BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051F22

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795521.1|  PREDICTED: photosystem I reaction center sub...    220   5e-69   Nicotiana sylvestris
ref|XP_004241054.2|  PREDICTED: photosystem I reaction center sub...    219   1e-68   
ref|XP_009621208.1|  PREDICTED: photosystem I reaction center sub...    219   1e-68   Nicotiana tomentosiformis
ref|XP_006356675.1|  PREDICTED: photosystem I reaction center sub...    218   7e-68   Solanum tuberosum [potatoes]
ref|XP_009799304.1|  PREDICTED: photosystem I reaction center sub...    214   2e-66   Nicotiana sylvestris
ref|XP_011090732.1|  PREDICTED: photosystem I reaction center sub...    212   9e-66   Sesamum indicum [beniseed]
ref|XP_009366924.1|  PREDICTED: photosystem I reaction center sub...    211   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_008340966.1|  PREDICTED: photosystem I reaction center sub...    211   2e-65   Malus domestica [apple tree]
gb|AGV54746.1|  photosystem I reaction center subunit II chloropl...    210   4e-65   Phaseolus vulgaris [French bean]
ref|XP_007143239.1|  hypothetical protein PHAVU_007G055900g             210   4e-65   Phaseolus vulgaris [French bean]
ref|XP_011071575.1|  PREDICTED: photosystem I reaction center sub...    211   4e-65   Sesamum indicum [beniseed]
ref|XP_008376830.1|  PREDICTED: photosystem I reaction center sub...    210   5e-65   Malus domestica [apple tree]
gb|EYU41499.1|  hypothetical protein MIMGU_mgv1a013699mg                210   5e-65   Erythranthe guttata [common monkey flower]
gb|EYU45647.1|  hypothetical protein MIMGU_mgv1a013850mg                209   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_010035248.1|  PREDICTED: photosystem I reaction center sub...    209   2e-64   Eucalyptus grandis [rose gum]
ref|XP_009588197.1|  PREDICTED: photosystem I reaction center sub...    208   2e-64   Nicotiana tomentosiformis
ref|XP_008224535.1|  PREDICTED: photosystem I reaction center sub...    209   2e-64   Prunus mume [ume]
ref|XP_002281825.1|  PREDICTED: photosystem I reaction center sub...    207   4e-64   Vitis vinifera
ref|XP_004296896.1|  PREDICTED: photosystem I reaction center sub...    207   8e-64   Fragaria vesca subsp. vesca
ref|XP_003556041.1|  PREDICTED: photosystem I reaction center sub...    206   1e-63   Glycine max [soybeans]
ref|NP_001235355.1|  photosystem I subunit PsaD                         206   3e-63   Glycine max [soybeans]
gb|AFK43504.1|  unknown                                                 206   3e-63   Lotus japonicus
ref|NP_001275862.1|  PSI reaction center subunit II                     204   1e-62   Citrus sinensis [apfelsine]
ref|XP_006419899.1|  hypothetical protein CICLE_v10005892mg             204   1e-62   Citrus clementina [clementine]
ref|XP_003610706.1|  Photosystem I reaction center subunit II           204   2e-62   Medicago truncatula
gb|ABK96621.1|  unknown                                                 203   2e-62   Populus trichocarpa x Populus deltoides
ref|XP_010277521.1|  PREDICTED: photosystem I reaction center sub...    203   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010935005.1|  PREDICTED: photosystem I reaction center sub...    202   6e-62   Elaeis guineensis
emb|CDO99040.1|  unnamed protein product                                202   7e-62   Coffea canephora [robusta coffee]
ref|XP_002315779.1|  photosystem I 20kD family protein                  201   9e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002516772.1|  Photosystem I reaction center subunit II, ch...    201   1e-61   Ricinus communis
ref|XP_004511355.1|  PREDICTED: photosystem I reaction center sub...    201   2e-61   Cicer arietinum [garbanzo]
ref|XP_009344083.1|  PREDICTED: photosystem I reaction center sub...    200   4e-61   Pyrus x bretschneideri [bai li]
ref|XP_008802683.1|  PREDICTED: photosystem I reaction center sub...    200   5e-61   Phoenix dactylifera
ref|XP_011026306.1|  PREDICTED: photosystem I reaction center sub...    199   8e-61   Populus euphratica
ref|XP_010108011.1|  Photosystem I reaction center subunit II           199   1e-60   
ref|XP_002311618.2|  photosystem I 20kD family protein                  199   1e-60   Populus trichocarpa [western balsam poplar]
gb|EPS62726.1|  hypothetical protein M569_12065                         196   1e-59   Genlisea aurea
ref|XP_011021547.1|  PREDICTED: photosystem I reaction center sub...    196   1e-59   Populus euphratica
ref|XP_011015859.1|  PREDICTED: photosystem I reaction center sub...    196   2e-59   Populus euphratica
emb|CDY21916.1|  BnaC09g00220D                                          198   2e-59   Brassica napus [oilseed rape]
ref|XP_010256006.1|  PREDICTED: photosystem I reaction center sub...    196   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_007034724.1|  Photosystem I subunit D-2                          196   2e-59   Theobroma cacao [chocolate]
ref|XP_007050585.1|  Photosystem I subunit D-2                          195   3e-59   
ref|XP_004134141.1|  PREDICTED: photosystem I reaction center sub...    195   4e-59   Cucumis sativus [cucumbers]
ref|XP_006306434.1|  hypothetical protein CARUB_v10012376mg             195   4e-59   Capsella rubella
ref|XP_006838247.1|  hypothetical protein AMTR_s00103p00041210          194   5e-59   Amborella trichopoda
ref|XP_006288687.1|  hypothetical protein CARUB_v10001997mg             194   6e-59   Capsella rubella
ref|XP_010474926.1|  PREDICTED: photosystem I reaction center sub...    194   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009111256.1|  PREDICTED: photosystem I reaction center sub...    194   7e-59   Brassica rapa
ref|XP_002892148.1|  hypothetical protein ARALYDRAFT_887465             194   1e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_010481602.1|  PREDICTED: photosystem I reaction center sub...    193   2e-58   
gb|AFV94477.1|  photosystem I reaction center subunit II                193   2e-58   Saccharum hybrid cultivar GT28
ref|NP_001062511.1|  Os08g0560900                                       193   2e-58   
ref|NP_171812.1|  photosystem I reaction center subunit D-2             193   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42673.1|  hypothetical protein AALP_AA1G025000                    192   5e-58   Arabis alpina [alpine rockcress]
ref|XP_010456951.1|  PREDICTED: photosystem I reaction center sub...    192   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010424650.1|  PREDICTED: photosystem I reaction center sub...    192   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010430302.1|  PREDICTED: photosystem I reaction center sub...    192   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010422538.1|  PREDICTED: photosystem I reaction center sub...    192   7e-58   Camelina sativa [gold-of-pleasure]
gb|KJB28316.1|  hypothetical protein B456_005G042000                    192   8e-58   Gossypium raimondii
ref|NP_192186.1|  photosystem I subunit D-1                             192   8e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396500.1|  hypothetical protein EUTSA_v10029178mg             192   8e-58   
ref|XP_008438687.1|  PREDICTED: photosystem I reaction center sub...    191   9e-58   Cucumis melo [Oriental melon]
ref|XP_010424649.1|  PREDICTED: photosystem I reaction center sub...    192   1e-57   
gb|AAM66066.1|  putative photosystem I reaction center subunit II...    191   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ACF05884.1|  chloroplast photosystem I protein                       190   1e-57   Populus tremula [European aspen]
gb|ACF05868.1|  chloroplast photosystem I protein                       190   1e-57   Populus tremula [European aspen]
ref|XP_010522735.1|  PREDICTED: photosystem I reaction center sub...    191   1e-57   Tarenaya hassleriana [spider flower]
ref|NP_001275788.1|  PSI reaction center subunit II                     191   1e-57   Citrus sinensis [apfelsine]
gb|ACF05876.1|  chloroplast photosystem I protein                       189   1e-57   Populus tremula [European aspen]
ref|XP_009396832.1|  PREDICTED: photosystem I reaction center sub...    192   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002278284.1|  PREDICTED: photosystem I reaction center sub...    191   2e-57   Vitis vinifera
gb|ACF05859.1|  chloroplast photosystem I protein                       189   2e-57   Populus tremula [European aspen]
gb|ACF05855.1|  chloroplast photosystem I protein                       189   2e-57   Populus tremula [European aspen]
emb|CAB52677.1|  photosystem I subunit II precursor                     191   2e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CAN61448.1|  hypothetical protein VITISV_024141                     190   2e-57   Vitis vinifera
ref|XP_010542866.1|  PREDICTED: photosystem I reaction center sub...    191   2e-57   Tarenaya hassleriana [spider flower]
gb|ACF05871.1|  chloroplast photosystem I protein                       189   2e-57   Populus tremula [European aspen]
ref|XP_006444053.1|  hypothetical protein CICLE_v10022248mg             190   3e-57   Citrus clementina [clementine]
gb|KDO68707.1|  hypothetical protein CISIN_1g047658mg                   191   4e-57   Citrus sinensis [apfelsine]
gb|KJB23065.1|  hypothetical protein B456_004G079200                    191   5e-57   Gossypium raimondii
gb|KJB46980.1|  hypothetical protein B456_008G004100                    189   6e-57   Gossypium raimondii
gb|ACN40159.1|  unknown                                                 187   7e-57   Picea sitchensis
ref|XP_010474916.1|  PREDICTED: photosystem I reaction center sub...    191   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002872810.1|  hypothetical protein ARALYDRAFT_490280             189   8e-57   
ref|XP_004981348.1|  PREDICTED: photosystem I reaction center sub...    191   9e-57   
ref|XP_010474917.1|  PREDICTED: photosystem I reaction center sub...    190   1e-56   
gb|KFK30882.1|  hypothetical protein AALP_AA6G038200                    189   1e-56   Arabis alpina [alpine rockcress]
emb|CAA68728.1|  unnamed protein product                                189   1e-56   Spinacia oleracea
gb|KDP21451.1|  hypothetical protein JCGZ_21922                         188   1e-56   Jatropha curcas
ref|XP_002520727.1|  Photosystem I reaction center subunit II, ch...    188   2e-56   Ricinus communis
emb|CAA32182.1|  unnamed protein product                                188   2e-56   Spinacia oleracea
sp|P12353.2|PSAD_SPIOL  RecName: Full=Photosystem I reaction cent...    187   4e-56   Spinacia oleracea
gb|ABK21867.1|  unknown                                                 187   8e-56   Picea sitchensis
ref|XP_009400838.1|  PREDICTED: photosystem I reaction center sub...    186   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK21314.1|  unknown                                                 187   1e-55   Picea sitchensis
ref|XP_010681150.1|  PREDICTED: photosystem I reaction center sub...    186   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001130880.1|  photosystem I reaction center subunit II           185   2e-55   Zea mays [maize]
