOY14556.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
Length=436

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y  ILMPN
Sbjct  156  LQNYGGILMPN  166



>gb|KEH40058.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=425

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  408
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            T+WIGDLH+WMDE YL  CFASTGE+ S+KVIRNK +G SEGYGF EF+SHA AEK LQ+
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTGEITSVKVIRNKHSGISEGYGFAEFFSHATAEKVLQN  157

Query  589  YTCILMPN  612
            Y  ILMPN
Sbjct  158  YAGILMPN  165



>gb|AFK35123.1| unknown [Medicago truncatula]
Length=425

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  408
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            T+WIGDLH+WMDE YL  CFASTGE+ S+KVIRNK +G SEGYGF EF+SHA AEK LQ+
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTGEITSVKVIRNKHSGISEGYGFAEFFSHATAEKVLQN  157

Query  589  YTCILMPN  612
            Y  ILMPN
Sbjct  158  YAGILMPN  165



>gb|KHG24367.1| Polyadenylate-binding RBP47 [Gossypium arboreum]
Length=382

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 90/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM-------PAThypphympyhphflhhppphaqpqqqqqhGGSNG-  399
            MQYP  A VMQHQMM       P      +   +H H  +          QQQ G ++G 
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHTQQQQGSNDGC  95

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFAS GE++SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASIGEISSIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  580  LQSYTCILMPN  612
            LQ+Y+ ILMPN
Sbjct  156  LQNYSGILMPN  166



>gb|EYU25396.1| hypothetical protein MIMGU_mgv1a006186mg [Erythranthe guttata]
Length=454

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            G  NGENRTIW+GDLHNWMDE YLR+CF STGEV+SIK+IRNKQTG +EGYGFVEF +HA
Sbjct  108  GNGNGENRTIWVGDLHNWMDEQYLRTCFDSTGEVSSIKLIRNKQTGSTEGYGFVEFSTHA  167

Query  565  AAEKALQSYTCILMPNT  615
            AAEK LQSY+C+ MP+T
Sbjct  168  AAEKVLQSYSCMAMPST  184



>ref|XP_010275609.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nelumbo nucifera]
Length=418

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAA  VMQHQMMP      +   Y P+  H    H Q QQQQQ  GS  +N+TIW+G
Sbjct  26   MQYPAATMVMQHQMMP----QHYPAHYMPYHHHQQQQHTQQQQQQQQQGSMEDNKTIWVG  81

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH WMDE YL SCFA TGEV SIKVIRNKQTG SEGYGFVEF+SHAAAEK LQ+Y    
Sbjct  82   DLHYWMDESYLHSCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLQNYNGTA  141

Query  604  MPNT  615
            MPNT
Sbjct  142  MPNT  145



>ref|XP_010275610.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nelumbo nucifera]
Length=413

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAA  VMQHQMMP      +   Y P+  H    H Q QQQQQ  GS  +N+TIW+G
Sbjct  26   MQYPAATMVMQHQMMP----QHYPAHYMPYHHHQQQQHTQQQQQQQQQGSMEDNKTIWVG  81

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH WMDE YL SCFA TGEV SIKVIRNKQTG SEGYGFVEF+SHAAAEK LQ+Y    
Sbjct  82   DLHYWMDESYLHSCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLQNYNGTA  141

Query  604  MPNT  615
            MPNT
Sbjct  142  MPNT  145



>gb|KJB63805.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=431

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 95/132 (72%), Gaps = 8/132 (6%)
 Frame = +1

Query  244  MQYP---AAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  32   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHHGHALSQQQQQGSGGGG  91

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  92   ENKTVWVGDLHHWMDENYLHSCFASTGEIVSIKVIRNKQTGLSEGYGFVEFFSHAMAEKV  151

Query  580  LQSYTCILMPNT  615
            LQ+Y+ +LMPNT
Sbjct  152  LQNYSGMLMPNT  163



>gb|KCW68769.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=428

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  394  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  573
            NGENRT+W+GDLH+WMDE+YL SCF STGE+ASIKVIRNKQTG SEGYGFVEF++H  AE
Sbjct  109  NGENRTVWVGDLHHWMDENYLHSCFVSTGEIASIKVIRNKQTGLSEGYGFVEFFTHGTAE  168

Query  574  KALQSYTCILMPNT  615
            K LQ+Y+ I+MPNT
Sbjct  169  KVLQNYSGIMMPNT  182



>ref|XP_004499084.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=426

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP---AThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  414
            MQYP A  VM H MMP       P    P+H  +          Q   Q  GSNGEN+T+
Sbjct  42   MQYPTA-MVMPHHMMPPQHYAPPPYVPYPHHHQYQQPLHVPHHHQHHHQQHGSNGENKTL  100

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
            WIGDLHNWMDE+YL  CFASTGE++SIKVIRNK  G SEGYGFVEF+SHA A+K LQ+Y 
Sbjct  101  WIGDLHNWMDENYLHRCFASTGEISSIKVIRNKHNGISEGYGFVEFFSHATADKVLQNYA  160

Query  595  CILMPN  612
             ILMPN
Sbjct  161  GILMPN  166



>ref|XP_011013053.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS+G+N+TIWIGDLH+WMDE+YL +CFASTGE+ASIKVIR+KQTG SEGYGFVEF++HA 
Sbjct  88   GSSGDNKTIWIGDLHHWMDENYLHTCFASTGEIASIKVIRSKQTGLSEGYGFVEFFTHAT  147

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y  ILMPNT
Sbjct  148  AEKVLQNYGGILMPNT  163



>ref|XP_011017227.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS+G+N+TIWIGDLH+WMDE+YL +CFASTGE+ASIKVIR+KQTG SEGYGFVEF++HA 
Sbjct  88   GSSGDNKTIWIGDLHHWMDENYLHTCFASTGEIASIKVIRSKQTGLSEGYGFVEFFTHAT  147

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y  ILMPNT
Sbjct  148  AEKVLQNYGGILMPNT  163



>gb|KCW68770.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=399

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  394  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  573
            NGENRT+W+GDLH+WMDE+YL SCF STGE+ASIKVIRNKQTG SEGYGFVEF++H  AE
Sbjct  56   NGENRTVWVGDLHHWMDENYLHSCFVSTGEIASIKVIRNKQTGLSEGYGFVEFFTHGTAE  115

Query  574  KALQSYTCILMPNT  615
            K LQ+Y+ I+MPNT
Sbjct  116  KVLQNYSGIMMPNT  129



>ref|XP_011030480.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Populus euphratica]
Length=427

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 91/129 (71%), Gaps = 7/129 (5%)
 Frame = +1

Query  250  YPAAATVMQHQMMPAThypphympyhphflhhppph-------aqpqqqqqhGGSNGENR  408
            YPAAA VMQHQ++P  HY P    ++    +H            Q   Q+Q    +GEN+
Sbjct  33   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  92

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIWIGDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF +HA AEK LQ+
Sbjct  93   TIWIGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFLTHATAEKVLQN  152

Query  589  YTCILMPNT  615
            Y  ILMPNT
Sbjct  153  YGGILMPNT  161



>ref|XP_011030472.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Populus euphratica]
Length=428

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 91/129 (71%), Gaps = 7/129 (5%)
 Frame = +1

Query  250  YPAAATVMQHQMMPAThypphympyhphflhhppph-------aqpqqqqqhGGSNGENR  408
            YPAAA VMQHQ++P  HY P    ++    +H            Q   Q+Q    +GEN+
Sbjct  34   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  93

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIWIGDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF +HA AEK LQ+
Sbjct  94   TIWIGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFLTHATAEKVLQN  153

Query  589  YTCILMPNT  615
            Y  ILMPNT
Sbjct  154  YGGILMPNT  162



>ref|XP_011030463.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Populus euphratica]
Length=428

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 91/129 (71%), Gaps = 7/129 (5%)
 Frame = +1

Query  250  YPAAATVMQHQMMPAThypphympyhphflhhppph-------aqpqqqqqhGGSNGENR  408
            YPAAA VMQHQ++P  HY P    ++    +H            Q   Q+Q    +GEN+
Sbjct  34   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  93

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIWIGDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF +HA AEK LQ+
Sbjct  94   TIWIGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFLTHATAEKVLQN  153

Query  589  YTCILMPNT  615
            Y  ILMPNT
Sbjct  154  YGGILMPNT  162



>ref|XP_010061775.1| PREDICTED: polyadenylate-binding protein RBP47-like [Eucalyptus 
grandis]
 gb|KCW68768.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=452

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  394  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  573
            NGENRT+W+GDLH+WMDE+YL SCF STGE+ASIKVIRNKQTG SEGYGFVEF++H  AE
Sbjct  109  NGENRTVWVGDLHHWMDENYLHSCFVSTGEIASIKVIRNKQTGLSEGYGFVEFFTHGTAE  168

Query  574  KALQSYTCILMPNT  615
            K LQ+Y+ I+MPNT
Sbjct  169  KVLQNYSGIMMPNT  182



>gb|KHG27259.1| Polyadenylate-binding RBP47 [Gossypium arboreum]
Length=384

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 94/132 (71%), Gaps = 8/132 (6%)
 Frame = +1

Query  244  MQYP---AAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNG  399
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  33   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHQGHAPSQQQQQGSGGGG  92

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  93   ENKTVWVGDLHHWMDENYLHSCFASTGEIVSIKVIRNKQTGLSEGYGFVEFFSHATAEKV  152

Query  580  LQSYTCILMPNT  615
            LQ+Y+ + MPNT
Sbjct  153  LQNYSGMFMPNT  164



>ref|XP_010525621.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Tarenaya 
hassleriana]
Length=434

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 85/123 (69%), Gaps = 4/123 (3%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            M+YP AA VM HQMM    +       +  +  + P H Q +  +   GSNGEN+TIWIG
Sbjct  53   MRYPPAAAVMPHQMM----FAAAAAAPYSPYHQYQPHHYQSRGNKHFNGSNGENKTIWIG  108

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL SCFAS GE++S+KVIRNK TG SEGYGFVEF SH  AEK LQ+Y  + 
Sbjct  109  DLHHWMDENYLNSCFASAGEISSVKVIRNKHTGLSEGYGFVEFLSHEIAEKVLQNYNGVA  168

Query  604  MPN  612
            MPN
Sbjct  169  MPN  171



>ref|XP_004291135.1| PREDICTED: polyadenylate-binding protein RBP47-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 85/133 (64%), Gaps = 9/133 (7%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAT---------hypphympyhphflhhppphaqpqqqqqhGGSN  396
            MQYPAAA VMQHQMMP                Y       L               GG +
Sbjct  44   MQYPAAAMVMQHQMMPPQHYAPPPPHYMAYHQYQQQPQQHLQQQQQPQMGSGGGGGGGGS  103

Query  397  GENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEK  576
            GEN+TIW+GDLH+WMDE+YL +CFAS GE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK
Sbjct  104  GENKTIWVGDLHHWMDENYLHNCFASAGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEK  163

Query  577  ALQSYTCILMPNT  615
             +Q+Y  ILMPNT
Sbjct  164  VIQNYAAILMPNT  176



>ref|XP_006374988.1| RNA-binding protein 47 [Populus trichocarpa]
 gb|ERP52785.1| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  394  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  573
            +GEN+TIWIGDLH+WMDE+YL SCF STGE+ASIKVIRNKQTG SEGYGFVEF +HA AE
Sbjct  89   SGENKTIWIGDLHHWMDENYLHSCFVSTGEIASIKVIRNKQTGLSEGYGFVEFLTHATAE  148