pdb|4RKU|D  Chain D, Crystal Structure Of Plant Photosystem I At ...    181   1e-54   Pisum sativum [garden pea]
sp|P36213.1|PSAD_HORVU  RecName: Full=Photosystem I reaction cent...    183   1e-54   Hordeum vulgare [barley]
gb|ACG41754.1|  photosystem I reaction center subunit II                183   1e-54   Zea mays [maize]
gb|ACG25364.1|  photosystem I reaction center subunit II                183   1e-54   Zea mays [maize]
ref|XP_003564108.1|  PREDICTED: photosystem I reaction center sub...    183   2e-54   Brachypodium distachyon [annual false brome]
pdb|2WSC|D  Chain D, Improved Model Of Plant Photosystem I              183   2e-54   Spinacia oleracea
gb|AFW67274.1|  photosystem I reaction center subunit II                184   3e-54   
ref|XP_002991814.1|  hypothetical protein SELMODRAFT_26984              177   4e-53   
ref|XP_001751403.1|  predicted protein                                  178   6e-53   
ref|XP_001768962.1|  predicted protein                                  177   8e-53   
pdb|3LW5|D  Chain D, Improved Model Of Plant Photosystem I              176   1e-52   unidentified
ref|XP_001752431.1|  predicted protein                                  179   1e-52   
ref|XP_001765579.1|  predicted protein                                  175   5e-52   
emb|CAA54744.1|  psaD                                                   176   7e-52   Spinacia oleracea
pdb|2O01|D  Chain D, The Structure Of A Plant Photosystem I Super...    173   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KHN02708.1|  Photosystem I reaction center subunit II, chlorop...    167   9e-48   Glycine soja [wild soybean]
ref|XP_005647040.1|  PSI-D1 precursor                                   160   1e-45   Coccomyxa subellipsoidea C-169
ref|XP_011400522.1|  Photosystem I reaction center subunit II, ch...    158   8e-45   Auxenochlorella protothecoides
ref|XP_002992973.1|  hypothetical protein SELMODRAFT_448960             167   2e-44   
gb|KIZ01091.1|  Photosystem I reaction center subunit II, chlorop...    156   3e-44   Monoraphidium neglectum
ref|XP_002953316.1|  hypothetical protein VOLCADRAFT_121148             155   5e-44   Volvox carteri f. nagariensis
ref|XP_003063552.1|  photosystem I subunit II, chloroplast precursor    156   9e-44   Micromonas pusilla CCMP1545
ref|XP_002504652.1|  photosystem I subunit II, chloroplast precursor    155   1e-43   Micromonas commoda
ref|XP_003592408.1|  Photosystem I reaction center subunit II           154   3e-43   
gb|KIZ02718.1|  Photosystem I reaction center subunit II, chlorop...    153   3e-43   Monoraphidium neglectum
ref|XP_007226637.1|  hypothetical protein PRUPE_ppa022366mg             153   7e-43   
gb|ABK96248.1|  unknown                                                 151   1e-42   Populus trichocarpa x Populus deltoides
ref|XP_007511428.1|  predicted protein                                  152   1e-42   Bathycoccus prasinos
emb|CEG01861.1|  Photosystem I PsaD                                     151   3e-42   Ostreococcus tauri
gb|EMS56878.1|  Photosystem I reaction center subunit II, chlorop...    148   1e-41   Triticum urartu
ref|XP_005847397.1|  hypothetical protein CHLNCDRAFT_35549              149   2e-41   Chlorella variabilis
ref|XP_001697722.1|  photosystem I reaction center subunit II, 20...    149   3e-41   Chlamydomonas reinhardtii
ref|XP_001421350.1|  psaD, PSI-D, subunit II, photosystem I protein     146   2e-40   Ostreococcus lucimarinus CCE9901
emb|CAL25356.1|  photosystem I reaction center subunit II               143   4e-40   Platanus x hispanica [London plane tree]
sp|Q9T4W8.1|PSAD_CYAPA  RecName: Full=Photosystem I reaction cent...    143   8e-39   Cyanophora paradoxa
emb|CBI26230.3|  unnamed protein product                                136   7e-37   Vitis vinifera
ref|YP_009029191.1|  photosystem I reaction center subunit II           135   7e-37   Didymosphenia geminata
ref|YP_004376584.1|  photosystem I ferredoxin-binding protein           135   7e-37   Fistulifera solaris
ref|WP_009769007.1|  PsaD protein                                       135   8e-37   Oscillatoriales cyanobacterium JSC-12
ref|YP_003734986.1|  photosystem I protein subunit II                   135   1e-36   Durinskia baltica
ref|YP_003734548.1|  ferredoxin-binding protein II                      135   2e-36   Kryptoperidinium foliaceum
ref|YP_009029026.1|  photosystem I reaction center subunit II           134   2e-36   Cylindrotheca closterium
ref|YP_009059209.1|  photosystem I reaction center subunit II           134   2e-36   Eunotia naegelii
ref|YP_005089671.1|  psaD gene product                                  134   2e-36   Ulnaria acus
ref|YP_009093018.1|  photosystem I subunit II                           134   3e-36   Rhizosolenia imbricata
ref|YP_009029302.1|  photosystem I reaction center subunit II           133   5e-36   Leptocylindrus danicus
ref|YP_874394.1|  photosystem I ferredoxin-binding protein              133   6e-36   Phaeodactylum tricornutum
ref|YP_009092872.1|  photosystem I subunit II                           133   6e-36   Chaetoceros simplex
ref|YP_009093339.1|  photosystem I subunit II                           133   8e-36   Cerataulina daemon
ref|YP_009029445.1|  photosystem I reaction center subunit II           133   9e-36   Lithodesmium undulatum
ref|WP_016872271.1|  MULTISPECIES: Photosystem I reaction center ...    133   9e-36   Fischerella thermalis
ref|NP_043647.1|  photosystem I subunit II                              133   9e-36   Trieres chinensis
ref|YP_009019626.1|  photosystem I reaction center subunit II           133   1e-35   Gracilaria salicornia
ref|YP_009028878.1|  photosystem I reaction center subunit II           132   1e-35   Coscinodiscus radiatus
gb|EHC11738.1|  photosystem I protein PsaD                              133   2e-35   Fischerella thermalis
gb|AFR24825.1|  photosystem I reaction center subunit II                132   2e-35   uncultured Pelagomonas
ref|WP_028824843.1|  Photosystem I reaction center subunit II           132   2e-35   
ref|YP_003002042.1|  photosystem I reaction center subunit II           131   3e-35   Aureococcus anophagefferens
ref|WP_017321535.1|  Photosystem I reaction center subunit II           131   3e-35   cyanobacterium PCC 7702
ref|YP_001936347.1|  photosystem I subunit II                           131   4e-35   Heterosigma akashiwo
ref|WP_016876091.1|  Photosystem I reaction center subunit II           131   4e-35   Chlorogloeopsis fritschii
gb|KCW60797.1|  hypothetical protein EUGRSUZ_H03534                     132   4e-35   Eucalyptus grandis [rose gum]
ref|YP_009028619.1|  photosystem I reaction center subunit II           131   4e-35   Asterionella formosa
ref|WP_026795097.1|  MULTISPECIES: Photosystem I reaction center ...    131   5e-35   Planktothrix
ref|WP_008189408.1|  PsaD                                               131   6e-35   Moorea producens
ref|WP_017300022.1|  Photosystem I reaction center subunit II           130   6e-35   Nodosilinea nodulosa
ref|YP_001293570.1|  photosystem I subunit II                           130   7e-35   Rhodomonas salina
ref|YP_009093191.1|  photosystem I subunit II                           130   7e-35   Roundia cardiophora
ref|YP_009028747.1|  photosystem I reaction center subunit II           130   7e-35   Asterionellopsis glacialis
ref|YP_009093464.1|  photosystem I subunit II                           130   8e-35   Conticribra weissflogii
ref|WP_018400163.1|  Photosystem I reaction center subunit II           130   8e-35   filamentous cyanobacterium ESFC-1
ref|NP_050759.1|  photosystem I subunit II                              130   8e-35   Guillardia theta
ref|YP_874547.1|  photosystem I ferredoxin-binding protein              130   9e-35   Thalassiosira pseudonana
gb|AIA21513.1|  photosystem I subunit II                                130   1e-34   Pyropia fucicola
ref|YP_007947808.1|  photosystem I subunit II                           130   1e-34   Pyropia haitanensis
ref|YP_536961.1|  photosystem I subunit II                              130   1e-34   Pyropia yezoensis
gb|AJO68451.1|  photosystem I subunit II                                130   1e-34   Gracilariopsis lemaneiformis
ref|WP_009787700.1|  photosystem I subunit II                           130   1e-34   Lyngbya sp. PCC 8106
ref|WP_023068767.1|  photosystem I reaction center subunit II           130   1e-34   Lyngbya aestuarii
ref|WP_026733629.1|  Photosystem I reaction center subunit II           130   1e-34   Fischerella sp. PCC 9605
gb|AFC39948.1|  photosystem I subunit II                                129   2e-34   Porphyra umbilicalis
ref|YP_008965721.1|  photosystem I reaction center subunit II           129   2e-34   Porphyridium purpureum
sp|O96800.1|PSAD_SKECO  RecName: Full=Photosystem I reaction cent...    129   2e-34   Skeletonema costatum
ref|WP_015145740.1|  PsaD                                               129   2e-34   Pleurocapsales
ref|NP_053889.1|  photosystem I subunit II                              129   2e-34   Porphyra purpurea
gb|AIR75448.1|  photosystem I subunit II                                129   3e-34   Cyclotella sp. L04_2
ref|WP_016866973.1|  Photosystem I reaction center subunit II           129   3e-34   Fischerella muscicola
ref|YP_003002181.1|  photosystem I reaction center subunit II           129   3e-34   Aureoumbra lagunensis
ref|WP_008312724.1|  PsaD                                               129   3e-34   Leptolyngbya sp. PCC 6406
ref|YP_008144865.1|  photosystem I reaction center subunit II           129   3e-34   Grateloupia taiwanensis
ref|WP_015173693.1|  photosystem I protein PsaD                         128   5e-34   Geitlerinema sp. PCC 7407
ref|WP_006616635.1|  MULTISPECIES: photosystem I protein PsaD           128   5e-34   Arthrospira
ref|WP_026788324.1|  MULTISPECIES: Photosystem I reaction center ...    128   8e-34   Planktothrix
gb|AIA21307.1|  photosystem I subunit II                                128   9e-34   Pyropia kanakaensis
ref|WP_017662216.1|  Photosystem I reaction center subunit II           127   1e-33   Geitlerinema sp. PCC 7105
ref|WP_011613167.1|  photosystem I protein PsaD                         127   1e-33   Trichodesmium erythraeum
ref|WP_035996822.1|  Photosystem I reaction center subunit II           127   1e-33   [Leptolyngbya] sp. JSC-1
ref|WP_015195039.1|  photosystem I protein PsaD                         127   2e-33   Stanieria cyanosphaera
ref|WP_035986603.1|  Photosystem I reaction center subunit II           127   2e-33   Leptolyngbya sp. KIOST-1
ref|YP_063618.1|  photosystem I subunit II                              127   2e-33   Gracilaria tenuistipitata var. liui
ref|WP_015182846.1|  PsaD                                               127   2e-33   Microcoleus sp. PCC 7113
ref|WP_017304392.1|  Photosystem I reaction center subunit II           126   3e-33   Spirulina subsalsa
ref|YP_009027562.1|  photosystem I subunit II                           126   3e-33   Pyropia perforata
gb|AIA20054.1|  photosystem I subunit II                                126   3e-33   Pyropia perforata
ref|WP_019505782.1|  Photosystem I reaction center subunit II           126   4e-33   Pleurocapsa sp. PCC 7319
ref|WP_013323038.1|  photosystem I protein PsaD                         126   5e-33   Cyanothece sp. PCC 7822
ref|YP_007627400.1|  photosystem I subunit II                           125   5e-33   Chondrus crispus [carageen]
ref|YP_005088653.1|  photosystem I subunit II                           125   5e-33   Phaeocystis antarctica
gb|AAP79147.1|  photosystem I protein PsaD                              129   7e-33   Bigelowiella natans
gb|EDX77926.1|  photosystem I reaction center subunit II                126   7e-33   Coleofasciculus chthonoplastes PCC 7420
ref|WP_044204978.1|  Photosystem I reaction center subunit II           125   7e-33   Coleofasciculus chthonoplastes
ref|YP_004072560.1|  photosystem I reaction center subunit II           125   8e-33   Thalassiosira oceanica CCMP1005
ref|WP_006632802.1|  photosystem I protein PsaD                         125   8e-33   Microcoleus vaginatus
ref|YP_008145427.1|  photosystem I subunit II                           125   8e-33   Phaeocystis globosa
ref|WP_012165369.1|  photosystem I protein PsaD                         125   9e-33   Acaryochloris marina
ref|WP_010468189.1|  photosystem I protein PsaD                         125   1e-32   Acaryochloris sp. CCMEE 5410
gb|ACF24542.1|  photosystem I reaction center subunit II                129   1e-32   Gymnochlora stellata
ref|WP_026721381.1|  Photosystem I reaction center subunit II           124   1e-32   Hapalosiphonaceae
ref|WP_017309650.1|  Photosystem I reaction center subunit II           124   1e-32   Fischerella sp. PCC 9339
ref|WP_006509381.1|  PsaD                                               124   2e-32   Xenococcus sp. PCC 7305
gb|AHY04349.1|  photosystem I reaction center subunit II                124   2e-32   Chrysochromulina sp. CCMP291
ref|WP_017715328.1|  Photosystem I reaction center subunit II           124   2e-32   Oscillatoria sp. PCC 10802
ref|WP_015157762.1|  PsaD                                               124   2e-32   Chamaesiphon minutus
ref|WP_007305646.1|  Photosystem I protein PsaD                         124   2e-32   Crocosphaera watsonii
ref|WP_036530202.1|  Photosystem I reaction center subunit II           124   3e-32   Neosynechococcus sphagnicola
ref|WP_017288063.1|  Photosystem I reaction center subunit II           124   3e-32   Leptolyngbya boryana
ref|WP_007356552.1|  MULTISPECIES: photosystem I protein PsaD           124   3e-32   Kamptonema
ref|WP_041622790.1|  Photosystem I reaction center subunit II           124   3e-32   Oscillatoria nigro-viridis
emb|CDY22079.1|  BnaA09g01080D                                          124   4e-32   Brassica napus [oilseed rape]
ref|YP_007878240.1|  photosystem I subunit II                           123   4e-32   Calliarthron tuberculosum
ref|WP_015124443.1|  PsaD                                               123   4e-32   Synechococcus sp. PCC 6312
ref|WP_016859046.1|  Photosystem I reaction center subunit II           123   4e-32   Fischerella muscicola
gb|AFZ10051.1|  photosystem I protein PsaD                              124   5e-32   Oscillatoria nigro-viridis PCC 7112
ref|YP_277398.1|  photosystem I subunit II                              123   6e-32   Emiliania huxleyi
ref|YP_009051089.1|  photosystem I subunit II                           123   6e-32   Galdieria sulphuraria
gb|AJH65942.1|  photosystem I reaction center subunit II                123   7e-32   Vertebrata lanosa
ref|WP_012629607.1|  photosystem I protein PsaD                         122   1e-31   Cyanothece sp. PCC 7425
gb|EDX84590.1|  photosystem I reaction center subunit II                122   2e-31   Synechococcus sp. PCC 7335
ref|WP_038016768.1|  Photosystem I reaction center subunit II           122   2e-31   
ref|WP_015956499.1|  photosystem I protein PsaD                         121   2e-31   Cyanothece sp. PCC 7424
ref|WP_010871317.1|  photosystem I subunit II                           121   2e-31   Synechocystis
ref|WP_012593753.1|  MULTISPECIES: photosystem I protein PsaD           121   4e-31   Cyanothece
ref|WP_039725494.1|  MULTISPECIES: Photosystem I reaction center ...    120   5e-31   Lyngbya confervoides
ref|WP_009544162.1|  MULTISPECIES: photosystem I protein PsaD           120   6e-31   Cyanothece
ref|WP_006530712.1|  PsaD                                               120   7e-31   Gloeocapsa sp. PCC 73106
ref|WP_028947468.1|  Photosystem I reaction center subunit II           120   7e-31   Synechocystis sp. PCC 6714
ref|WP_027844942.1|  Photosystem I reaction center subunit II           120   9e-31   Mastigocoleus testarum
ref|WP_002738785.1|  photosystem I reaction center subunit II           120   1e-30   Microcystis aeruginosa
ref|WP_006275750.1|  MULTISPECIES: Photosystem I protein PsaD           119   1e-30   Aphanizomenonaceae
dbj|GAL93034.1|  photosystem I subunit II (PsaD)                        119   1e-30   Microcystis aeruginosa NIES-44
ref|WP_002796771.1|  Photosystem I reaction center subunit II           119   1e-30   Microcystis
ref|WP_016924991.1|  Photosystem I reaction center subunit II           119   1e-30   Prochlorothrix hollandica
ref|YP_003289238.1|  Photosystem I reaction center subunit II           119   1e-30   Ectocarpus siliculosus
ref|WP_015224168.1|  photosystem I protein PsaD                         119   2e-30   Halothece sp. PCC 7418
gb|ACB50691.1|  photosystem I reaction center subunit II                120   2e-30   Cyanothece sp. ATCC 51142
ref|WP_015231048.1|  PsaD                                               119   2e-30   Dactylococcopsis salina
ref|WP_011377824.1|  MULTISPECIES: photosystem I reaction center ...    119   2e-30   Synechococcus
ref|WP_024124772.1|  photosystem I subunit II PsaD                      119   3e-30   Thermosynechococcus sp. NK55a
ref|WP_040933357.1|  Photosystem I reaction center subunit II           119   3e-30   
pir||PL0034  photosystem I chain II - Synechococcus sp. (PCC 6301...    117   3e-30
ref|WP_015222401.1|  photosystem I protein PsaD                         119   3e-30   
ref|WP_040938870.1|  Photosystem I reaction center subunit II           118   3e-30   
ref|WP_040944569.1|  Photosystem I reaction center subunit II           118   4e-30   
gb|AFY74121.1|  PsaD                                                    119   5e-30   Synechococcus sp. PCC 7502
ref|YP_002327575.1|  PSI reaction center subunit II                     118   5e-30   Vaucheria litorea
ref|WP_013192195.1|  photosystem I protein PsaD                         118   6e-30   Trichormus azollae
ref|WP_002740397.1|  MULTISPECIES: photosystem I reaction center ...    118   6e-30   Microcystis
ref|WP_039754673.1|  Photosystem I reaction center subunit II           118   6e-30   
ref|WP_041918842.1|  Photosystem I reaction center subunit II           117   1e-29   
ref|WP_019493410.1|  Photosystem I reaction center subunit II           117   1e-29   Calothrix sp. PCC 7103
prf||1510177A  photosystem II                                           117   1e-29
ref|WP_008272575.1|  photosystem I subunit II                           117   1e-29   Cyanothece sp. CCY0110
gb|AFZ29137.1|  photosystem I protein PsaD                              118   1e-29   Gloeocapsa sp. PCC 7428
ref|WP_009633578.1|  PsaD                                               117   1e-29   Synechocystis sp. PCC 7509
ref|YP_005090043.1|  psaD gene product                                  116   1e-29   Fucus vesiculosus
ref|WP_016953057.1|  Photosystem I reaction center subunit II           116   2e-29   Anabaena sp. PCC 7108
ref|WP_029637180.1|  Photosystem I reaction center subunit II [         116   2e-29   [Scytonema hofmanni] UTEX B 1581
ref|WP_015221061.1|  photosystem I protein PsaD                         117   2e-29   Cyanobacterium aponinum
ref|WP_011057561.1|  photosystem I subunit II                           116   2e-29   Thermosynechococcus
ref|WP_028083790.1|  Photosystem I reaction center subunit II           116   2e-29   Dolichospermum circinale
pdb|1JB0|D  Chain D, Crystal Structure Of Photosystem I: A Photos...    116   2e-29   
ref|WP_015215982.1|  photosystem I protein PsaD                         116   3e-29   
ref|WP_012306311.1|  MULTISPECIES: photosystem I subunit II             116   3e-29   
ref|WP_028090681.1|  Photosystem I reaction center subunit II           116   3e-29   
sp|P56596.1|PSAD_NOSS8  RecName: Full=Photosystem I reaction cent...    115   3e-29   
gb|AAD38699.1|AF148503_2  photosystem I accessory protein D             115   4e-29   
ref|WP_024544608.1|  Photosystem I reaction center subunit II           115   4e-29   
ref|WP_041039117.1|  Photosystem I reaction center subunit II           115   4e-29   
ref|WP_017292752.1|  Photosystem I reaction center subunit II           115   5e-29   
ref|WP_015079642.1|  MULTISPECIES: photosystem I protein PsaD           115   5e-29   
ref|YP_006639027.1|  photosystem I ferredoxin-binding protein           114   9e-29   
ref|WP_036477609.1|  Photosystem I reaction center subunit II           115   1e-28   
ref|WP_015208523.1|  PsaD                                               114   1e-28   
ref|WP_009626149.1|  photosystem I protein PsaD                         115   1e-28   
sp|P23076.3|PSAD_SYNP6  RecName: Full=Photosystem I reaction cent...    114   1e-28   
ref|WP_023071664.1|  photosystem i protein                              114   1e-28   
ref|WP_044290906.1|  Photosystem I reaction center subunit II           114   1e-28   
ref|WP_022606580.1|  PsaD                                               114   2e-28   
ref|WP_037220235.1|  Photosystem I reaction center subunit II           113   3e-28   
gb|AFY55101.1|  PsaD                                                    114   3e-28   
ref|WP_040054753.1|  Photosystem I reaction center subunit II           113   4e-28   
ref|WP_012953669.1|  photosystem I reaction center subunit II PsaD      113   4e-28   
ref|WP_017317314.1|  Photosystem I reaction center subunit II           112   6e-28   
ref|WP_015151596.1|  PsaD                                               112   8e-28   
sp|P23808.1|PSAD_MICDP  RecName: Full=Photosystem I reaction cent...    112   8e-28   
gb|KIJ85471.1|  Photosystem I reaction center subunit II                112   9e-28   
ref|YP_002049251.1|  Photosystem I reaction center subunit II (PsaD)    112   1e-27   
ref|NP_849051.1|  photosystem I subunit II                              112   1e-27   
gb|AIA61184.1|  photosystem I subunit II (chloroplast)                  112   1e-27   
ref|WP_006516877.1|  PsaD protein                                       111   2e-27   
ref|NP_045207.1|  photosystem I subunit II                              111   2e-27   
ref|WP_035155503.1|  Photosystem I reaction center subunit II           111   2e-27   
ref|WP_017744641.1|  Photosystem I reaction center subunit II           111   3e-27   