Query  574  KALQSYTCILMPNT  615
            K LQ+Y  ILMPNT
Sbjct  149  KVLQNYGGILMPNT  162



>ref|XP_010098709.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
 gb|EXB75612.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
Length=423

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphymp-------yhphflhhppphaqpqqqqqhGGSNGE  402
            MQYPA A VMQHQMMP   +  HY             + H      Q QQQQ   G   +
Sbjct  29   MQYPATAMVMQHQMMPPPPHHQHYAAPPPPQHYMAAAYHHPYHHGHQQQQQQTGSGGGAD  88

Query  403  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  582
            N+T+W+GDLH+WMDE+YL SCFA+TGE+ASIK+IRNKQTG SEGYGFVEF+SHA A+  L
Sbjct  89   NKTLWVGDLHHWMDENYLHSCFANTGEIASIKIIRNKQTGLSEGYGFVEFFSHATADTVL  148

Query  583  QSYTCILMPN  612
            QSY+ + MPN
Sbjct  149  QSYSAMPMPN  158



>gb|EPS64859.1| nucleic acid binding protein, partial [Genlisea aurea]
Length=377

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 93/130 (72%), Gaps = 6/130 (5%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMP------AThypphympyhphflhhppphaqpqqqqqhGGSNGEN  405
            MQYP AA VMQH MMP         YP H++ +H      PPP  Q       GGS+G+N
Sbjct  8    MQYPTAAVVMQHGMMPHYAPPHYIPYPLHHIHHHLPSSPAPPPQQQVGSSNNGGGSSGDN  67

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            RT+W+GDL+NWMDEDYLR+CF ST  V S+KVIRNKQTGFSEGYGFVEF SHA AEK L+
Sbjct  68   RTLWVGDLYNWMDEDYLRNCFDSTRGVTSVKVIRNKQTGFSEGYGFVEFSSHATAEKVLK  127

Query  586  SYTCILMPNT  615
            SY+ I+MPN+
Sbjct  128  SYSSIVMPNS  137



>gb|AGV54251.1| RNA binding post-transcriptional regulator csx1 like protein 
[Phaseolus vulgaris]
Length=416

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 85/122 (70%), Gaps = 5/122 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYP A  VM H M+P      HY P +  F HH         QQ   GS+GEN+T+WIG
Sbjct  39   MQYPTA-MVMPHHMLPP----QHYAPPYVPFHHHQYAPPHVPHQQHQNGSSGENKTVWIG  93

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSHA AEK LQ Y  IL
Sbjct  94   DLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHATAEKILQKYAGIL  153

Query  604  MP  609
             P
Sbjct  154  RP  155



>ref|XP_010268853.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nelumbo 
nucifera]
Length=408

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 79/124 (64%), Gaps = 10/124 (8%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAA  VMQHQMMP  +  P+   +H                        EN+TIW+G
Sbjct  26   MQYPAATLVMQHQMMPQHYPQPYMPYHHHQQQPQSQQQGSSD----------ENKTIWVG  75

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH WMDE YL +CFA TGEV SIKVIRNKQTG SEGYGFVEF+SHAAAEK L +Y    
Sbjct  76   DLHYWMDESYLHNCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLHNYNGTA  135

Query  604  MPNT  615
            MPNT
Sbjct  136  MPNT  139



>ref|XP_002302445.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE81718.2| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +1

Query  250  YPAAATVMQHQ-----MMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  414
            YPAAA VMQH       +P   +      YH +  HH  PH Q QQQQQ  GS+G+N+TI
Sbjct  39   YPAAAMVMQHMPPQHYGLPPPQHYMAATAYHQYQHHHHLPHVQQQQQQQREGSSGDNKTI  98

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
             IGDLH+WMDE+YL +CFASTGE+ASIKVIR+KQTG SEGYGFVEF++HA AEK LQ+Y 
Sbjct  99   CIGDLHHWMDENYLHTCFASTGEIASIKVIRSKQTGLSEGYGFVEFFTHATAEKVLQNYG  158

Query  595  CILMPNT  615
             ILMPNT
Sbjct  159  GILMPNT  165



>ref|XP_010268845.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nelumbo 
nucifera]
Length=413

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 79/124 (64%), Gaps = 10/124 (8%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAA  VMQHQMMP  +  P+   +H                        EN+TIW+G
Sbjct  26   MQYPAATLVMQHQMMPQHYPQPYMPYHHHQQQPQSQQQGSSD----------ENKTIWVG  75

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH WMDE YL +CFA TGEV SIKVIRNKQTG SEGYGFVEF+SHAAAEK L +Y    
Sbjct  76   DLHYWMDESYLHNCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLHNYNGTA  135

Query  604  MPNT  615
            MPNT
Sbjct  136  MPNT  139



>ref|XP_004501589.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=413

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 87/124 (70%), Gaps = 5/124 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYPAAA VMQH M+P  HY P    ++  + H+        Q+     S+ +N+TIW+G
Sbjct  35   MQYPAAAMVMQHHMLPPQHYAPPSPHHYIPYHHYQHQITHVHQR-----SSADNKTIWVG  89

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL  CFAST E+ SIKVIRNK TG SEGYGFVEF+SH  AEK LQ++  +L
Sbjct  90   DLHHWMDENYLHCCFASTAEIFSIKVIRNKHTGQSEGYGFVEFHSHGTAEKVLQNFAGVL  149

Query  604  MPNT  615
            MPNT
Sbjct  150  MPNT  153



>ref|XP_010668311.1| PREDICTED: polyadenylate-binding protein RBP47-like [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS+GEN+TIW+GDLH+WMDE YL SCF S GE+ S+KVIRNKQTG SEGYGFVEF++HA 
Sbjct  136  GSSGENKTIWVGDLHHWMDEIYLSSCFGSAGEIVSVKVIRNKQTGASEGYGFVEFFTHAI  195

Query  568  AEKALQSYTCILMPN  612
            AEK LQSYT ++MPN
Sbjct  196  AEKVLQSYTGLMMPN  210



>ref|XP_008813039.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Phoenix dactylifera]
Length=350

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = +1

Query  244  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  420
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  421  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  600
            GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK LQ++   
Sbjct  81   GDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVLQNFVGH  140

Query  601  LMPNT  615
            +MPNT
Sbjct  141  IMPNT  145



>ref|XP_008813037.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=355

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = +1

Query  244  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  420
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  421  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  600
            GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK LQ++   
Sbjct  81   GDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVLQNFVGH  140

Query  601  LMPNT  615
            +MPNT
Sbjct  141  IMPNT  145



>ref|XP_010647773.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Vitis vinifera]
Length=414

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 85/122 (70%), Gaps = 6/122 (5%)
 Frame = +1

Query  250  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDL  429
            YPAAA VMQHQMM   HY P++ P  P    + PP  Q        GS  E +T+W+GDL
Sbjct  35   YPAAAMVMQHQMMYPQHYMPYHHPQPPQQYQNQPPQHQMH------GSTDEIKTLWVGDL  88

Query  430  HNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCILMP  609
            H WMD++YLR+CF  TGEV+SIK+IRNKQTG SEGYGFVEF+S A AEK L SY   LMP
Sbjct  89   HQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRATAEKILHSYNGTLMP  148

Query  610  NT  615
            NT
Sbjct  149  NT  150



>gb|KEH35744.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=300

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYP AA VM H M+     PP + P  PH       +        HG S  +N+T+W+G
Sbjct  44   MQYPPAAMVMPHHML-----PPQHYPPPPHHYMAYHHYLHHVPHVHHGSSAADNKTLWVG  98

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL  CFASTGE+ SIKVIRNKQT  +EGYGFVEF SH  AEK LQ+Y  +L
Sbjct  99   DLHHWMDENYLHRCFASTGEIFSIKVIRNKQTCQTEGYGFVEFTSHGTAEKVLQTYAGML  158

Query  604  MPNT  615
            MPNT
Sbjct  159  MPNT  162



>ref|XP_010907889.1| PREDICTED: polyadenylate-binding protein RBP47 [Elaeis guineensis]
Length=402

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = +1

Query  244  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  420
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  25   MQYPPAAAMVMPHQMVAAVPPPPPPQYAQHFLPYHQPPPPQHHQHQAGAAGGEENKTIWV  84

Query  421  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  600
            GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK LQS+   
Sbjct  85   GDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVLQSFAGH  144

Query  601  LMPNT  615
            +MPNT
Sbjct  145  IMPNT  149



>ref|XP_008813036.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=398

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = +1

Query  244  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  420
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  421  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  600
            GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK LQ++   
Sbjct  81   GDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVLQNFVGH  140

Query  601  LMPNT  615
            +MPNT
Sbjct  141  IMPNT  145



>ref|XP_008452518.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=426

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  EN+TIW+GDLH+WMDE YL SCF+S GE++S+KVIRNKQTG SEGYGFVEF SHA 
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVGEISSMKVIRNKQTGLSEGYGFVEFLSHAT  137

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y+ + MP+T
Sbjct  138  AEKVLQNYSGMFMPST  153



>gb|KGN55171.1| hypothetical protein Csa_4G639100 [Cucumis sativus]
Length=366

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  EN+TIW+GDLH+WMDE YL SCF+S GE++S+KVIRNKQTG SEGYGFVEF SH  
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVGEISSMKVIRNKQTGLSEGYGFVEFLSHTT  137

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y+ + MP+T
Sbjct  138  AEKVLQNYSGMFMPST  153



>ref|XP_003603009.1| RNA-binding protein [Medicago truncatula]
 gb|AES73260.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=420

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            MQYP AA VM H M+     PP + P  PH       +        HG S  +N+T+W+G
Sbjct  44   MQYPPAAMVMPHHML-----PPQHYPPPPHHYMAYHHYLHHVPHVHHGSSAADNKTLWVG  98

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE+YL  CFASTGE+ SIKVIRNKQT  +EGYGFVEF SH  AEK LQ+Y  +L
Sbjct  99   DLHHWMDENYLHRCFASTGEIFSIKVIRNKQTCQTEGYGFVEFTSHGTAEKVLQTYAGML  158

Query  604  MPNT  615
            MPNT
Sbjct  159  MPNT  162



>ref|XP_006660711.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=344

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            GG   EN+TIW+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHA
Sbjct  10   GGGQEENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHA  69

Query  565  AAEKALQSYTCILMPNT  615
            AAEK L+ +   +MPNT
Sbjct  70   AAEKVLEGFAGHIMPNT  86



>ref|XP_004141245.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160607.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
Length=426

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  EN+TIW+GDLH+WMDE YL SCF+S GE++S+KVIRNKQTG SEGYGFVEF SH  
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVGEISSMKVIRNKQTGLSEGYGFVEFLSHTT  137

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y+ + MP+T
Sbjct  138  AEKVLQNYSGMFMPST  153



>ref|XP_011000065.1| PREDICTED: polyadenylate-binding protein RBP47 [Populus euphratica]
Length=436

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GSN E +TIW+GDL +WMDE YL +CF+ TGEV+S+K+IRNKQTG  EGYGFVEFYS AA
Sbjct  98   GSNEEAKTIWVGDLLHWMDETYLHNCFSHTGEVSSVKIIRNKQTGQLEGYGFVEFYSRAA  157

Query  568  AEKALQSYTCILMPNT  615
            AEK LQSY+C +MPNT
Sbjct  158  AEKVLQSYSCSMMPNT  173



>ref|XP_009390905.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 79/127 (62%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM---PAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  414
            ++YPA A VMQH MM   P  H    Y          PP  +    Q     +  E RTI
Sbjct  21   VRYPAPAMVMQHPMMAPPPYGHPFVAYHQTPTPPPPPPPLKSIRLHQAVDAAAEDEKRTI  80