ref|WP_006198574.1|  photosystem I reaction center subunit II           110   3e-27   
ref|WP_010314860.1|  photosystem I protein PsaD                         111   3e-27   
emb|CDN13363.1|  photosystem I subunit II (PsaD)                        110   4e-27   
ref|YP_007476277.1|  photosystem I reaction center subunit II (fe...    110   4e-27   
ref|WP_011143690.1|  photosystem I reaction centre subunit II           110   4e-27   
ref|WP_017651861.1|  Photosystem I reaction center subunit II           110   5e-27   
ref|WP_012411433.1|  photosystem I protein PsaD                         110   6e-27   
ref|WP_041430107.1|  Photosystem I reaction center subunit II           109   7e-27   
ref|WP_015127985.1|  photosystem I protein PsaD                         109   1e-26   
ref|WP_010994505.1|  photosystem I reaction center subunit II           109   1e-26   
gb|KIE10409.1|  Photosystem I reaction center subunit II                109   1e-26   
ref|WP_011321384.1|  photosystem I protein PsaD                         109   1e-26   
ref|WP_011433827.1|  photosystem I reaction center subunit II           109   1e-26   
ref|WP_015134252.1|  photosystem I protein PsaD                         108   2e-26   
ref|WP_019502597.1|  hypothetical protein                               108   3e-26   
ref|WP_015112247.1|  photosystem I protein PsaD                         108   3e-26   
ref|WP_038000832.1|  Photosystem I reaction center subunit II           108   4e-26   
ref|WP_015136451.1|  PsaD                                               108   4e-26   
gb|EAQ68518.1|  photosystem I reaction center subunit II (PsaD)         107   5e-26   
ref|WP_008235951.1|  photosystem I subunit II (PsaD)                    107   6e-26   
ref|WP_008224714.1|  photosystem I subunit II (PsaD)                    107   7e-26   
ref|WP_006910658.1|  photosystem I reaction center subunit II           107   8e-26   
ref|WP_023171757.1|  photosystem I protein PsaD                         107   8e-26   
ref|WP_028953660.1|  Photosystem I reaction center subunit II           106   1e-25   
ref|WP_041225999.1|  Photosystem I reaction center subunit II           106   2e-25   
ref|WP_038547798.1|  Photosystem I reaction center subunit II           106   2e-25   
gb|AFZ12711.1|  photosystem I protein PsaD                              106   2e-25   
gb|AII42441.1|  Photosystem I reaction center subunit II                106   2e-25   
ref|WP_035831507.1|  Photosystem I reaction center subunit II           106   3e-25   
ref|WP_006173380.1|  photosystem I reaction center subunit II (PsaD)    105   3e-25   
ref|WP_010311728.1|  photosystem I protein PsaD                         105   4e-25   
ref|WP_007099913.1|  photosystem I reaction center subunit II (PsaD)    105   4e-25   
ref|WP_011128902.1|  photosystem I reaction center subunit II (PsaD)    105   4e-25   
ref|WP_036900706.1|  Photosystem I reaction center subunit II           105   5e-25   
ref|WP_012196249.1|  photosystem I protein PsaD                         105   5e-25   
ref|WP_006042180.1|  photosystem I reaction center subunit II (PsaD)    105   7e-25   
ref|WP_011932371.1|  photosystem I reaction center subunit II           104   8e-25   
ref|WP_043694980.1|  Photosystem I reaction center subunit II           104   9e-25   
ref|WP_011618423.1|  photosystem I reaction center subunit II           104   1e-24   
ref|WP_015109263.1|  PsaD                                               103   2e-24   
ref|WP_011133206.1|  photosystem I protein PsaD                         103   2e-24   
ref|WP_025781322.1|  Photosystem I reaction center subunit II           103   3e-24   
ref|WP_011377212.1|  photosystem I protein PsaD                         103   3e-24   
ref|WP_026032399.1|  Photosystem I reaction center subunit II           102   4e-24   
ref|WP_036919402.1|  MULTISPECIES: Photosystem I reaction center ...    102   4e-24   
ref|WP_011131077.1|  photosystem I protein PsaD                         102   4e-24   
ref|WP_011363412.1|  MULTISPECIES: photosystem I reaction center ...    102   5e-24   
gb|AHF62815.1|  photosystem I reaction center subunit II (PsaD)         102   5e-24   
ref|WP_015156676.1|  MULTISPECIES: photosystem I protein PsaD           102   5e-24   
ref|WP_036911259.1|  MULTISPECIES: Photosystem I reaction center ...    102   5e-24   
ref|WP_032521962.1|  Photosystem I reaction center subunit II           102   6e-24   
ref|WP_032526300.1|  Photosystem I reaction center subunit II           102   9e-24   
ref|WP_025915179.1|  Photosystem I reaction center subunit II           102   9e-24   
ref|WP_025927078.1|  Photosystem I reaction center subunit II           102   9e-24   
ref|WP_025934063.1|  Photosystem I reaction center subunit II           101   1e-23   
ref|WP_025935474.1|  Photosystem I reaction center subunit II           101   1e-23   
gb|ABC98753.1|  photosystem I reaction center subunit II                101   1e-23   
ref|WP_025956224.1|  Photosystem I reaction center subunit II           101   1e-23   
ref|WP_042851104.1|  Photosystem I reaction center subunit II           101   1e-23   
ref|WP_025937671.1|  MULTISPECIES: Photosystem I reaction center ...    101   1e-23   
ref|WP_011863680.1|  MULTISPECIES: photosystem I protein PsaD           101   1e-23   
ref|WP_002807018.1|  MULTISPECIES: photosystem I reaction center ...    101   1e-23   
ref|WP_041438839.1|  Photosystem I reaction center subunit II           101   1e-23   
gb|ABE11137.1|  photosystem I protein PsaD                              101   2e-23   
ref|WP_019477882.1|  MULTISPECIES: Photosystem I reaction center ...    101   2e-23   
ref|WP_011936501.1|  photosystem I reaction center subunit II           101   2e-23   
ref|WP_038014855.1|  Photosystem I reaction center subunit II           101   2e-23   
ref|WP_011826874.1|  photosystem I protein PsaD                         101   2e-23   
ref|WP_032513725.1|  Photosystem I reaction center subunit II           100   2e-23   
ref|WP_025954911.1|  Photosystem I reaction center subunit II           100   3e-23   
ref|WP_025943458.1|  Photosystem I reaction center subunit II           100   3e-23   
ref|WP_025889562.1|  MULTISPECIES: Photosystem I reaction center ...    100   3e-23   
ref|WP_017327440.1|  hypothetical protein                               100   3e-23   
ref|WP_025928909.1|  Photosystem I reaction center subunit II           100   3e-23   
ref|WP_019474331.1|  MULTISPECIES: Photosystem I reaction center ...    100   4e-23   
ref|WP_011821058.1|  photosystem I protein PsaD                         100   4e-23   
ref|WP_011819190.1|  photosystem I protein PsaD                         100   4e-23   
ref|WP_025943071.1|  Photosystem I reaction center subunit II           100   4e-23   
ref|WP_032517906.1|  Photosystem I reaction center subunit II           100   4e-23   
ref|WP_025930967.1|  Photosystem I reaction center subunit II         99.8    5e-23   
dbj|BAD78733.1|  photosystem I reaction center subunit II             98.6    7e-23   
ref|WP_011125882.1|  MULTISPECIES: photosystem I protein PsaD         99.8    7e-23   
ref|WP_009788961.1|  photosystem I reaction center subunit II (PsaD)  97.8    3e-22   
ref|WP_011360689.1|  photosystem I reaction center subunit II (PsaD)  97.8    3e-22   
gb|ABK96014.1|  unknown                                               95.9    5e-22   
gb|ACF86694.1|  unknown                                               95.9    6e-22   
ref|YP_003795447.1|  photosystem I subunit II                         95.9    1e-21   
gb|EMT14162.1|  Photosystem I reaction center subunit II, chlorop...  94.0    3e-21   
ref|YP_008519723.1|  photosystem I reaction center subunit II         94.7    5e-21   
ref|YP_007317065.1|  photosystem I reaction center subunit II         94.4    6e-21   
ref|YP_008519970.1|  photosystem I reaction center subunit II         92.8    2e-20   
ref|YP_008520096.1|  photosystem I reaction center subunit II         92.8    2e-20   
ref|WP_038654413.1|  Photosystem I reaction center subunit II         92.8    3e-20   
ref|WP_011295494.1|  photosystem I protein PsaD                       91.3    1e-19   
ref|WP_015164131.1|  photosystem I protein PsaD                       90.1    3e-19   
gb|AGI04047.1|  photosystem I subunit II                              88.6    5e-19   
ref|WP_015196995.1|  photosystem I protein PsaD                       88.2    2e-18   
gb|ABQ52926.1|  photosystem I reaction center subunit II              85.5    3e-18   
gb|ABQ52919.1|  photosystem I reaction center subunit II              85.1    4e-18   
gb|ABQ52912.1|  photosystem I reaction center subunit II              85.1    4e-18   
gb|ABQ52913.1|  photosystem I reaction center subunit II              85.1    4e-18   
gb|ABQ52927.1|  photosystem I reaction center subunit II              84.0    1e-17   
ref|NP_001104945.1|  photosystem I subunit d1                         84.7    1e-17   
gb|ABQ52911.1|  photosystem I reaction center subunit II              83.6    2e-17   
gb|AAB51150.1|  subunit II of photosystem I                           83.6    3e-17   
gb|ABQ52930.1|  photosystem I reaction center subunit II              82.8    3e-17   
gb|ABQ52922.1|  photosystem I reaction center subunit II              82.0    5e-17   
gb|ABQ52924.1|  photosystem I reaction center subunit II              82.0    5e-17   
gb|ABQ52932.1|  photosystem I reaction center subunit II              82.0    6e-17   
gb|ABQ52910.1|  photosystem I reaction center subunit II              82.0    7e-17   
gb|ACO90365.1|  PsaD                                                  83.2    7e-17   
gb|ABQ52929.1|  photosystem I reaction center subunit II              81.6    8e-17   
gb|ABQ52931.1|  photosystem I reaction center subunit II              81.6    9e-17   
ref|XP_010497891.1|  PREDICTED: photosystem I reaction center sub...  81.6    9e-17   
dbj|BAJ87604.1|  predicted protein                                    84.3    1e-16   
gb|ACG50087.1|  PsaD                                                  81.6    3e-16   
gb|KEI67811.1|  PsaD                                                  80.1    6e-16   
gb|ACT34029.1|  PsaD                                                  76.6    2e-14   
gb|ACA96900.1|  chloroplast photosystem I subunit D-2                 63.9    3e-10   
gb|ACA96901.1|  chloroplast photosystem I subunit D-2                 63.5    4e-10   
gb|ACA96898.1|  chloroplast photosystem I subunit D-2                 63.5    4e-10   
gb|ACA96899.1|  chloroplast photosystem I subunit D-2                 63.2    5e-10   
ref|WP_029983812.1|  Photosystem I reaction center subunit II         62.0    7e-10   
ref|XP_003083422.1|  PSI reaction center, subunit II (ISS)            57.4    6e-08   
sp|P84563.1|PSAD_POPEU  RecName: Full=Photosystem I reaction cent...  53.1    9e-07   
ref|WP_025900916.1|  Photosystem I reaction center subunit II         54.3    1e-06   
ref|WP_025939988.1|  MULTISPECIES: Photosystem I reaction center ...  46.6    5e-04   