Query  415  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  594
            W+GDLH WMDE+YL SCF  +GEV SIKVIRNKQTG SEGYGFVEF+SHA AE  LQS+ 
Sbjct  81   WVGDLHYWMDENYLHSCFGHSGEVVSIKVIRNKQTGQSEGYGFVEFHSHATAENILQSFG  140

Query  595  CILMPNT  615
              LMPNT
Sbjct  141  SHLMPNT  147



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            GG   EN+TIW+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHA
Sbjct  108  GGGQEENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHA  167

Query  565  AAEKALQSYTCILMPNT  615
            AAEK L+ +   +MPNT
Sbjct  168  AAEKVLEGFAGHIMPNT  184



>ref|XP_011004995.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=434

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GSN E +TIW+GDL +WMDE YL +CF+ TGEV+S+K+IRNKQTG  EGYGFVEFYS AA
Sbjct  96   GSNEEAKTIWVGDLLHWMDEAYLHNCFSHTGEVSSVKIIRNKQTGQLEGYGFVEFYSRAA  155

Query  568  AEKALQSYTCILMPNT  615
            AEK LQSY+C +MPNT
Sbjct  156  AEKVLQSYSCSMMPNT  171



>ref|XP_002285031.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Vitis vinifera]
Length=416

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 85/124 (69%), Gaps = 8/124 (6%)
 Frame = +1

Query  250  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDL  429
            YPAAA VMQHQMM   HY P++ P  P    + PP  Q        GS  E +T+W+GDL
Sbjct  35   YPAAAMVMQHQMMYPQHYMPYHHPQPPQQYQNQPPQHQMH------GSTDEIKTLWVGDL  88

Query  430  HNWMDEDYLRSCFASTGEV--ASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            H WMD++YLR+CF  TGEV  +SIK+IRNKQTG SEGYGFVEF+S A AEK L SY   L
Sbjct  89   HQWMDDNYLRTCFGHTGEVKVSSIKIIRNKQTGQSEGYGFVEFFSRATAEKILHSYNGTL  148

Query  604  MPNT  615
            MPNT
Sbjct  149  MPNT  152



>ref|XP_010519119.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP47C-like [Tarenaya hassleriana]
Length=424

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            SNGEN++IW+GDLH+WMDE+YL SCFAS+GE+AS+KVIRNK +G SEGYGFVEF SH  A
Sbjct  89   SNGENKSIWVGDLHHWMDENYLNSCFASSGEIASVKVIRNKHSGLSEGYGFVEFVSHEIA  148

Query  571  EKALQSYTCILMPN  612
            EK L+ Y+   MPN
Sbjct  149  EKVLEDYSGTSMPN  162



>ref|XP_006393576.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
 gb|ESQ30862.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
Length=447

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  423
            M+YP A  VM HQMM A   PP     +  F  H   H Q +  +    SNGEN+TIWIG
Sbjct  62   MRYPPA-VVMPHQMMYAPAPPPSPYSPYHQFPSHHHQHHQSRGNKYQNASNGENKTIWIG  120

Query  424  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  603
            DLH+WMDE YL S FAS GE+ S+KVIRNK TG SEGYGFVEF SH  A+K LQ +    
Sbjct  121  DLHHWMDESYLNSSFASAGEMVSVKVIRNKHTGLSEGYGFVEFLSHDIADKVLQEFNGTT  180

Query  604  MPNT  615
            MPNT
Sbjct  181  MPNT  184



>emb|CBI32444.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  E +T+W+GDLH WMD++YLR+CF  TGEV+SIK+IRNKQTG SEGYGFVEF+S A 
Sbjct  3    GSTDEIKTLWVGDLHQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRAT  62

Query  568  AEKALQSYTCILMPNT  615
            AEK L SY   LMPNT
Sbjct  63   AEKILHSYNGTLMPNT  78



>ref|XP_003578248.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=431

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G   EN+TIW+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAA
Sbjct  98   GGQEENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAA  157

Query  568  AEKALQSYTCILMPNT  615
            AEK L  +   +MPNT
Sbjct  158  AEKVLDGFAGHIMPNT  173



>ref|XP_002313840.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE87795.2| RNA-binding protein 47 [Populus trichocarpa]
Length=435

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GSN E +T+W+GDL +WMDE YL +CF+ TGEV+S+K+IRNKQTG  EGYGFVEFYSHAA
Sbjct  97   GSNEEAKTVWVGDLLHWMDETYLHNCFSHTGEVSSVKIIRNKQTGQLEGYGFVEFYSHAA  156

Query  568  AEKALQSYTCILMPNT  615
            AEK LQSY+  +MPNT
Sbjct  157  AEKVLQSYSGSMMPNT  172



>ref|XP_008782204.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=409

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 87/129 (67%), Gaps = 6/129 (5%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG-----SNGENR  408
            +QYPAA   MQHQMM A   P +   + P+  H  PP   P QQ    G     ++ EN+
Sbjct  25   VQYPAA-MAMQHQMMGAVPPPQYAQLFLPYPQHCLPPPPPPNQQHHQQGWAAALASDENK  83

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIW+GDLH WMDE Y+ SCF  TGEV SIKVIRNK+TG SEGYGFVEF+SHAAAEK LQ+
Sbjct  84   TIWVGDLHYWMDESYIHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKVLQN  143

Query  589  YTCILMPNT  615
            +    MPNT
Sbjct  144  FCGYAMPNT  152



>gb|AFW58430.1| nucleic acid binding protein, partial [Zea mays]
Length=241

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL +CF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  150

Query  562  AAAEKALQSYTCILMPNT  615
            A+AEKALQ++T  +MPNT
Sbjct  151  ASAEKALQNFTGHVMPNT  168



>ref|XP_008782206.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=385

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 87/129 (67%), Gaps = 6/129 (5%)
 Frame = +1

Query  244  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG-----SNGENR  408
            +QYPAA   MQHQMM A   P +   + P+  H  PP   P QQ    G     ++ EN+
Sbjct  25   VQYPAA-MAMQHQMMGAVPPPQYAQLFLPYPQHCLPPPPPPNQQHHQQGWAAALASDENK  83

Query  409  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  588
            TIW+GDLH WMDE Y+ SCF  TGEV SIKVIRNK+TG SEGYGFVEF+SHAAAEK LQ+
Sbjct  84   TIWVGDLHYWMDESYIHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKVLQN  143

Query  589  YTCILMPNT  615
            +    MPNT
Sbjct  144  FCGYAMPNT  152



>ref|XP_006653468.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=409

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL SCF ++GEV +IKVIRN+QTG SEGYGFVEFYSH
Sbjct  79   GGNGCEENKTIWVGDLQYWMDENYLHSCFGTSGEVVTIKVIRNRQTGQSEGYGFVEFYSH  138

Query  562  AAAEKALQSYTCILMPNT  615
             +AEKALQ++T  +MPNT
Sbjct  139  GSAEKALQNFTGHVMPNT  156


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 8/69 (12%)
 Frame = +1

Query  385  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  558
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F S
Sbjct  272  GHSDGDFTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQC------GFVQFVS  325

Query  559  HAAAEKALQ  585
               AE+ALQ
Sbjct  326  RTDAEEALQ  334



>emb|CDO97156.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 86/130 (66%), Gaps = 8/130 (6%)
 Frame = +1

Query  244  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSNGEN  405
            MQYPAAA VMQ QMM      PA  Y  H +    H L+ P P  + Q Q Q   S+ EN
Sbjct  42   MQYPAAAMVMQQQMMYDRQYVPAAAYYHHQLYQQQHQLYQPQPQHKQQSQIQ--NSSEEN  99

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            RTIWIGDL  WMDE YL SCF+   E+ S+KVIRNKQTG SE YGFVEF SHAAA+K LQ
Sbjct  100  RTIWIGDLQQWMDEAYLLSCFSQASELISVKVIRNKQTGQSERYGFVEFSSHAAADKVLQ  159

Query  586  SYTCILMPNT  615
            SY  + MPNT
Sbjct  160  SYNGLPMPNT  169



>ref|XP_010539063.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010539064.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X2 [Tarenaya hassleriana]
Length=426

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            SNGEN+TIW+GDLH+WMDE+YL SCFAS GE+ S+KVIRNK  G SEGYGFVEF SH  A
Sbjct  89   SNGENKTIWVGDLHHWMDENYLNSCFASAGEIVSVKVIRNKYNGLSEGYGFVEFISHGIA  148

Query  571  EKALQSYTCILMPN  612
            +K LQ+Y    MPN
Sbjct  149  DKVLQNYNGASMPN  162



>ref|XP_009417617.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDLH WMDE+YL +CF  TGEV SIKVIRNKQTG SEGYGFVEFY+HAAAEK 
Sbjct  75   ENKTIWVGDLHYWMDENYLHNCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTHAAAEKV  134

Query  580  LQSYTCILMPNT  615
            LQ++    MPNT
Sbjct  135  LQNFGGHTMPNT  146



>ref|NP_001144988.1| uncharacterized protein LOC100278143 [Zea mays]
 gb|ACG44236.1| hypothetical protein [Zea mays]
Length=436

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+++W+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAEK 
Sbjct  104  ENKSVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  163

Query  580  LQSYTCILMPNT  615
            L+ ++  +MPNT
Sbjct  164  LEGFSGHIMPNT  175



>ref|XP_004952707.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Setaria 
italica]
Length=428

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = +1

Query  385  GGSNGE-NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            GG+ GE NRTIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+ +G SEGYGFVEFYSH
Sbjct  96   GGNGGEDNRTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRHSGVSEGYGFVEFYSH  155

Query  562  AAAEKALQSYTCILMPNT  615
            A+AEKALQ+++  +MPNT
Sbjct  156  ASAEKALQNFSGHVMPNT  173



>ref|NP_001132004.1| uncharacterized protein LOC100193409 [Zea mays]
 gb|ACF80669.1| unknown [Zea mays]
Length=422

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDLH WMDE+YL +CF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAE+ 
Sbjct  90   ENKTIWVGDLHFWMDENYLHNCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAERV  149

Query  580  LQSYTCILMPNT  615
            L+ ++  +MPNT
Sbjct  150  LEGFSGHIMPNT  161



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  403  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  582
            N+TIW+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAEK L
Sbjct  18   NKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVL  77

Query  583  QSYTCILMPNT  615
            + +   +MPNT
Sbjct  78   EGFAGHIMPNT  88



>ref|XP_004957051.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Setaria 
italica]
Length=437

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+T+W+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSH AAEK 
Sbjct  107  ENKTVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHGAAEKV  166

Query  580  LQSYTCILMPNT  615
            L+ ++  +MPNT
Sbjct  167  LEGFSGHIMPNT  178



>ref|XP_008667171.1| PREDICTED: uncharacterized protein LOC100193409 isoform X1 [Zea 
mays]
 tpg|DAA40260.1| TPA: hypothetical protein ZEAMMB73_589753 [Zea mays]
Length=424

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDLH WMDE+YL +CF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAE+ 
Sbjct  90   ENKTIWVGDLHFWMDENYLHNCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAERV  149

Query  580  LQSYTCILMPNT  615
            L+ ++  +MPNT
Sbjct  150  LEGFSGHIMPNT  161



>ref|NP_001052934.2| Os04g0449900 [Oryza sativa Japonica Group]
 dbj|BAF14848.2| Os04g0449900 [Oryza sativa Japonica Group]
Length=387

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEFYSH
Sbjct  57   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSH  116

Query  562  AAAEKALQSYTCILMPNT  615
             +AEKALQ++T  +MPNT
Sbjct  117  GSAEKALQNFTGHVMPNT  134


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 8/69 (12%)
 Frame = +1

Query  385  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  558
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F S
Sbjct  250  GHSDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQC------GFVQFVS  303

Query  559  HAAAEKALQ  585
               AE+ALQ
Sbjct  304  RTDAEEALQ  312



>dbj|BAJ85879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDLH WMDE+YL +CF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAEK 
Sbjct  151  ENKTIWVGDLHYWMDENYLHTCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  210

Query  580  LQSYTCILMPNT  615
            L  +   +MPNT
Sbjct  211  LDGFAGHIMPNT  222



>gb|ACF87959.1| unknown [Zea mays]
 tpg|DAA61808.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=433

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+++W+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAEK 
Sbjct  101  ENKSVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  160

Query  580  LQSYTCILMPNT  615
            L+ ++  +MPNT
Sbjct  161  LEGFSGHIMPNT  172



>gb|EAY94326.1| hypothetical protein OsI_16094 [Oryza sativa Indica Group]
Length=426

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEFYSH
Sbjct  96   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSH  155

Query  562  AAAEKALQSYTCILMPNT  615
             +AEKALQ++T  +MPNT
Sbjct  156  GSAEKALQNFTGHVMPNT  173


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 8/69 (12%)
 Frame = +1

Query  385  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  558
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F S
Sbjct  289  GHSDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQC------GFVQFVS  342

Query  559  HAAAEKALQ  585
               AE+ALQ
Sbjct  343  RTDAEEALQ  351



>emb|CAH67097.1| H0818E04.14 [Oryza sativa Indica Group]
Length=426

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEFYSH
Sbjct  96   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSH  155

Query  562  AAAEKALQSYTCILMPNT  615
             +AEKALQ++T  +MPNT
Sbjct  156  GSAEKALQNFTGHVMPNT  173


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 8/69 (12%)
 Frame = +1

Query  385  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  558
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F S
Sbjct  289  GHSDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQC------GFVQFVS  342

Query  559  HAAAEKALQ  585
               AE+ALQ
Sbjct  343  RTDAEEALQ  351



>ref|XP_002446570.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
 gb|EES10898.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
Length=423

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  93   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  152

Query  562  AAAEKALQSYTCILMPNT  615
            A+AEKALQ++T  +MPNT
Sbjct  153  ASAEKALQNFTGHVMPNT  170


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 8/76 (11%)
 Frame = +1

Query  385  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  558
            G S+G+  NRT+++G L   + ED LR  FA  G++AS+K+   KQ       GFV+F S
Sbjct  286  GHSDGDSSNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPLGKQC------GFVQFAS  339

Query  559  HAAAEKALQSYTCILM  606
               AE+ALQ     L+
Sbjct  340  RTDAEEALQGLNGSLI  355



>emb|CAL25353.1| ACBF-like dna binding protein [Platanus x acerifolia]
Length=216

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDLH WMD +YL +CFA TGEV SIKVIRNKQTG SEGYGFVEF+S  AAEK 
Sbjct  27   ENKTIWVGDLHYWMDGNYLNNCFAHTGEVISIKVIRNKQTGQSEGYGFVEFFSREAAEKV  86

Query  580  LQSYTCILMPNT  615
            LQ+Y    MPNT
Sbjct  87   LQNYNGTAMPNT  98



>ref|XP_009358068.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=390

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G N E RTIW+GDLH+WMDE YL  CFA TG+V+SIKVIRNKQTG SEGYGFVEFYS  A
Sbjct  50   GPNDEVRTIWVGDLHHWMDETYLHGCFAHTGQVSSIKVIRNKQTGQSEGYGFVEFYSREA  109

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+Y    MPNT
Sbjct  110  AEEVLQNYNGTAMPNT  125



>ref|XP_008392304.1| PREDICTED: polyadenylate-binding protein RBP47 [Malus domestica]
Length=443

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G N E RTIW+GDLH+WMDE YL  CFA TG+V+SIKVIRNKQTG SEGYGFVEFYS  A
Sbjct  103  GPNDEVRTIWVGDLHHWMDETYLHGCFAHTGQVSSIKVIRNKQTGQSEGYGFVEFYSREA  162

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+Y    MPNT
Sbjct  163  AEEVLQNYNGTAMPNT  178



>gb|ACG32072.1| nucleic acid binding protein [Zea mays]
 gb|ACG34530.1| nucleic acid binding protein [Zea mays]
 gb|AFW58432.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=369

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL +CF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  40   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  99

Query  562  AAAEKALQSYTCILMPNT  615
            A+AEKALQ++T  +MPNT
Sbjct  100  ASAEKALQNFTGHVMPNT  117



>gb|KJB79290.1| hypothetical protein B456_013G042300 [Gossypium raimondii]
Length=294

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            G ++ E +TIW+GDL +WMDE YL SCF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS  
Sbjct  95   GSNSDEVKTIWVGDLVHWMDESYLHSCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRE  154

Query  565  AAEKALQSYTCILMPNT  615
            AAEK LQSY   LMPNT
Sbjct  155  AAEKVLQSYNGSLMPNT  171



>ref|XP_008678713.1| PREDICTED: polyadenylate-binding protein RBP47-like [Zea mays]
 gb|AFW62691.1| hypothetical protein ZEAMMB73_026342 [Zea mays]
Length=430

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = +1

Query  385  GGSNGE-NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            GG+ GE NRTIW+GDL  WMDE+YL SCF S+GEV +IKVIRN+ +G SEGYGF+EFY+H
Sbjct  96   GGNGGEDNRTIWVGDLQYWMDENYLHSCFGSSGEVVNIKVIRNRHSGVSEGYGFIEFYTH  155

Query  562  AAAEKALQSYTCILMPNT  615
             +AEKALQ+++  +MPNT
Sbjct  156  VSAEKALQNFSGHVMPNT  173



>ref|XP_003529385.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+W+GDLH+WMDE+YL +CFA TGEV S KVIRNKQTG SEGYGFVEFYS A AEK 
Sbjct  99   EIRTVWLGDLHHWMDENYLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFVEFYSRATAEKV  158

Query  580  LQSYTCILMPNT  615
            LQ+Y   +MPNT
Sbjct  159  LQNYNGTMMPNT  170



>ref|NP_001150649.1| nucleic acid binding protein [Zea mays]
 gb|ACG39896.1| nucleic acid binding protein [Zea mays]
Length=420

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL +CF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  150

Query  562  AAAEKALQSYTCILMPNT  615
            A+AEKALQ++T  +MPNT
Sbjct  151  ASAEKALQNFTGHVMPNT  168



>gb|ACF85767.1| unknown [Zea mays]
 gb|AFW58431.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=420

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  388  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  561
            G NG  EN+TIW+GDL  WMDE+YL +CF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  150

Query  562  AAAEKALQSYTCILMPNT  615
            A+AEKALQ++T  +MPNT
Sbjct  151  ASAEKALQNFTGHVMPNT  168



>ref|XP_006384437.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
 gb|ERP62234.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
Length=435

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GSN E +TIW+GDL +WMDE YL +CF+ TGEV+S+K+IRNKQTG  EGYGFVEFYS AA
Sbjct  97   GSNEEAKTIWVGDLLHWMDEAYLHNCFSHTGEVSSVKIIRNKQTGQLEGYGFVEFYSRAA  156

Query  568  AEKALQSYTCILMPNT  615
            AEK LQSY+  +MPNT
Sbjct  157  AEKVLQSYSGSMMPNT  172



>ref|XP_003518846.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S+ E RT+W+GDLH+WMDE+YL +CFA TGEV S KVIRNKQTG SEGYGFVEFYS   A
Sbjct  95   SSDEIRTVWLGDLHHWMDENYLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFVEFYSRGTA  154

Query  571  EKALQSYTCILMPNT  615
            EK LQ+Y   +MPNT
Sbjct  155  EKVLQNYNGTMMPNT  169



>gb|KDO49120.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=307

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  571  EKALQSYTCILMPNT  615
            EK LQSY+  LMPNT
Sbjct  171  EKVLQSYSGSLMPNT  185



>gb|KDO49118.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=341

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  571  EKALQSYTCILMPNT  615
            EK LQSY+  LMPNT
Sbjct  171  EKVLQSYSGSLMPNT  185



>gb|KDO49121.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=349

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  571  EKALQSYTCILMPNT  615
            EK LQSY+  LMPNT
Sbjct  171  EKVLQSYSGSLMPNT  185



>gb|KCW63816.1| hypothetical protein EUGRSUZ_G01492 [Eucalyptus grandis]
Length=432

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            +TIWIGDLH+WMDE YL +CF+ TGEV+S+KVIRNKQTG SEGYGFVEF SHA AEK LQ
Sbjct  99   KTIWIGDLHHWMDETYLHNCFSHTGEVSSVKVIRNKQTGQSEGYGFVEFSSHATAEKVLQ  158

Query  586  SYTCILMPNT  615
            SY    MPNT
Sbjct  159  SYNGTSMPNT  168



>gb|KDO49119.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=376

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  571  EKALQSYTCILMPNT  615
            EK LQSY+  LMPNT
Sbjct  171  EKVLQSYSGSLMPNT  185



>ref|XP_006423053.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
 gb|ESR36293.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
Length=372

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  107  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  166

Query  571  EKALQSYTCILMPNT  615
            EK LQSY+  LMPNT
Sbjct  167  EKVLQSYSGSLMPNT  181



>ref|XP_010066047.1| PREDICTED: polyadenylate-binding protein RBP47 [Eucalyptus grandis]
Length=445

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            +TIWIGDLH+WMDE YL +CF+ TGEV+S+KVIRNKQTG SEGYGFVEF SHA AEK LQ
Sbjct  112  KTIWIGDLHHWMDETYLHNCFSHTGEVSSVKVIRNKQTGQSEGYGFVEFSSHATAEKVLQ  171

Query  586  SYTCILMPNT  615
            SY    MPNT
Sbjct  172  SYNGTSMPNT  181



>ref|XP_009391347.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIW+GDLH WMDE+YL +CF  TGEV SIKVIRNKQTG SEGYGFVEFY+H AA+  
Sbjct  78   DNKTIWVGDLHYWMDENYLHNCFGRTGEVISIKVIRNKQTGQSEGYGFVEFYTHEAAKNV  137

Query  580  LQSYTCILMPNT  615
            LQS+   +MPNT
Sbjct  138  LQSFVGHMMPNT  149



>ref|XP_004153285.1| PREDICTED: polyadenylate-binding protein RBP47B-like, partial 
[Cucumis sativus]
Length=218

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  E +T+WIGDL  WMDE YL +CFA TGEV+S+KVI NKQTG SEGYGFVEF+SH  
Sbjct  94   GSTDEVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTT  153

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y   +MPNT
Sbjct  154  AEKVLQNYNGTIMPNT  169



>ref|XP_004975779.1| PREDICTED: polyadenylate-binding protein RBP47-like [Setaria 
italica]
Length=420

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEF+SH +AEKA
Sbjct  96   ENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSHGSAEKA  155

Query  580  LQSYTCILMPNT  615
            LQ++T  +MPNT
Sbjct  156  LQNFTGHVMPNT  167


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 8/69 (12%)
 Frame = +1

Query  385  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  558
            G S+G+  NRT+++G L   + ED LR  FA  G++AS+K+   KQ       GFV+F S
Sbjct  283  GHSDGDSSNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPLGKQC------GFVQFVS  336

Query  559  HAAAEKALQ  585
               AE+ALQ
Sbjct  337  RTDAEEALQ  345



>gb|KJB79289.1| hypothetical protein B456_013G042300 [Gossypium raimondii]
Length=438