>ref|XP_009795521.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nicotiana sylvestris]
 sp|P29302.1|PSAD_NICSY RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Nicotiana sylvestris]
 emb|CAA42623.1| PSI-D2 [Nicotiana sylvestris]
Length=204

 Score =   220 bits (561),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 134/165 (81%), Gaps = 9/165 (5%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF   LSA K +A     PWKQSL  FS  P+ L  + +AP RPIRAMAEE 
Sbjct  1    MAMATQASLFTPALSAPKSSA-----PWKQSLASFS--PKQLKSTVSAP-RPIRAMAEEA  52

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
                 +  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  53   ATKEAEA-PVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTG  111

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREGANLLKLARKEQCLALGTRLRSKY INY+FYRVFP+GE
Sbjct  112  GAAIMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGE  156



>ref|XP_004241054.2| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Solanum lycopersicum]
 sp|P12372.1|PSAD_SOLLC RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAA34185.1| photosystem I subunit II protein precursor [Solanum lycopersicum]
 prf||1601516A photosystem I reaction center II
Length=208

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 133/166 (80%), Gaps = 7/166 (4%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF  PLS  K        PWKQSL  FS  P+ L KST +  RPIRAMAEE 
Sbjct  1    MAMATQASLFTPPLSVPKSTTA----PWKQSLVSFST-PKQL-KSTVSVTRPIRAMAEEA  54

Query  230  teaptke-aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  406
              A  ++ AP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPT
Sbjct  55   PAATEEKPAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPT  114

Query  407  GGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GGAAIMR+G NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  115  GGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  160



>ref|XP_009621208.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nicotiana tomentosiformis]
Length=207

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 138/167 (83%), Gaps = 10/167 (6%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF   LSA K ++     PWKQSL  FS  P+ L  + +AP RPIRAMAEE 
Sbjct  1    MAMATQASLFTPALSAPKSSS-----PWKQSLASFS--PKQLKSTVSAP-RPIRAMAEEA  52

Query  230  teaptkea--PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
              A TKEA  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  53   AAAATKEAEAPVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  112

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMREGANLLKLARKEQCLALGTRLRSKY INY+FYRVFP+GE
Sbjct  113  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGE  159



>ref|XP_006356675.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Solanum tuberosum]
 emb|CAD89270.1| putative photosystem I reaction centre PSI-D subunit precursor 
[Solanum tuberosum]
Length=207

 Score =   218 bits (554),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 133/166 (80%), Gaps = 8/166 (5%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF   LS  K  A     PWKQSL  FS  P+ L KST +  RPIRAMAEE 
Sbjct  1    MAMATQASLFTPALSVPKSTA-----PWKQSLLSFST-PKQL-KSTVSVTRPIRAMAEEA  53

Query  230  teaptke-aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  406
              A  ++ AP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPT
Sbjct  54   PAATEEKPAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPT  113

Query  407  GGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GGAAIMREG NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  114  GGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  159



>ref|XP_009799304.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA02871.1| PSI-D1 precursor [Nicotiana sylvestris]
Length=214

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 137/169 (81%), Gaps = 7/169 (4%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA+QASLF   +S +K A  RV APWKQS   FS  P+ L KS  A  RPI+AMA E 
Sbjct  1    MAMASQASLFTPSISTSKTADPRVVAPWKQSASSFSA-PK-LSKSVVA-YRPIKAMAVEK  57

Query  230  teaptk----eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  397
             ++ TK     APVGFTPP LDP+TPSPIFGGSTGGLLRKAQV+EFYVITW SPKEQIFE
Sbjct  58   AQSATKEAEPAAPVGFTPPQLDPSTPSPIFGGSTGGLLRKAQVDEFYVITWESPKEQIFE  117

Query  398  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            MPTGGAAIMREG NLLKLARKEQCLALGTRLRSKY INY+FYRVFP+GE
Sbjct  118  MPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGE  166



>ref|XP_011090732.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Sesamum indicum]
Length=215

 Score =   212 bits (540),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF   LS  K A   VA PWKQSL  FS  P+ +  ++    RPIRAMAEE 
Sbjct  1    MAMATQASLFTPTLSGPKSADRVVA-PWKQSLAQFST-PKPMKVASAVAHRPIRAMAEEA  58

Query  230  teaptk-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  406
              A  + EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPT
Sbjct  59   PPATKEPEAPAGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPT  118

Query  407  GGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  119  GGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  164



>ref|XP_009366924.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=213

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF    S  K  ADR  APWKQS+    + P+ L  STT   R   +  E+T
Sbjct  1    MAMATQASLFTPTPSVPKTIADRTTAPWKQSVSSSFMAPKPLKLSTTRTMRINASAEEKT  60

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
                 +EAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTG
Sbjct  61   VTPTKEEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTG  120

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  121  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  165



>ref|XP_008340966.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Malus domestica]
Length=213

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF    S  K  ADR  APWKQS+    + P+ L  STT   R   +  E+T
Sbjct  1    MAMATQASLFTPTPSVPKTTADRTTAPWKQSVSSSFMPPKPLKLSTTRTMRINASAEEKT  60

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
                 +EAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTG
Sbjct  61   VTTTKEEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTG  120

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  121  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  165



>gb|AGV54746.1| photosystem I reaction center subunit II chloroplastic-like protein 
[Phaseolus vulgaris]
Length=207

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 130/165 (79%), Gaps = 6/165 (4%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF  P S  KP+      PWKQS       P+ L  S T     IRA A+ET
Sbjct  1    MAMATQASLFTPPFSGLKPSDRASV-PWKQSPTFSFTSPKPLKLSKT-----IRAAADET  54

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
             EA TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  55   AEAATKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTG  114

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  115  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  159



>ref|XP_007143239.1| hypothetical protein PHAVU_007G055900g [Phaseolus vulgaris]
 gb|ESW15233.1| hypothetical protein PHAVU_007G055900g [Phaseolus vulgaris]
Length=207

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF  P S  K +      PWKQS       P+ L  S T     IRA A+ET
Sbjct  1    MAMATQASLFTPPFSGLKLSDRASV-PWKQSPTFSFTSPKPLKLSKT-----IRAAADET  54

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
             EA TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  55   AEAATKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTG  114

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  115  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  159



>ref|XP_011071575.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Sesamum indicum]
Length=213

 Score =   211 bits (536),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF   LSAAKPA    A PWKQS+  FS     +    +   RPIRAMAEE 
Sbjct  1    MAMATQASLFTPTLSAAKPADRVAA-PWKQSIAQFSTPKAPIKGVASVSHRPIRAMAEEA  59

Query  230  teaptk-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  406
              A  + EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPT
Sbjct  60   PAATKEPEAPAGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPT  119

Query  407  GGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  120  GGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  165



>ref|XP_008376830.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Malus domestica]
Length=212

 Score =   210 bits (535),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF    SA K  ADR   PWKQS+    + P+ L  ST    R I A AEE 
Sbjct  1    MAMATQASLFTPTPSAPKTTADRTTTPWKQSVSSSFMAPKPLKLSTARTMR-INASAEEK  59

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
            T  PTKEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTG
Sbjct  60   TVTPTKEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTG  119

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  120  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  164



>gb|EYU41499.1| hypothetical protein MIMGU_mgv1a013699mg [Erythranthe guttata]
Length=212

 Score =   210 bits (535),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF   LS  K      A PWKQSL  FS V + +  ++    RPIRAMA+E 
Sbjct  1    MAMATQASLFTPTLSGPKSGDRAAA-PWKQSLAQFSAV-KPMKGASAVSHRPIRAMADEA  58

Query  230  teaptk-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  406
              A  + EAP GFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPT
Sbjct  59   PAATKEPEAPAGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPT  118

Query  407  GGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  119  GGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  164



>gb|EYU45647.1| hypothetical protein MIMGU_mgv1a013850mg [Erythranthe guttata]
Length=209

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 8/167 (5%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QA+LFA+ +SA + AA     PWKQSL  FS   + + KS  A  RPIRAMAE+ 
Sbjct  1    MAMATQATLFAATISADRVAA-----PWKQSLAQFSTATKPIIKSA-ATHRPIRAMAEDA  54

Query  230  teaptke--aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
              A TKE  AP GFTPP LDP TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMP
Sbjct  55   PAAATKEPEAPAGFTPPELDPTTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMP  114

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMR+G NLLKLARKEQCLALGT+LRSKY I YQFYRVFP+GE
Sbjct  115  TGGAAIMRQGPNLLKLARKEQCLALGTKLRSKYKIKYQFYRVFPNGE  161



>ref|XP_010035248.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84226.1| hypothetical protein EUGRSUZ_B01088 [Eucalyptus grandis]
Length=214

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 125/167 (75%), Gaps = 3/167 (2%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLH--CFSVVPRGLDKSTTAPCRPIRamae  223
            MAMA QASLF   L+A K   DRV APWKQS     F+  P+    S     R   A   
Sbjct  1    MAMATQASLFTPALAAPKSGVDRVIAPWKQSASSLAFAATPKAAKSSPRTAIR-AAAAEG  59

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
            +      +EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  60   KAEAPVKEEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  119

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  120  TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  166



>ref|XP_009588197.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=209

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 132/169 (78%), Gaps = 12/169 (7%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA+QASLF   +S  K AA     PWKQS+  FS  P+      T   RPI+A A+E 
Sbjct  1    MAMASQASLFTPSISGPKTAA-----PWKQSVSSFSA-PKPSKSGVT--YRPIKATADEK  52