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            G ++ E +TIW+GDL +WMDE YL SCF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS  
Sbjct  95   GSNSDEVKTIWVGDLVHWMDESYLHSCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRE  154

Query  565  AAEKALQSYTCILMPNT  615
            AAEK LQSY   LMPNT
Sbjct  155  AAEKVLQSYNGSLMPNT  171



>ref|XP_006480131.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Citrus 
sinensis]
 gb|KDO49117.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=449

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  571  EKALQSYTCILMPNT  615
            EK LQSY+  LMPNT
Sbjct  171  EKVLQSYSGSLMPNT  185



>gb|KDO49116.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=450

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  571  EKALQSYTCILMPNT  615
            EK LQSY+  LMPNT
Sbjct  171  EKVLQSYSGSLMPNT  185



>ref|XP_006423054.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
 gb|ESR36294.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
Length=445

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  107  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  166

Query  571  EKALQSYTCILMPNT  615
            EK LQSY+  LMPNT
Sbjct  167  EKVLQSYSGSLMPNT  181



>ref|XP_003579863.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=428

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG +EGYGFVEFYSHA+A+KA
Sbjct  102  ENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQTEGYGFVEFYSHASADKA  161

Query  580  LQSYTCILMPNT  615
            LQ++T   MPNT
Sbjct  162  LQNFTGHAMPNT  173


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 8/69 (12%)
 Frame = +1

Query  385  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  558
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+ + KQ       GFV++ +
Sbjct  289  GHSDGDSTNRTVYVGGLDPNVSEDELRKSFAKYGDVASVKIPQGKQC------GFVQYVN  342

Query  559  HAAAEKALQ  585
               AE+ALQ
Sbjct  343  RTDAEEALQ  351



>ref|XP_007156541.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28535.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=363

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S+ E RTIW+GDLH+WMDE+YL +CFA TGEV S KVIRNKQTG SEGYGFVEFY+   A
Sbjct  29   SSDEIRTIWLGDLHHWMDENYLHNCFAHTGEVLSAKVIRNKQTGQSEGYGFVEFYTRPTA  88

Query  571  EKALQSYTCILMPNT  615
            EK LQ+Y   +MPNT
Sbjct  89   EKVLQNYNGTMMPNT  103



>gb|KJB79291.1| hypothetical protein B456_013G042300 [Gossypium raimondii]
Length=415

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            G ++ E +TIW+GDL +WMDE YL SCF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS  
Sbjct  95   GSNSDEVKTIWVGDLVHWMDESYLHSCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRE  154

Query  565  AAEKALQSYTCILMPNT  615
            AAEK LQSY   LMPNT
Sbjct  155  AAEKVLQSYNGSLMPNT  171



>ref|XP_007156542.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28536.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=367

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S+ E RTIW+GDLH+WMDE+YL +CFA TGEV S KVIRNKQTG SEGYGFVEFY+   A
Sbjct  29   SSDEIRTIWLGDLHHWMDENYLHNCFAHTGEVLSAKVIRNKQTGQSEGYGFVEFYTRPTA  88

Query  571  EKALQSYTCILMPNT  615
            EK LQ+Y   +MPNT
Sbjct  89   EKVLQNYNGTMMPNT  103



>ref|XP_009404023.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RTIW+GDL  WMDE+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  78   EKRTIWVGDLQYWMDENYLLSCFVHTGEVVSIKVIRNKQTGQSEGYGFVEFHSHATAEKI  137

Query  580  LQSYTCILMPNT  615
            LQS++  LMP T
Sbjct  138  LQSFSGHLMPTT  149



>ref|XP_006648763.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=378

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            ENRTIW+GDL  WMDE+YL +CF S GEV +IKVIRN+ +G SEGYGFVEF SHA+AEKA
Sbjct  53   ENRTIWVGDLQYWMDENYLHNCFGSGGEVVTIKVIRNRHSGVSEGYGFVEFCSHASAEKA  112

Query  580  LQSYTCILMPNT  615
            LQ+++  LMPNT
Sbjct  113  LQNFSGHLMPNT  124


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 6/61 (10%)
 Frame = +1

Query  403  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  582
            NRTI++G L   + ED LR  FA  G++AS+K+   KQ       GFV+F +   AE+AL
Sbjct  248  NRTIYVGGLDPNVTEDELRKAFAKYGDLASVKIPVGKQC------GFVQFVNRPDAEEAL  301

Query  583  Q  585
            Q
Sbjct  302  Q  302



>gb|EPS57677.1| hypothetical protein M569_17140 [Genlisea aurea]
Length=414

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE+YL SCF+ TGEV S+KVIRNKQTG SE YGFVEF SH AAEK 
Sbjct  90   DNKTIWIGDLQQWMDENYLHSCFSQTGEVVSVKVIRNKQTGQSEKYGFVEFISHGAAEKV  149

Query  580  LQSYTCILMPNT  615
            LQSY    MPNT
Sbjct  150  LQSYNGSTMPNT  161



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   120 bits (300),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            ++ EN+TIW+GDLH WMDE YL SCF  TGEV SIKVIRNK+TG SEGYGFVEF+SHAAA
Sbjct  417  ASDENKTIWVGDLHYWMDESYLHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAA  476

Query  571  EKALQSYTCILMPNT  615
            EK LQ++    MPNT
Sbjct  477  EKVLQNFNGYAMPNT  491



>ref|XP_003608019.1| RNA Binding Protein [Medicago truncatula]
 gb|AES90216.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=454

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RTIW+GDLH+WMDE +L +CFA TGEVAS KVIRNKQTG SEGYGFVEFY+ A AEK 
Sbjct  114  EIRTIWLGDLHHWMDETFLHNCFAHTGEVASAKVIRNKQTGQSEGYGFVEFYTRAMAEKV  173

Query  580  LQSYTCILMPNT  615
            LQ++   +MPNT
Sbjct  174  LQNFNGTMMPNT  185



>ref|XP_002452313.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
 gb|EES05289.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
Length=435

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +NRTIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+ +G SEGYGFVEFYSH +AEKA
Sbjct  107  DNRTIWVGDLQYWMDENYLHSCFGPSGEVVNIKVIRNRHSGVSEGYGFVEFYSHVSAEKA  166

Query  580  LQSYTCILMPNT  615
            LQ+++  +MPNT
Sbjct  167  LQNFSGHVMPNT  178


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 6/61 (10%)
 Frame = +1

Query  403  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  582
            NRT+++G L   + ED LR  FA  G++AS+K+   KQ       GFV+F + A AE+AL
Sbjct  302  NRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPFGKQC------GFVQFVNRADAEEAL  355

Query  583  Q  585
            Q
Sbjct  356  Q  356



>gb|AFK40720.1| unknown [Medicago truncatula]
Length=454

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RTIW+GDLH+WMDE +L +CFA TGEVAS KVIRNKQTG SEGYGFVEFY+ A AEK 
Sbjct  114  EIRTIWLGDLHHWMDETFLHNCFAHTGEVASAKVIRNKQTGQSEGYGFVEFYTRAMAEKV  173

Query  580  LQSYTCILMPNT  615
            LQ++   +MPNT
Sbjct  174  LQNFNGTMMPNT  185



>sp|Q9LEB3.1|RBP47_NICPL RecName: Full=Polyadenylate-binding protein RBP47; Short=Poly(A)-binding 
protein RBP47; AltName: Full=RNA-binding protein 
47; Short=NplRBP47 [Nicotiana plumbaginifolia]
 emb|CAC01238.1| RNA Binding Protein 47 [Nicotiana plumbaginifolia]
Length=428

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  82   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  141

Query  580  LQSYTCILMPNT  615
            LQSY   +MPNT
Sbjct  142  LQSYNGTMMPNT  153



>ref|XP_011088289.1| PREDICTED: polyadenylate-binding protein RBP47 [Sesamum indicum]
Length=423

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL+SCF+ TGEV S+K+IRNKQTG SE YGF+EF SH AAEK 
Sbjct  90   DNKTIWIGDLQQWMDEGYLQSCFSQTGEVVSVKIIRNKQTGQSERYGFIEFNSHLAAEKV  149

Query  580  LQSYTCILMPNT  615
            LQSY   +MPNT
Sbjct  150  LQSYNGTVMPNT  161



>gb|KDP23018.1| hypothetical protein JCGZ_01681 [Jatropha curcas]
Length=429

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            +TIWIGDL NWMDE YL +CF+ TGEV+++KVIRNKQTG SEGYGFVEF+SHA AEK LQ
Sbjct  97   KTIWIGDLLNWMDEPYLHNCFSHTGEVSTVKVIRNKQTGQSEGYGFVEFHSHATAEKVLQ  156

Query  586  SYTCILMPNT  615
            +Y   +MPNT
Sbjct  157  NYNGSVMPNT  166



>ref|XP_004505196.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cicer arietinum]
Length=442

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E +TIW+GDLH+WMDE +L +CFA TGEV S KVIRNKQTG SEGYGF+EFYS A AEK 
Sbjct  102  EIKTIWLGDLHHWMDETFLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFIEFYSRATAEKV  161

Query  580  LQSYTCILMPNT  615
            LQ+Y   +MPNT
Sbjct  162  LQNYNGTMMPNT  173



>ref|XP_009380242.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RTIW+GDL  WMDE+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  78   ERRTIWVGDLQYWMDENYLHSCFGHTGEVISIKVIRNKQTGQSEGYGFVEFHSHATAEKV  137

Query  580  LQSYTCILMPNT  615
            LQ+++   MPNT
Sbjct  138  LQNFSNHPMPNT  149



>gb|KJB47423.1| hypothetical protein B456_008G025400 [Gossypium raimondii]
Length=394

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            G ++ E +TIW+GDL +WMDE YL  CF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS A
Sbjct  91   GCNSDEVKTIWVGDLVHWMDETYLHGCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRA  150

Query  565  AAEKALQSYTCILMPNT  615
             AEK LQSY   LMPNT
Sbjct  151  TAEKVLQSYNGSLMPNT  167



>gb|KJB47422.1| hypothetical protein B456_008G025400 [Gossypium raimondii]
Length=393

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            G ++ E +TIW+GDL +WMDE YL  CF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS A
Sbjct  91   GCNSDEVKTIWVGDLVHWMDETYLHGCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRA  150

Query  565  AAEKALQSYTCILMPNT  615
             AEK LQSY   LMPNT
Sbjct  151  TAEKVLQSYNGSLMPNT  167



>ref|XP_004230808.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum lycopersicum]
Length=413

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF SHAAAEK 
Sbjct  74   DNKTIWIGDLQQWMDESYLHSCFSHAGEVISVKIIRNKQTGQSERYGFVEFNSHAAAEKV  133

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  134  LQSYNGTMMPN  144



>ref|XP_008797245.1| PREDICTED: polyadenylate-binding protein RBP47-like [Phoenix 
dactylifera]
Length=393

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 87/126 (69%), Gaps = 5/126 (4%)
 Frame = +1

Query  244  MQYP--AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIW  417
            MQYP  AAA +M+HQM+P    P +   + P+    PP + Q Q     G    EN+TIW
Sbjct  18   MQYPPPAAAMMMRHQMVPPPPQPQYAQQFLPYHPLPPPQNHQHQAGTAAG---EENKTIW  74

Query  418  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  597
            +GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK +QS+  
Sbjct  75   VGDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVIQSFVG  134

Query  598  ILMPNT  615
             +MPNT
Sbjct  135  HIMPNT  140



>ref|NP_001275480.1| DNA binding protein ACBF-like [Solanum tuberosum]
 gb|ABB86267.1| DNA binding protein ACBF-like [Solanum tuberosum]
Length=372

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S+ +N+TIWIGDL  WMDE+YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAA
Sbjct  28   SSEDNKTIWIGDLQQWMDENYLHSCFSHAGEVISVKIIRNKQTGQSERYGFVEFNTHAAA  87

Query  571  EKALQSYTCILMPN  612
            EK LQSY   +MPN
Sbjct  88   EKVLQSYNGTMMPN  101



>ref|XP_007042377.1| RNA-binding protein 47A [Theobroma cacao]
 gb|EOX98208.1| RNA-binding protein 47A [Theobroma cacao]
Length=436

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E +TIW+GDL +WMDE YL  CF+ TGEV+S+K+IRNKQTG SEGYGF+EFYS AAAEK 
Sbjct  99   EVKTIWVGDLVHWMDETYLHGCFSHTGEVSSVKIIRNKQTGQSEGYGFIEFYSRAAAEKV  158

Query  580  LQSYTCILMPNT  615
            LQS+   LMPNT
Sbjct  159  LQSFNGSLMPNT  170



>ref|XP_004145357.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=436

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  E +T+WIGDL  WMDE YL +CFA TGEV+S+KVI NKQTG SEGYGFVEF+SH  
Sbjct  94   GSTDEVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTT  153

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y   +MPNT
Sbjct  154  AEKVLQNYNGTIMPNT  169



>ref|XP_004234481.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
lycopersicum]
Length=405

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S+ E R++WIGDL  WMDE Y+++CFA TGEVAS+KVIRNKQ+G SEGYGFVEF SHAAA
Sbjct  67   SSDEIRSLWIGDLQFWMDEQYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAAA  126

Query  571  EKALQSYTCILMPNT  615
            E+ LQ+Y   +MPN+
Sbjct  127  ERNLQTYNGSMMPNS  141



>ref|XP_004168889.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=437

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  E +T+WIGDL  WMDE YL +CFA TGEV+S+KVI NKQTG SEGYGFVEF+SH  
Sbjct  94   GSTDEVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTT  153

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y   +MPNT
Sbjct  154  AEKVLQNYNGTIMPNT  169



>ref|XP_006346456.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum tuberosum]
Length=420

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE+YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  81   DNKTIWIGDLQQWMDENYLHSCFSHAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  140

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  141  LQSYNGTMMPN  151



>ref|XP_010052834.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Eucalyptus 
grandis]
 gb|KCW76950.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=300

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            GG   E RT+WIGDL  WMDE YL +CFA+TGEVA++KVIRNKQT   EGYGF+EFY+ A
Sbjct  85   GGGGDEVRTLWIGDLQYWMDEAYLGTCFAATGEVANVKVIRNKQTMQPEGYGFIEFYTRA  144

Query  565  AAEKALQSYTCILMPN  612
            AAE+ LQ+Y   +MPN
Sbjct  145  AAERVLQTYNGAIMPN  160



>ref|XP_009628458.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=418

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS+ +N+TIWIGDL +WMDE YL SCF+ +GEV S+KVIRNKQTG SE YGFVEF +H A
Sbjct  61   GSSEDNKTIWIGDLQHWMDETYLHSCFSQSGEVISVKVIRNKQTGQSERYGFVEFNTHEA  120

Query  568  AEKALQSYTCILMPN  612
            AEK LQSY   +MPN
Sbjct  121  AEKVLQSYNGTMMPN  135



>ref|XP_009590296.1| PREDICTED: polyadenylate-binding protein RBP47 [Nicotiana tomentosiformis]
Length=430

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  84   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  143

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  144  LQSYNGTMMPN  154



>ref|XP_009783555.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nicotiana sylvestris]
Length=437

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS+ +N+TIWIGDL +WMDE YL SCF+ +GEV S+KVIRNKQTG SE YGFVEF +H A
Sbjct  75   GSSEDNKTIWIGDLQHWMDETYLHSCFSQSGEVISVKVIRNKQTGQSERYGFVEFNTHEA  134

Query  568  AEKALQSYTCILMPN  612
            AEK LQSY   +MPN
Sbjct  135  AEKVLQSYNGTMMPN  149



>ref|XP_009783557.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nicotiana sylvestris]
Length=397

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS+ +N+TIWIGDL +WMDE YL SCF+ +GEV S+KVIRNKQTG SE YGFVEF +H A
Sbjct  75   GSSEDNKTIWIGDLQHWMDETYLHSCFSQSGEVISVKVIRNKQTGQSERYGFVEFNTHEA  134

Query  568  AEKALQSYTCILMPN  612
            AEK LQSY   +MPN
Sbjct  135  AEKVLQSYNGTMMPN  149



>ref|XP_006343293.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=411

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S+ E R++WIGDL  WMDE Y+++CFA TGEVAS+KVIRNKQ+G SEGYGFVEF SHAAA
Sbjct  73   SSDEIRSLWIGDLQFWMDEPYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAAA  132

Query  571  EKALQSYTCILMPNT  615
            E+ LQ+Y   +MPN+
Sbjct  133  ERNLQTYNGSMMPNS  147



>gb|AAC49850.1| DNA binding protein ACBF [Nicotiana tabacum]
Length=428

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  82   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  141

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  142  LQSYNGTMMPN  152



>ref|XP_008459212.1| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis melo]
Length=439

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  E +T+WIGDL  WMDE YL +CFA TGEV+S+KVI NKQTG SEGYGFVEF+SH  
Sbjct  94   GSTDEVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTT  153

Query  568  AEKALQSYTCILMPNT  615
            AEK LQ+Y   +MPNT
Sbjct  154  AEKVLQNYNGTIMPNT  169



>ref|XP_010500273.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=444

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            SNGEN+TIW+GDL+ WMDE YL S F STGE+ S+KVIRNK  G+SEGYGFVEF SH  A
Sbjct  107  SNGENKTIWVGDLYQWMDEPYLNSSFGSTGEIVSVKVIRNKHNGYSEGYGFVEFESHDVA  166

Query  571  EKALQSYTCILMPNT  615
            EK LQ +    MP T
Sbjct  167  EKVLQKFNGATMPTT  181



>gb|EYU37704.1| hypothetical protein MIMGU_mgv1a006826mg [Erythranthe guttata]
Length=430

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMD+ YL+SCFA +GEV S+K+IRNKQTG SE YGF+EF SHAAAEK 
Sbjct  92   DNKTIWIGDLQQWMDDGYLQSCFAQSGEVVSVKIIRNKQTGQSERYGFIEFNSHAAAEKV  151

Query  580  LQSYTCILMPNT  615
            LQSY   +M NT
Sbjct  152  LQSYNGTMMLNT  163



>ref|XP_003575198.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Brachypodium 
distachyon]
Length=421

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            RTIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+ +G SEGYGFVEFYSHA+AEKALQ
Sbjct  99   RTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRHSGVSEGYGFVEFYSHASAEKALQ  158

Query  586  SYTCILMPNT  615
            ++   +MPNT
Sbjct  159  NFAGHVMPNT  168


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 6/64 (9%)
 Frame = +1

Query  403  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  582
            NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F + A AE+AL
Sbjct  292  NRTVYVGGLDPNVSEDELRKTFAKYGDVASVKIPVGKQC------GFVQFVNRADAEEAL  345

Query  583  QSYT  594
            Q+ +
Sbjct  346  QALS  349



>ref|XP_010052833.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Eucalyptus 
grandis]
Length=336

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            GG   E RT+WIGDL  WMDE YL +CFA+TGEVA++KVIRNKQT   EGYGF+EFY+ A
Sbjct  85   GGGGDEVRTLWIGDLQYWMDEAYLGTCFAATGEVANVKVIRNKQTMQPEGYGFIEFYTRA  144

Query  565  AAEKALQSYTCILMPN  612
            AAE+ LQ+Y   +MPN
Sbjct  145  AAERVLQTYNGAIMPN  160



>ref|XP_009789022.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
sylvestris]
Length=413

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E R++WIGDL  WMDE Y+ +CFA TGEV S+KVIRNKQTG SEGYGF+EF SHAAAEK 
Sbjct  74   EIRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAAAEKN  133

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  134  LQTYNGTLMPN  144



>ref|XP_009595795.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E R++WIGDL  WMDE Y+ +CFA TGEV S+KVIRNKQTG SEGYGF+EF SHAAAEK 
Sbjct  72   ELRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAAAEKN  131

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  132  LQAYNGTLMPN  142



>gb|AAB92518.1| putative RNA binding protein [Nicotiana tabacum]
Length=482

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  136  DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  195

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  196  LQSYNGTMMPN  206



>ref|XP_002518798.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43723.1| nuclear acid binding protein, putative [Ricinus communis]
Length=438

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +++TIW+GDL +WMDE YL SCF+ TGEV S+KVIRNKQTG  EGYGF+EFYSHA AEK 
Sbjct  104  DSKTIWVGDLLHWMDETYLHSCFSHTGEVTSVKVIRNKQTGQPEGYGFIEFYSHATAEKV  163

Query  580  LQSYTCILMPN  612
            LQ+Y   +MPN
Sbjct  164  LQNYNGSMMPN  174



>ref|XP_006349628.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Solanum 
tuberosum]
Length=424

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  137  LQSYNGTMMPN  147



>ref|XP_006349627.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Solanum 
tuberosum]
Length=428

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  137  LQSYNGTMMPN  147



>ref|XP_010461546.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            SNGEN+TIW+GDLH+WMDE YL S F S GE+ S+KVIRNK  G+SEGYGFVEF SH  A
Sbjct  109  SNGENKTIWVGDLHHWMDEPYLNSSFGSAGEIVSVKVIRNKHNGYSEGYGFVEFESHDVA  168

Query  571  EKALQSYTCILMPNT  615
            +K LQ +    MP T
Sbjct  169  DKVLQKFNGATMPTT  183



>ref|XP_009631415.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana tomentosiformis]
Length=399

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E R++WIGDL  WMDE YL +CFA TGEV + KVIRNKQTG SEGYGFVEF SHAAAE+ 
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAERN  130

Query  580  LQSYTCILMPNT  615
            LQ+Y   LMPNT
Sbjct  131  LQAYNGTLMPNT  142



>ref|NP_001275430.1| DNA-binding protein-like [Solanum tuberosum]
 gb|ABB86246.1| DNA-binding protein-like [Solanum tuberosum]
Length=423

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  137  LQSYNGTMMPN  147



>ref|XP_010327390.1| PREDICTED: DNA-binding protein isoform X2 [Solanum lycopersicum]
Length=423

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  137  LQSYNGTMMPN  147



>ref|XP_010327389.1| PREDICTED: DNA-binding protein isoform X1 [Solanum lycopersicum]
Length=424

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  137  LQSYNGTMMPN  147



>ref|XP_009631416.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana tomentosiformis]
Length=398

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E R++WIGDL  WMDE YL +CFA TGEV + KVIRNKQTG SEGYGFVEF SHAAAE+ 
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAERN  130

Query  580  LQSYTCILMPNT  615
            LQ+Y   LMPNT
Sbjct  131  LQAYNGTLMPNT  142



>ref|XP_009631417.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nicotiana tomentosiformis]
Length=396

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E R++WIGDL  WMDE YL +CFA TGEV + KVIRNKQTG SEGYGFVEF SHAAAE+ 
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAERN  130

Query  580  LQSYTCILMPNT  615
            LQ+Y   LMPNT
Sbjct  131  LQAYNGTLMPNT  142



>ref|XP_010545222.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Tarenaya 
hassleriana]
Length=411

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS GE R++WIGDL +WMDE+YL S FA TGE+ S KVIR+KQTG+SEGYGF+EF +H+A
Sbjct  71   GSAGEIRSLWIGDLQSWMDENYLMSIFAHTGEIQSAKVIRSKQTGYSEGYGFIEFVNHSA  130