Query  230  teaptk----eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  397
             ++ TK     APVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFE
Sbjct  53   AQSATKEAELAAPVGFTPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFE  112

Query  398  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            MPTGGAAIMREG NLLKLARKEQCLALGTRLRSKY INY+FYRVFP+GE
Sbjct  113  MPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGE  161



>ref|XP_008224535.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Prunus mume]
Length=213

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QA+LF    SA K + +R   PWKQS+    + P+ L  S+T     I A AEE 
Sbjct  1    MAMATQATLFTPTPSAPKTSVERSTVPWKQSVSSSFMAPKPLMLSSTTRTMRINAAAEEK  60

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
            T AP KEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTG
Sbjct  61   TVAPPKEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTG  120

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  121  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  165



>ref|XP_002281825.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Vitis vinifera]
 emb|CAN62373.1| hypothetical protein VITISV_036477 [Vitis vinifera]
Length=204

 Score =   207 bits (528),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 123/165 (75%), Gaps = 9/165 (5%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF   LS  +        PWK S       P+ L KS+ AP   IRAMAEE 
Sbjct  1    MAMATQASLFTPTLSGDRVTV-----PWKSSSSLSFTTPK-LPKSSVAPRTTIRAMAEEA  54

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
                    PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  55   PTKEA---PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  111

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  112  GAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  156



>ref|XP_004296896.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=205

 Score =   207 bits (526),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 122/168 (73%), Gaps = 14/168 (8%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QA+LF    SA          PWKQS+    + P+ L  ST A  RP+R  A E 
Sbjct  1    MAMATQATLFTPTASA----------PWKQSVTSTFMAPKSLTLSTVA-SRPMRISAAEE  49

Query  230  te---aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEM  400
                     EAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEM
Sbjct  50   KTVAPTKEAEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEM  109

Query  401  PTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            PTGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  110  PTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  157



>ref|XP_003556041.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Glycine max]
 gb|KHN15781.1| Photosystem I reaction center subunit II, chloroplastic [Glycine 
soja]
Length=203

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 125/165 (76%), Gaps = 10/165 (6%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF  PLS  KP+    A PWKQS          L  ST+ P +  R +    
Sbjct  1    MAMATQASLFTPPLSGLKPSDRATA-PWKQS--------STLSFSTSKPLKFSRTIRAAA  51

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
            T+  T+  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  52   TDQTTEA-PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  110

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  111  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  155



>ref|NP_001235355.1| photosystem I subunit PsaD [Glycine max]
 gb|ABQ63097.1| photosystem I subunit PsaD [Glycine max]
 gb|ACU14192.1| unknown [Glycine max]
Length=210

 Score =   206 bits (523),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASL   PLS  K +      PWKQ+       P+ L  S T   R   A     
Sbjct  1    MAMATQASLLTPPLSGLKASDRASV-PWKQNSSLSFSSPKPLKFSRT--IRAAAADETTE  57

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
              A  + APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  58   APAKVEAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  117

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  118  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162



>gb|AFK43504.1| unknown [Lotus japonicus]
Length=210

 Score =   206 bits (523),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 123/180 (68%), Gaps = 33/180 (18%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQS--LHCFSVVP-------------RGLDKS  184
            MAMA QASLF+ PLS    A      PWKQS  L   +  P             R  D+ 
Sbjct  1    MAMATQASLFSPPLSGRVSA------PWKQSPTLSFTNTKPLKFTTSPRTTTTIRAADEK  54

Query  185  TTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVI  364
            T AP             A  + APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVI
Sbjct  55   TEAPV------------ATKEAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVI  102

Query  365  TWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  103  TWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162



>ref|NP_001275862.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80475.1| PSI reaction center subunit II [Citrus sinensis]
Length=207

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 131/167 (78%), Gaps = 10/167 (6%)
 Frame = +2

Query  50   MAMAA--QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamae  223
            MAMAA  QASLFA     A  +  + +APWKQS   FSV P    K        I+AMAE
Sbjct  1    MAMAATTQASLFAP----ANFSTTKSSAPWKQS-SSFSVRPL---KHNAPRTNTIKAMAE  52

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
              TE PTKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  53   GKTETPTKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  112

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  113  TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  159



>ref|XP_006419899.1| hypothetical protein CICLE_v10005892mg [Citrus clementina]
 ref|XP_006489366.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Citrus sinensis]
 dbj|BAF80470.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80477.1| PSI reaction center subunit II [Citrus sinensis]
 gb|ESR33139.1| hypothetical protein CICLE_v10005892mg [Citrus clementina]
 gb|KDO74646.1| hypothetical protein CISIN_1g028581mg [Citrus sinensis]
Length=207

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 130/167 (78%), Gaps = 8/167 (5%)
 Frame = +2

Query  44   ISMAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamae  223
            ++MA   QASLFA     A  +  + +APWKQS   FSV P    K        I+AMAE
Sbjct  1    MAMAATTQASLFAP----ANFSTTKSSAPWKQS-SSFSVRPL---KHNAPRTNTIKAMAE  52

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
              TE PTKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  53   GKTETPTKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  112

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  113  TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  159



>ref|XP_003610706.1| Photosystem I reaction center subunit II [Medicago truncatula]
 gb|AES93664.1| photosystem I reaction center subunit II [Medicago truncatula]
 gb|AFK47938.1| unknown [Medicago truncatula]
Length=209

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 122/169 (72%), Gaps = 12/169 (7%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQ--SLHCFSVVPRGLDKSTT--APCRPIRam  217
            MAMA QASLF  PLS+ K        PWKQ  +L   S+ P      TT  +        
Sbjct  1    MAMATQASLFTPPLSSPK--------PWKQPSTLSFISLKPIKFTTKTTKISAADEKTEA  52

Query  218  aeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  397
            A  TT+     APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFE
Sbjct  53   ASVTTKEEAPAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFE  112

Query  398  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            MPTGGAAIMREG NLLKLARKEQCLALG RLRSKY I YQFYRVFP+GE
Sbjct  113  MPTGGAAIMREGPNLLKLARKEQCLALGNRLRSKYKIKYQFYRVFPNGE  161



>gb|ABK96621.1| unknown [Populus trichocarpa x Populus deltoides]
Length=201

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 121/165 (73%), Gaps = 14/165 (8%)
 Frame = +2

Query  56   MAAQASLFASPLSaakpaadrvaaPWKQS--LHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAAQASLF  P  +   ++++  APWKQS  L   +V P+   K   A    ++      
Sbjct  1    MAAQASLFTPPTLSTLKSSNQAIAPWKQSSFLPISNVKPQRTMKVAAAEETAVKEA----  56

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
                    PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  57   --------PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  108

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  109  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  153



>ref|XP_010277521.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nelumbo nucifera]
Length=213

 Score =   203 bits (517),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 125/168 (74%), Gaps = 6/168 (4%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVV-PRGLDKSTTAPCRPIRamaee  226
            MAMA QA+LF   LSA K     +  PWK S    S + PR L+ S     R IRA A +
Sbjct  1    MAMATQAALFTPTLSAPKSGNRALV-PWKPSSTSLSFISPRPLNLSVAQ--RTIRAAAAD  57

Query  227  tteap--tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEM  400
                     EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEM
Sbjct  58   EKTEAPPAAEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEM  117

Query  401  PTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            PTGGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  118  PTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  165



>ref|XP_010935005.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Elaeis guineensis]
Length=210

 Score =   202 bits (514),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +2

Query  50   MAMAAQASLFASPL--SaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamae  223
            MAMA QASLF  P   ++   A    A PW  S   F+  PR L  ST  P     A  +
Sbjct  1    MAMATQASLFTPPTLSASKPAAPRSAAIPWTNS--PFAATPRPLTLSTNTPRN---ATFK  55

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
             +      EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  56   VSATEEKTEAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMP  115

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  116  TGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIQYQFYRVFPNGE  162



>emb|CDO99040.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   202 bits (513),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 122/165 (74%), Gaps = 8/165 (5%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF   LS+          PWKQS       P+ +   T    R IRAMAEE 
Sbjct  1    MAMATQASLFTPTLSSPSDRVTV---PWKQSSLVAFASPKPIK--TNMATRTIRAMAEEA  55

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
            + A     P GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  56   STAAA---PAGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  112

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMR+G NLLKLARKEQCLALGTRLRSKY I+YQFYRVFP+GE
Sbjct  113  GAAIMRQGPNLLKLARKEQCLALGTRLRSKYKISYQFYRVFPNGE  157



>ref|XP_002315779.1| photosystem I 20kD family protein [Populus trichocarpa]
 gb|ABK95430.1| unknown [Populus trichocarpa]
 gb|ABK95668.1| unknown [Populus trichocarpa]
 gb|EEF01950.1| photosystem I 20kD family protein [Populus trichocarpa]
Length=201

 Score =   201 bits (512),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 120/165 (73%), Gaps = 14/165 (8%)
 Frame = +2

Query  56   MAAQASLFASPLSaakpaadrvaaPWKQS--LHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAAQASLF  P  +   ++++   PWKQ+  L   +V P+   K   A    ++      
Sbjct  1    MAAQASLFTPPTLSTLKSSNQAFVPWKQASFLPISNVKPQRTMKVAAAEETAVKEA----  56

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
                    PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  57   --------PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  108

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  109  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  153



>ref|XP_002516772.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF45386.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
Length=208

 Score =   201 bits (512),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 121/165 (73%), Gaps = 5/165 (3%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF     +   +++    PWKQS   F  +P    +  +   + I+A A E 
Sbjct  1    MAMATQASLFTPTTLSTPKSSNHAIVPWKQS--SFLSIPTAKPRKYSIAQKTIKAAAAEG  58

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
                    PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  59   KTKEA---PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  115

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  116  GAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  160



>ref|XP_004511355.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Cicer arietinum]
Length=215

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 121/175 (69%), Gaps = 18/175 (10%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF  PLS  K        PWKQ      +  + +  +T +P   IR  A   
Sbjct  1    MAMATQASLFTPPLSTPK--------PWKQPSTLSFITLKPIKFTTASPRTTIRTAASAD  52

Query  230  teaptkea----------PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSP  379
             +  T             PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SP
Sbjct  53   DKTETPVKTEKAPAPAPAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSP  112

Query  380  KEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            KEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  113  KEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  167



>ref|XP_009344083.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=210

 Score =   200 bits (509),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = +2

Query  56   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeette  235
            MA QASLF    SA K  ADR  APW+QS+    +  + L  ST    R I A AEE T 
Sbjct  1    MATQASLFTPTPSAPKTPADRTTAPWRQSVFSSFMALKPLKLSTARTVR-INASAEEKTV  59

Query  236  aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  415
             PTKEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTGGA
Sbjct  60   TPTKEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTGGA  119

Query  416  AIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            AIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162



>ref|XP_008802683.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Phoenix dactylifera]
Length=209

 Score =   200 bits (508),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 121/167 (72%), Gaps = 8/167 (5%)
 Frame = +2