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+Y    MPNT
Sbjct  131  AERILQTYNGTQMPNT  146



>ref|XP_007199852.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
 gb|EMJ01051.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
Length=449

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G   E RTIW+GDLH+WMDE YL  CFA TG+V+++KVIRNKQT  SEGYGFVEF+S  A
Sbjct  109  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTGQVSTVKVIRNKQTAQSEGYGFVEFFSREA  168

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQSY    MPNT
Sbjct  169  AEEVLQSYNGAAMPNT  184



>ref|XP_008236617.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=450

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G   E RTIW+GDLH+WMDE YL  CFA TG+V+++KVIRNKQT  SEGYGFVEF+S  A
Sbjct  110  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTGQVSTVKVIRNKQTAQSEGYGFVEFFSREA  169

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQSY    MPNT
Sbjct  170  AEEVLQSYNGAAMPNT  185



>ref|XP_006845940.1| hypothetical protein AMTR_s00157p00080130 [Amborella trichopoda]
 gb|ERN07615.1| hypothetical protein AMTR_s00157p00080130 [Amborella trichopoda]
Length=291

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S+ EN+++W+GDL  WMDE+YL SCF  TGEV S+KVIRNKQTG SEGYGFVEF S AAA
Sbjct  74   SSEENKSLWVGDLQYWMDENYLNSCFGHTGEVVSLKVIRNKQTGQSEGYGFVEFVSRAAA  133

Query  571  EKALQSYTCILMPNT  615
            EK LQ+Y   +MP+T
Sbjct  134  EKILQNYNGGMMPST  148



>ref|NP_001234487.1| DNA-binding protein [Solanum lycopersicum]
 gb|AAR91698.1| DNA-binding protein [Solanum lycopersicum]
Length=428

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  137  LQSYNGTMMPN  147



>ref|XP_008236618.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=446

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G   E RTIW+GDLH+WMDE YL  CFA TG+V+++KVIRNKQT  SEGYGFVEF+S  A
Sbjct  110  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTGQVSTVKVIRNKQTAQSEGYGFVEFFSREA  169

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQSY    MPNT
Sbjct  170  AEEVLQSYNGAAMPNT  185



>ref|XP_010052832.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76949.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=427

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            GG   E RT+WIGDL  WMDE YL +CFA+TGEVA++KVIRNKQT   EGYGF+EFY+ A
Sbjct  85   GGGGDEVRTLWIGDLQYWMDEAYLGTCFAATGEVANVKVIRNKQTMQPEGYGFIEFYTRA  144

Query  565  AAEKALQSYTCILMPN  612
            AAE+ LQ+Y   +MPN
Sbjct  145  AAERVLQTYNGAIMPN  160



>ref|XP_009356988.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=445

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G   E RTIW+GDLH+WMDE YL  CFA TG+V+S+KVIRNKQTG SEGYGFVEFYS   
Sbjct  106  GPTDEVRTIWVGDLHHWMDETYLHGCFAHTGQVSSVKVIRNKQTGQSEGYGFVEFYSREV  165

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+   + MPNT
Sbjct  166  AEEVLQNCNGVPMPNT  181



>ref|XP_011461514.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=448

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G   E RTIW GDLH+WMDE YL  CFA TG+V+S+KVIRNKQTG +EGYGFVEFYS  A
Sbjct  113  GPTDEVRTIWAGDLHHWMDEAYLHGCFAYTGQVSSVKVIRNKQTGQTEGYGFVEFYSREA  172

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+Y    MPNT
Sbjct  173  AEEVLQTYNGTPMPNT  188



>gb|KDP39118.1| hypothetical protein JCGZ_00875 [Jatropha curcas]
Length=407

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G + E +++WIGDL  WMDE+YL S F+STGEV S KVIRNKQTG  EGYGF+EF S AA
Sbjct  64   GDSAEIKSLWIGDLQQWMDENYLLSIFSSTGEVVSAKVIRNKQTGLPEGYGFIEFVSRAA  123

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+Y   LMPNT
Sbjct  124  AERILQTYNGALMPNT  139



>ref|XP_004294842.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=454

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G   E RTIW GDLH+WMDE YL  CFA TG+V+S+KVIRNKQTG +EGYGFVEFYS  A
Sbjct  113  GPTDEVRTIWAGDLHHWMDEAYLHGCFAYTGQVSSVKVIRNKQTGQTEGYGFVEFYSREA  172

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+Y    MPNT
Sbjct  173  AEEVLQTYNGTPMPNT  188



>ref|XP_009794615.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nicotiana 
sylvestris]
Length=402

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  56   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  115

Query  580  LQSYTCILMPN  612
            LQSY   +MP+
Sbjct  116  LQSYNGTMMPS  126



>ref|XP_009794616.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nicotiana 
sylvestris]
Length=431

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  85   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  144

Query  580  LQSYTCILMPN  612
            LQSY   +MP+
Sbjct  145  LQSYNGTMMPS  155



>ref|NP_001130489.1| uncharacterized protein LOC100191587 [Zea mays]
 gb|ACF78722.1| unknown [Zea mays]
Length=417

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            RTIW+GDL  WMDE+YL SCF   GEV +IKVIRN+ +G SEGYGFVEFYSH +AEKALQ
Sbjct  93   RTIWVGDLQYWMDENYLHSCFGPGGEVVNIKVIRNRHSGVSEGYGFVEFYSHVSAEKALQ  152

Query  586  SYTCILMPNT  615
            +++  +MPNT
Sbjct  153  NFSGHVMPNT  162



>ref|XP_010327242.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X3 [Solanum lycopersicum]
Length=354

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S  E RT+WIGDL  WMDE YL SCFA TGEV S KVIRNKQT  SEGYGF+EF SHAAA
Sbjct  71   SADEVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAA  130

Query  571  EKALQSYTCILMPN  612
            E+ LQ+Y   LMPN
Sbjct  131  ERNLQAYNGTLMPN  144



>ref|XP_001777334.1| predicted protein [Physcomitrella patens]
 ref|XP_001782740.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ52446.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ57864.1| predicted protein, partial [Physcomitrella patens]
Length=416

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S+ E +T+W+GDL  WMDE+YL + F  TGEV S+K+IRNKQTG+SEGYGFVEF SHAAA
Sbjct  3    SHEEVKTLWVGDLQYWMDENYLHTAFVHTGEVQSVKIIRNKQTGYSEGYGFVEFVSHAAA  62

Query  571  EKALQSYTCILMPNT  615
            EK LQ+Y    MPNT
Sbjct  63   EKILQAYNGTQMPNT  77



>ref|XP_007147735.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
 gb|ESW19729.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
Length=399

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE+YL +CFASTGEV S+KVIRNKQT  SEGYGF+EF S AAAE+ 
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122

Query  580  LQSYTCILMPN  612
            LQ+Y   +MPN
Sbjct  123  LQTYNGAIMPN  133



>gb|AGV54881.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE+YL +CFASTGEV S+KVIRNKQT  SEGYGF+EF S AAAE+ 
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122

Query  580  LQSYTCILMPN  612
            LQ+Y   +MPN
Sbjct  123  LQTYNGAIMPN  133



>gb|EPS64177.1| hypothetical protein M569_10604, partial [Genlisea aurea]
Length=438

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            R++WIGDL  WMDE YL SCFA TGEVAS KVIRN+ TG SEGYGF+EF SHAAAE+ LQ
Sbjct  90   RSLWIGDLQYWMDEQYLYSCFAHTGEVASAKVIRNRHTGQSEGYGFIEFVSHAAAERNLQ  149

Query  586  SYTCILMPNT  615
            +Y   LMPN 
Sbjct  150  TYNGALMPNV  159



>gb|AGV54456.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE+YL +CFASTGEV S+KVIRNKQT  SEGYGF+EF S AAAE+ 
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122

Query  580  LQSYTCILMPN  612
            LQ+Y   +MPN
Sbjct  123  LQTYNGAIMPN  133



>emb|CDX95176.1| BnaC09g16940D [Brassica napus]
Length=419

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            SN EN+TIWIGDL +WMDE+YL SCFA  GE+AS+KVIRNK TG SEGYGFVEF SH  A
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAGEMASVKVIRNKHTGLSEGYGFVEFDSHDVA  143

Query  571  EKALQSYTCILM  606
            EK LQ +  + M
Sbjct  144  EKVLQDFNGVTM  155



>ref|XP_011096084.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Sesamum 
indicum]
Length=422

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            R++WIGDL  WMDE YL +CFA+TGEV S KVIRNKQTG SEGYGF+EF SHAAAE+ LQ
Sbjct  87   RSLWIGDLQYWMDEQYLYNCFAATGEVVSAKVIRNKQTGQSEGYGFIEFASHAAAERNLQ  146

Query  586  SYTCILMPNT  615
            +Y   LMPN 
Sbjct  147  TYNGSLMPNV  156



>ref|XP_010327241.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum lycopersicum]
Length=411

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE YL SCFA TGEV S KVIRNKQT  SEGYGF+EF SHAAAE+ 
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  133

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  134  LQAYNGTLMPN  144



>emb|CDP04386.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            R++WIGDL  WMDE YL SCF+ TGEV S KVIRNKQTG SEGYGF+EF SHA AE+ LQ
Sbjct  80   RSLWIGDLQYWMDEQYLLSCFSQTGEVLSAKVIRNKQTGQSEGYGFIEFVSHAGAERNLQ  139

Query  586  SYTCILMPNT  615
            +Y   LMPN 
Sbjct  140  AYNGTLMPNV  149



>ref|XP_004248403.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum lycopersicum]
Length=410

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE YL SCFA TGEV S KVIRNKQT  SEGYGF+EF SHAAAE+ 
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  133

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  134  LQAYNGTLMPN  144



>ref|XP_011096085.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Sesamum 
indicum]
Length=420

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  406  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  585
            R++WIGDL  WMDE YL +CFA+TGEV S KVIRNKQTG SEGYGF+EF SHAAAE+ LQ
Sbjct  87   RSLWIGDLQYWMDEQYLYNCFAATGEVVSAKVIRNKQTGQSEGYGFIEFASHAAAERNLQ  146

Query  586  SYTCILMPNT  615
            +Y   LMPN 
Sbjct  147  TYNGSLMPNV  156



>ref|XP_011092727.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Sesamum indicum]
Length=387

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL +CF+ TGEV S+K+IRNKQTG SE YGFVEF +H AAE  
Sbjct  79   DNKTIWIGDLQQWMDEGYLHACFSQTGEVVSVKIIRNKQTGQSERYGFVEFNTHLAAENV  138

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  139  LQSYNGTMMPN  149



>ref|XP_011092726.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Sesamum indicum]
Length=403

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            +N+TIWIGDL  WMDE YL +CF+ TGEV S+K+IRNKQTG SE YGFVEF +H AAE  
Sbjct  79   DNKTIWIGDLQQWMDEGYLHACFSQTGEVVSVKIIRNKQTGQSERYGFVEFNTHLAAENV  138

Query  580  LQSYTCILMPN  612
            LQSY   +MPN
Sbjct  139  LQSYNGTMMPN  149



>emb|CDY52067.1| BnaA09g53390D [Brassica napus]
Length=419

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            SN EN+TIWIGDL +WMDE+YL SCFA  GE+AS+KVIRNK TG SEGYGFVEF SH  A
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAGEMASVKVIRNKHTGLSEGYGFVEFDSHDIA  143

Query  571  EKALQSYTCILM  606
            EK LQ +  + M
Sbjct  144  EKVLQDFNGVTM  155



>ref|XP_009114049.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Brassica 
rapa]
Length=419

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            SN EN+TIWIGDL +WMDE+YL SCFA  GE+AS+KVIRNK TG SEGYGFVEF SH  A
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAGEMASVKVIRNKHTGLSEGYGFVEFDSHDIA  143

Query  571  EKALQSYTCILM  606
            EK LQ +  + M
Sbjct  144  EKVLQDFNGVTM  155



>ref|XP_004153512.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Cucumis sativus]
Length=176

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  391  SNG-ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            +NG E RT+WIGDL  WMDE+Y+ +CFA TGEV+S+KVIRNKQTG SEGYGF+EF +  A
Sbjct  60   ANGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPA  119

Query  568  AEKALQSYTCILMPN  612
            AE+ LQ+Y    MPN
Sbjct  120  AERVLQTYNGTAMPN  134



>ref|XP_006413118.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
 gb|ESQ54571.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
Length=408

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS GE R++WIGDL  WMDE+YL S FA TGE  S KVIRNKQ+G+SEGYGF+EF SHAA
Sbjct  64   GSAGEIRSLWIGDLQPWMDENYLMSIFALTGEAQSAKVIRNKQSGYSEGYGFIEFVSHAA  123

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+Y    MP++
Sbjct  124  AERILQTYNGAQMPSS  139



>gb|KJB69302.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=294

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  +MDE+YL SCFA TGEVAS+KVIRNKQTG  EGYGF+EF S AAAE+ 
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147

Query  580  LQSYTCILMPN  612
            LQ+Y    MPN
Sbjct  148  LQTYNGTPMPN  158



>ref|XP_004232721.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=413

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E R++WIGDL  WMDE YL +CFA TGEV S KVIRNKQ+G SEGYGF+EF SHAAAE+ 
Sbjct  77   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVTSAKVIRNKQSGQSEGYGFIEFISHAAAERN  136

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  137  LQAYNGTLMPN  147



>sp|Q9LEB4.1|RBP45_NICPL RecName: Full=Polyadenylate-binding protein RBP45; Short=Poly(A)-binding 
protein RBP45; AltName: Full=RNA-binding protein 
45; Short=NplRBP45 [Nicotiana plumbaginifolia]
 emb|CAC01237.1| RNA Binding Protein 45 [Nicotiana plumbaginifolia]
Length=409

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G+  E R++WIGDL  WMDE+YL +CF  TGE+ S KVIRNKQTG SEGYGF+EF SHAA
Sbjct  78   GNPNEVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAA  137

Query  568  AEKALQSYTCILMPNT  615
            AE  LQ+Y   LMPN 
Sbjct  138  AETILQTYNGTLMPNV  153



>ref|XP_009600135.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana tomentosiformis]
Length=410

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G+  E R++WIGDL  WMDE+YL +CF  TGE+ S KVIRNKQTG SEGYGF+EF SHAA
Sbjct  79   GNPNEVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAA  138

Query  568  AEKALQSYTCILMPNT  615
            AE  LQ+Y   LMPN 
Sbjct  139  AETILQTYNGTLMPNV  154



>emb|CDY66423.1| BnaAnng22220D [Brassica napus]
Length=426

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS  E R++WIGDL  WMDE+YL + F+ TGEV   KVIRNKQ+G+SEGYGF+EF SHAA
Sbjct  67   GSGDEIRSLWIGDLQPWMDENYLVNSFSITGEVQQAKVIRNKQSGYSEGYGFIEFVSHAA  126

Query  568  AEKALQSYTCILMPNT  615
            AE+ LQ+Y   LMPN+
Sbjct  127  AERILQTYNGALMPNS  142



>ref|XP_009795696.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana sylvestris]
Length=409

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            G+  E R++WIGDL  WMDE+YL +CF  TGE+ S KVIRNKQTG SEGYGF+EF SHAA
Sbjct  78   GNPNEVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAA  137

Query  568  AEKALQSYTCILMPNT  615
            AE  LQ+Y   LMPN 
Sbjct  138  AETILQTYNGTLMPNV  153



>gb|KFK27100.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=407

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS+GE R++WIGDL  WMDE+YL S FA +GEV S+KVIRNKQ+G +EGYGF+EF +HAA
Sbjct  68   GSDGEIRSLWIGDLQPWMDENYLNSIFAQSGEVQSVKVIRNKQSGQTEGYGFIEFANHAA  127

Query  568  AEKALQSYTCILMPN  612
            AE+ LQSY    MP+
Sbjct  128  AERFLQSYNGTPMPS  142



>gb|KFK27101.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=405

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  388  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            GS+GE R++WIGDL  WMDE+YL S FA +GEV S+KVIRNKQ+G +EGYGF+EF +HAA
Sbjct  68   GSDGEIRSLWIGDLQPWMDENYLNSIFAQSGEVQSVKVIRNKQSGQTEGYGFIEFANHAA  127

Query  568  AEKALQSYTCILMPN  612
            AE+ LQSY    MP+
Sbjct  128  AERFLQSYNGTPMPS  142



>ref|XP_001784132.1| predicted protein [Physcomitrella patens]
 gb|EDQ51056.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E +T+W+GDL  WMDE+YL + F  TGEV S+K+IRNKQTG+SEGYGFVEF SH AAEK 
Sbjct  41   EVKTLWVGDLQYWMDENYLHTAFVHTGEVQSVKIIRNKQTGYSEGYGFVEFVSHVAAEKI  100

Query  580  LQSYTCILMPNT  615
            LQ+Y    MPNT
Sbjct  101  LQAYNGTQMPNT  112



>ref|XP_006352617.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum tuberosum]
Length=412

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE YL +CFA TGEV S KVIRNKQT  SEGYGF+EF SHAAAE+ 
Sbjct  75   EVRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  134

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  135  LQAYNGTLMPN  145



>ref|XP_006352618.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum tuberosum]
Length=411

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE YL +CFA TGEV S KVIRNKQT  SEGYGF+EF SHAAAE+ 
Sbjct  75   EVRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  134

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  135  LQAYNGTLMPN  145



>gb|KJB69305.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=286

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  +MDE+YL SCFA TGEVAS+KVIRNKQTG  EGYGF+EF S AAAE+ 
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147

Query  580  LQSYTCILMPN  612
            LQ+Y    MPN
Sbjct  148  LQTYNGTPMPN  158



>ref|XP_009614215.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=415

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE YL +CFA TGEV S KVIRNKQT  SEGYGF+EF SHAAAE+ 
Sbjct  78   EIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  137

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  138  LQAYNGTLMPN  148



>ref|XP_002973844.1| hypothetical protein SELMODRAFT_100454 [Selaginella moellendorffii]
 ref|XP_002983548.1| hypothetical protein SELMODRAFT_118305 [Selaginella moellendorffii]
 gb|EFJ15449.1| hypothetical protein SELMODRAFT_118305 [Selaginella moellendorffii]
 gb|EFJ24799.1| hypothetical protein SELMODRAFT_100454 [Selaginella moellendorffii]
Length=350

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  564
            G +NGE +T+W+GDL  WMDE YL SCFA T EV   KVIRNKQTG+SEGYGFVEF +H+
Sbjct  14   GHANGELKTLWVGDLQYWMDEGYLYSCFAHTSEVQVAKVIRNKQTGYSEGYGFVEFTNHS  73

Query  565  AAEKALQSYTCILMPNT  615
             AEK LQS+    MP+T
Sbjct  74   TAEKVLQSFNGTQMPST  90



>ref|XP_009776429.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=415

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S  E RT+WIGDL  WMDE YL +CFA TGEV S KVIRNKQT  SEGYGF+EF SHAAA
Sbjct  75   SADEIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAA  134

Query  571  EKALQSYTCILMPN  612
            E+ LQ+Y   LMPN
Sbjct  135  ERNLQAYNGTLMPN  148



>gb|KJB69304.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=292

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  +MDE+YL SCFA TGEVAS+KVIRNKQTG  EGYGF+EF S AAAE+ 
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147

Query  580  LQSYTCILMPN  612
            LQ+Y    MPN
Sbjct  148  LQTYNGTPMPN  158



>ref|XP_009776437.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=414

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S  E RT+WIGDL  WMDE YL +CFA TGEV S KVIRNKQT  SEGYGF+EF SHAAA
Sbjct  75   SADEIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAA  134

Query  571  EKALQSYTCILMPN  612
            E+ LQ+Y   LMPN
Sbjct  135  ERNLQAYNGTLMPN  148



>emb|CDX70874.1| BnaC03g09580D [Brassica napus]
Length=430

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  W+DE+YL SCF+ TGE+ S+KVIRNK TG  EGYGF+EF SHAAAE+ 
Sbjct  21   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAERT  80

Query  580  LQSYTCILMPNT  615
            LQ+Y   LMP T
Sbjct  81   LQTYNGTLMPGT  92



>gb|KJB81765.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=286

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  394  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  573
            +GE R++WIGDL  WMDE+YL + FA TGEV S KVIRNKQT   EGYGF+EF S AAAE
Sbjct  78   SGEIRSLWIGDLQPWMDENYLMNIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSQAAAE  137

Query  574  KALQSYTCILMPNT  615
            + LQSY  + MPN+
Sbjct  138  RVLQSYNGVPMPNS  151



>ref|XP_007153936.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
 gb|ESW25930.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
Length=398

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  WMDE+YL +CFA TGEVAS+KVIRNKQT  SEGYGF+EF S A AE+ 
Sbjct  61   EVRTLWIGDLQYWMDENYLYTCFAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAGAERI  120

Query  580  LQSYTCILMPN  612
            LQ+Y   +MPN
Sbjct  121  LQTYNGTIMPN  131



>ref|XP_006348103.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=413

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E R++WIGDL  WMDE Y+ +CFA TGEV S KVIRNKQ+G SEGYGF+EF SHAAAE+ 
Sbjct  77   EIRSLWIGDLQFWMDEQYILNCFAQTGEVTSAKVIRNKQSGQSEGYGFIEFISHAAAERN  136

Query  580  LQSYTCILMPN  612
            LQ+Y   LMPN
Sbjct  137  LQAYNGTLMPN  147



>ref|XP_010278713.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nelumbo 
nucifera]
Length=310

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  391  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  570
            S  E RT+WIGDL  WM+E Y+ SCFA TGEVAS+KVIRNKQTG SEGYGF+EF +  AA
Sbjct  92   SADEVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAA  151

Query  571  EKALQSYTCILMPN  612
            E+ LQ+Y   LMPN
Sbjct  152  ERILQTYNGTLMPN  165



>ref|XP_010673626.1| PREDICTED: polyadenylate-binding protein RBP47B' [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  400  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  579
            E RT+WIGDL  W+DE Y+ SCFA TGEV S+KVIRNK TG  EGYGFVEF SHAAAE+ 
Sbjct  14   EVRTLWIGDLQIWVDESYIHSCFAQTGEVISVKVIRNKITGHPEGYGFVEFVSHAAAERV  73

Query  580  LQSYTCILMPNT  615
            LQSY    MP T
Sbjct  74   LQSYNGTPMPGT  85



>ref|XP_004158014.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Cucumis 
sativus]
Length=260

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  391  SNG-ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  567
            +NG E RT+WIGDL  WMDE+Y+ +CFA TGEV+S+KVIRNKQTG SEGYGF+EF +  A
Sbjct  60   ANGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPA  119

Query  568  AEKALQSYTCILMPN  612
            AE+ LQ+Y    MPN
Sbjct  120  AERVLQTYNGTAMPN  134



Lambda      K        H        a         alpha
   0.311    0.126    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090