Query  50   MAMAAQASLFASPL--SaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamae  223
            MAMA QASLF  P   ++   A    A PW +S   F+  PR L  S      P  A  +
Sbjct  1    MAMATQASLFTPPTLPASKPAAPRSAAIPWTKS--PFAASPRPLTLSIA----PRNATIK  54

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
             +      EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  55   VSATEEKTEAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMP  114

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  115  TGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  161



>ref|XP_011026306.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=203

 Score =   199 bits (506),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 118/165 (72%), Gaps = 10/165 (6%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF     +   ++++   PWKQS          L  S     R  +  A E 
Sbjct  1    MAMATQASLFTPTTLSTLKSSNQTIVPWKQSTF--------LPISNVKAQRSFKVAAAEE  52

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
            T       PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  53   TATKEA--PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  110

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  111  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  155



>ref|XP_010108011.1| Photosystem I reaction center subunit II [Morus notabilis]
 gb|EXC17576.1| Photosystem I reaction center subunit II [Morus notabilis]
Length=215

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 128/167 (77%), Gaps = 2/167 (1%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPR--GLDKSTTAPCRPIRamae  223
            MA  A  +LF   LSA K     VA  WKQSL      P+   L + ++     +RA AE
Sbjct  1    MATQATTTLFTPTLSAPKAGDRGVAVTWKQSLTSSFTTPKPFKLSRPSSGSSTIVRAAAE  60

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
            E T+APTKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEM 
Sbjct  61   EATKAPTKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMV  120

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  121  TGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  167



>ref|XP_002311618.2| photosystem I 20kD family protein [Populus trichocarpa]
 gb|EEE88985.2| photosystem I 20kD family protein [Populus trichocarpa]
Length=204

 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 119/165 (72%), Gaps = 9/165 (5%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF     +   ++++   PWKQS          L  S     R  +  A E 
Sbjct  1    MAMATQASLFTPTTLSTLKSSNQTIVPWKQSSF--------LPISNVKAQRSFKVAAVEG  52

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
              A  +  PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  53   KTATKEA-PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  111

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  112  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  156



>gb|EPS62726.1| hypothetical protein M569_12065 [Genlisea aurea]
Length=196

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 120/166 (72%), Gaps = 19/166 (11%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDK-STTAPCRPIRamaee  226
            MAMA Q +LFAS LS A          WKQ        PR L K S +   RP+  +   
Sbjct  1    MAMATQTTLFASTLSGA----------WKQP------SPRKLPKLSGSISHRPL--IRAM  42

Query  227  tteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPT  406
              EA       GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPT
Sbjct  43   AEEAAVAAPAAGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPT  102

Query  407  GGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GGAAIMREG NLLKLARKEQCLALGTRLRSKY INY+FYRVFP+GE
Sbjct  103  GGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGE  148



>ref|XP_011021547.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=201

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 120/163 (74%), Gaps = 10/163 (6%)
 Frame = +2

Query  56   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeette  235
            MA QASLF     +A  ++++  APWK  L  F      L  S   P R ++  A E T 
Sbjct  1    MATQASLFTPTALSALKSSNQAIAPWK--LSSF------LPISNVKPQRTMKVAAAEETA  52

Query  236  aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  415
                  PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGA
Sbjct  53   VKEA--PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGA  110

Query  416  AIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            AIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  111  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  153



>ref|XP_011015859.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=203

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 121/165 (73%), Gaps = 10/165 (6%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA QASLF     +   ++++   PWKQS    S +P    K+  +            
Sbjct  1    MAMATQASLFTPTTLSTLKSSNQTIVPWKQS----SFLPISNVKAQRS------FKVAAA  50

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
             E  TKEAPVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  51   EETATKEAPVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  110

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKE CLALGTRLRSKY I YQFYRVFP+GE
Sbjct  111  GAAIMREGPNLLKLARKELCLALGTRLRSKYKIKYQFYRVFPNGE  155



>emb|CDY21916.1| BnaC09g00220D [Brassica napus]
Length=281

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 125/171 (73%), Gaps = 17/171 (10%)
 Frame = +2

Query  56   MAAQAS-LFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeett  232
            MAAQAS LF+S ++ A  +         + LH F+   R   +S + P   IRA   ++ 
Sbjct  1    MAAQASGLFSSAVTTAATSGV-------KKLHLFTTTHR--PRSLSFPKTAIRAEKTDSA  51

Query  233  ea-------ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQI  391
             A         +EAPVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQI
Sbjct  52   AAAAAPAAAVKEEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQI  111

Query  392  FEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            FEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  112  FEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  162



>ref|XP_010256006.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nelumbo nucifera]
Length=212

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 121/167 (72%), Gaps = 5/167 (3%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWK-QSLHCFSVVPRGLDKSTTAPCRPIRamaee  226
            MAMA QA LF   LS        +  PWK  S     + PR L+ S     R IRA A +
Sbjct  1    MAMATQAGLFTPTLSTPNSGNRALV-PWKPSSSSLSFLSPRPLNLSLA--HRTIRASAAD  57

Query  227  tteapt-keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
                    EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  58   GKTEAPPAEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMP  117

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  118  TGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  164



>ref|XP_007034724.1| Photosystem I subunit D-2 [Theobroma cacao]
 gb|EOY05650.1| Photosystem I subunit D-2 [Theobroma cacao]
Length=210

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 126/165 (76%), Gaps = 3/165 (2%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA Q SLF     +A  ++DRVA PWKQ+   F  +P        AP       AEE 
Sbjct  1    MAMATQTSLFTPATLSAPKSSDRVAVPWKQA--SFVTLP-SFKSQKFAPRTIKAEAAEEK  57

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
             E  TKEAPVGFTPP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTG
Sbjct  58   AETATKEAPVGFTPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTG  117

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMR+G NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  118  GAAIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  162



>ref|XP_007050585.1| Photosystem I subunit D-2 [Theobroma cacao]
 gb|EOX94742.1| Photosystem I subunit D-2 [Theobroma cacao]
Length=204

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 119/163 (73%), Gaps = 7/163 (4%)
 Frame = +2

Query  56   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeette  235
            MA QA LF   +S  K        PWK S       P+ L+ S       IRA A +   
Sbjct  1    MATQAGLFTPTISTPKSLV-----PWKPSWSFSFATPKSLNLSMAHST--IRAAAADQEA  53

Query  236  aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  415
            A  +EAPVGFTPP LDPNTPSP+F GSTGGLLRKAQVEEFYVITW SP+EQIFEMPTGGA
Sbjct  54   ATKEEAPVGFTPPELDPNTPSPMFSGSTGGLLRKAQVEEFYVITWDSPREQIFEMPTGGA  113

Query  416  AIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            AIMR+G NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  114  AIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  156



>ref|XP_004134141.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Cucumis sativus]
 sp|P32869.1|PSAD_CUCSA RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=PS I subunit 5; AltName: Full=Photosystem 
I 20 kDa subunit; Short=PSI-D; Flags: Precursor [Cucumis 
sativus]
 gb|KGN56995.1| hypothetical protein Csa_3G147780 [Cucumis sativus]
 prf||1710320A photosystem I 20kD protein
Length=207

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 119/167 (71%), Gaps = 10/167 (6%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQS--LHCFSVVPRGLDKSTTAPCRPIRamae  223
            MAMA QA+LF   LS  K     +  PWKQS  L   +  P     S++      R+   
Sbjct  1    MAMATQATLFTPSLSTPKSTGISI--PWKQSSTLSFLTSKPHLKAASSS------RSFKV  52

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
                  + EAP GF+PP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  53   SAEAETSVEAPAGFSPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  112

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  113  TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  159



>ref|XP_006306434.1| hypothetical protein CARUB_v10012376mg [Capsella rubella]
 gb|EOA39332.1| hypothetical protein CARUB_v10012376mg [Capsella rubella]
Length=206

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  62   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  121

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  122  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  158



>ref|XP_006838247.1| hypothetical protein AMTR_s00103p00041210 [Amborella trichopoda]
 gb|ERN00816.1| hypothetical protein AMTR_s00103p00041210 [Amborella trichopoda]
Length=202

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  58   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  117

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  118  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  154



>ref|XP_006288687.1| hypothetical protein CARUB_v10001997mg [Capsella rubella]
 gb|EOA21585.1| hypothetical protein CARUB_v10001997mg [Capsella rubella]
Length=202

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  58   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  117

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  118  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  154



>ref|XP_010474926.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic 
[Camelina sativa]
Length=207

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +2

Query  137  QSLHCFSVV--PRGLDKSTTA-PCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIF  307
            + LH FS    P+ L  + TA       + +     A  +EAPVGFTPP LDPNTPSPIF
Sbjct  21   KKLHLFSTSHRPKSLSYTKTAIRAEKTDSSSAAPATAVKEEAPVGFTPPQLDPNTPSPIF  80

Query  308  GGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTR  487
             GSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTR
Sbjct  81   AGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTR  140

Query  488  LRSKYXINYQFYRVFPHGE  544
            LRSKY I YQFYRVFP+GE
Sbjct  141  LRSKYKIKYQFYRVFPNGE  159



>ref|XP_009111256.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic 
[Brassica rapa]
Length=208

 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 125/169 (74%), Gaps = 15/169 (9%)
 Frame = +2

Query  56   MAAQAS-LFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeett  232
            MAAQAS LF+S ++ A  +         + LH F+   R   +S + P   IRA   ++ 
Sbjct  1    MAAQASGLFSSAVTTAATSGV-------KKLHLFTTSHR--PRSLSFPKTAIRAEKADSA  51

Query  233  ea-----ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  397
             A       +EAPVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFE
Sbjct  52   AAAPAAAVKEEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFE  111

Query  398  MPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            MPTGGAAIMREG NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  112  MPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  160



>ref|XP_002892148.1| hypothetical protein ARALYDRAFT_887465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68407.1| hypothetical protein ARALYDRAFT_887465 [Arabidopsis lyrata subsp. 
lyrata]
Length=205

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 106/137 (77%), Gaps = 1/137 (1%)
 Frame = +2

Query  137  QSLHCFSVVPRGLDKS-TTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGG  313
            + LH FS   R    S T    R  +  +     A  +EAPVGFTPP LDPNTPSPIF G
Sbjct  21   KKLHLFSTSHRLKSLSFTKTAIRAEKTESSSAAPAVKEEAPVGFTPPQLDPNTPSPIFAG  80

Query  314  STGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLR  493
            STGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLR
Sbjct  81   STGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLR  140

Query  494  SKYXINYQFYRVFPHGE  544
            SKY I YQFYRVFP+GE
Sbjct  141  SKYKITYQFYRVFPNGE  157



>ref|XP_010481602.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
[Camelina sativa]
Length=206

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG
Sbjct  63   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  122

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  123  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  159



>gb|AFV94477.1| photosystem I reaction center subunit II [Saccharum hybrid cultivar 
GT28]
Length=200

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56   PKGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  116  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  152



>ref|NP_001062511.1| Os08g0560900 [Oryza sativa Japonica Group]
 gb|AAO72568.1| chloroplast photosystem I reaction center subunit II precursor-like 
protein [Oryza sativa Japonica Group]
 dbj|BAD13214.1| putative photosystem I reaction center subunit II, chloroplast 
precursor (Photosystem I 20 kDa subunit) (PSI-D) [Oryza sativa 
Japonica Group]
 dbj|BAF24425.1| Os08g0560900 [Oryza sativa Japonica Group]
 gb|EAZ08015.1| hypothetical protein OsI_30281 [Oryza sativa Indica Group]
 gb|EAZ43663.1| hypothetical protein OsJ_28289 [Oryza sativa Japonica Group]
 dbj|BAG88105.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99984.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  59   PAGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  118

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  119  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  155



>ref|NP_171812.1| photosystem I reaction center subunit D-2 [Arabidopsis thaliana]
 sp|Q9SA56.1|PSAD2_ARATH RecName: Full=Photosystem I reaction center subunit II-2, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit 2; Short=PSI-D2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD25795.1|AC006550_3 Strong similarity to gb|X14017 photosystem I reaction centre 
subunit II precursor (psaD) from Spinacia oleracea. ESTs gb|R30423, 
gb|T42998, gb|Z18178, gb|T14133, gb|N65521, gb|T42498, 
gb|T41918, gb|N38024, gb|R65109, gb|T43849, gb|AA394388, 
gb|T20925 and gb|N65696 come from this gene [Arabidopsis thaliana]
 gb|AAG40059.1|AF324708_1 At1g03130 [Arabidopsis thaliana]
 gb|AAG48776.1|AF332413_1 putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAK62620.1| At1g03130/F10O3_4 [Arabidopsis thaliana]
 gb|AAM63823.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAN38693.1| At1g03130/F10O3_4 [Arabidopsis thaliana]
 gb|AEE27534.1| photosystem I reaction center subunit D-2 [Arabidopsis thaliana]
Length=204

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +2

Query  137  QSLHCFSVVPRGLDKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGS  316
            + LH FS   R    S T            +     KEAPVGFTPP LDPNTPSPIF GS
Sbjct  21   KKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGS  80

Query  317  TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  496
            TGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRS
Sbjct  81   TGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRS  140

Query  497  KYXINYQFYRVFPHGE  544
            KY I YQFYRVFP+GE
Sbjct  141  KYKITYQFYRVFPNGE  156



>gb|KFK42673.1| hypothetical protein AALP_AA1G025000 [Arabis alpina]
Length=204

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  60   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  119

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  120  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  156



>ref|XP_010456951.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like, 
partial [Camelina sativa]
Length=205

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162



>ref|XP_010424650.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like, 
partial [Camelina sativa]
Length=205

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162



>ref|XP_010430302.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Camelina sativa]
Length=213

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  69   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  128

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  129  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  165



>ref|XP_010422538.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic 
[Camelina sativa]
Length=210

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162



>gb|KJB28316.1| hypothetical protein B456_005G042000 [Gossypium raimondii]
Length=228

 Score =   192 bits (489),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 122/175 (70%), Gaps = 19/175 (11%)
 Frame = +2

Query  50   MAMAAQASLFA-----SPLSaakpaadrvaaPWKQSLHCFS-----VVPRGLDKSTTAPC  199
            MAMA QASLF      +P S  + AA     P   ++  F      + PR +    T   
Sbjct  1    MAMATQASLFTPSTLRTPKSGDRIAAVLRKQPPFLTVPSFKSPKSIIAPRTIKAEATE--  58

Query  200  RPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSP  379
                   E+     TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SP
Sbjct  59   -------EKAETTATKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESP  111

Query  380  KEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            KEQIFEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  112  KEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  166



>ref|NP_192186.1| photosystem I subunit D-1 [Arabidopsis thaliana]
 sp|Q9S7H1.1|PSAD1_ARATH RecName: Full=Photosystem I reaction center subunit II-1, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit 1; Short=PSI-D1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG40026.1|AF324675_1 AT4g02770 [Arabidopsis thaliana]
 gb|AAG41469.1|AF326887_1 putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAK63862.1|AF389290_1 AT4g02770/T5J8_7 [Arabidopsis thaliana]
 gb|AAD15351.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 emb|CAB52676.1| photosystem I subunit II precursor [Arabidopsis thaliana]
 emb|CAB77762.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAL32590.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10233.1| unknown protein [Arabidopsis thaliana]
 gb|AAM26726.1| AT4g02770/T5J8_7 [Arabidopsis thaliana]
 gb|AAM44987.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AEE82228.1| photosystem I subunit D-1 [Arabidopsis thaliana]
Length=208

 Score =   192 bits (487),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  64   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  123

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  124  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  160



>ref|XP_006396500.1| hypothetical protein EUTSA_v10029178mg [Eutrema salsugineum]
 gb|ESQ37953.1| hypothetical protein EUTSA_v10029178mg [Eutrema salsugineum]
Length=237

 Score =   192 bits (489),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  93   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  152

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  153  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  189



>ref|XP_008438687.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Cucumis melo]
Length=207

 Score =   191 bits (486),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 121/167 (72%), Gaps = 10/167 (6%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQS--LHCFSVVPRGLDKSTTAPCRPIRamae  223
            MAMA QA+LF   LS  K +A  +  PWKQS  L   +  P     S++      R++  
Sbjct  1    MAMATQATLFTPSLSTPKSSAISI--PWKQSPTLSFLTSKPHLKTASSS------RSLKV  52

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
                    EAP GFTPP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  53   SAEAEAAVEAPAGFTPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  112

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  113  TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  159



>ref|XP_010424649.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Camelina sativa]
Length=230

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162



>gb|AAM66066.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
Length=208

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  64   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  123

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  124  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  160



>gb|ACF05884.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  132



>gb|ACF05868.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05879.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05880.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  132



>ref|XP_010522735.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic 
[Tarenaya hassleriana]
Length=207

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  257  VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  436
            VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  64   VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  123

Query  437  NLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  124  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  159



>ref|NP_001275788.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80479.1| PSI reaction center subunit II [Citrus sinensis]
Length=209

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = +2

Query  56   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeette  235
            MA QA LF +P       +     PWK +       P+ L  S     R +RA   E   
Sbjct  1    MATQAGLF-TPSITTTKTSKLPLNPWKPTSSFSFTSPKPLTFSMGQ--RTVRAAGAEGKT  57

Query  236  ap-tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGG  412
               TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGG
Sbjct  58   EAPTKEAPVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGG  117

Query  413  AAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            AAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  118  AAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  161



>gb|ACF05876.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05886.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  132



>ref|XP_009396832.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=259

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 126/176 (72%), Gaps = 12/176 (7%)
 Frame = +2

Query  26   LASTFFISMAMAAQASLFASP--LSaakpaadrvaaPWKQS-LHCFSVVPRGLDKSTTAP  196
            ++S    SMA + QASLF  P  L ++KP+A R   PWK + L   ++  RG        
Sbjct  45   VSSFITTSMATSPQASLFTPPAALPSSKPSAPRSLLPWKHTPLTAGAMSLRGAS------  98

Query  197  CRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTS  376
                R  A E       EAP GFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW S
Sbjct  99   ---FRVSATEEKTEAAPEAPAGFTPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDS  155

Query  377  PKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            PKEQ+FEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  156  PKEQVFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  211



>ref|XP_002278284.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Vitis vinifera]
 emb|CBI28699.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  60   PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  119

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  120  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  156



>gb|ACF05859.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05860.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05869.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05870.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05873.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05875.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05877.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05885.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  132



>gb|ACF05855.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05856.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05857.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05858.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05861.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05862.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05863.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05864.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05865.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05866.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05867.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05872.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05874.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05878.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05881.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05882.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05883.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05887.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05888.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05889.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05890.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05891.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05892.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  132



>emb|CAB52677.1| photosystem I subunit II precursor [Arabidopsis thaliana]
Length=204

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +2

Query  137  QSLHCFSVVPRGLDKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGS  316
            + LH FS   R    S T            +     KEAPVGFTPP LDPNTPSPIF GS
Sbjct  21   KKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGS  80

Query  317  TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  496
            TGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRS
Sbjct  81   TGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRS  140

Query  497  KYXINYQFYRVFPHGE  544
            K+ I YQFYRVFP+GE
Sbjct  141  KFKITYQFYRVFPNGE  156



>emb|CAN61448.1| hypothetical protein VITISV_024141 [Vitis vinifera]
Length=183

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  41   PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  100

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  101  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  137



>ref|XP_010542866.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Tarenaya hassleriana]
Length=206

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  257  VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  436
            VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  63   VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  122

Query  437  NLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  123  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  158



>gb|ACF05871.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  95

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  132



>ref|XP_006444053.1| hypothetical protein CICLE_v10022248mg [Citrus clementina]
 dbj|BAF80471.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80473.1| PSI reaction center subunit II [Citrus sinensis]
 gb|ESR57293.1| hypothetical protein CICLE_v10022248mg [Citrus clementina]
Length=209

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  65   PVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  124

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  125  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  161



>gb|KDO68707.1| hypothetical protein CISIN_1g047658mg [Citrus sinensis]
Length=229

 Score =   191 bits (484),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  65   PVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  124

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  125  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  161



>gb|KJB23065.1| hypothetical protein B456_004G079200 [Gossypium raimondii]
Length=250

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 126/172 (73%), Gaps = 8/172 (5%)
 Frame = +2

Query  35   TFFISMAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRa  214
            T  IS+ MA QA LF   ++ +K  A     PW  S       P+ ++ S  A    +RA
Sbjct  37   TPIISIPMATQAGLFTPTITTSKSLA-----PWNPSSPFSLATPKSINFSM-AQRTSVRA  90

Query  215  maeetteap--tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ  388
             A +   A   TKEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ
Sbjct  91   AAADEAAAAAATKEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQ  150

Query  389  IFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            IFEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  151  IFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  202



>gb|KJB46980.1| hypothetical protein B456_008G004100 [Gossypium raimondii]
Length=210

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMR+G
Sbjct  66   PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPTGGAAIMRQG  125

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  162



>gb|ACN40159.1| unknown [Picea sitchensis]
Length=161

 Score =   187 bits (476),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  17   PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  76

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  77   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  113



>ref|XP_010474916.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=247

 Score =   191 bits (484),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMRE 
Sbjct  103  PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMRER  162

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  163  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  199



>ref|XP_002872810.1| hypothetical protein ARALYDRAFT_490280 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49069.1| hypothetical protein ARALYDRAFT_490280 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   189 bits (480),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  257  VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  436
            VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  63   VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  122

Query  437  NLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  123  NLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  158



>ref|XP_004981348.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Setaria italica]
Length=275

 Score =   191 bits (485),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  131  PKGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  190

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY INYQFYRVFP+GE
Sbjct  191  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGE  227



>ref|XP_010474917.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=241

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMRE 
Sbjct  103  PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMRER  162

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  163  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  199



>gb|KFK30882.1| hypothetical protein AALP_AA6G038200 [Arabis alpina]
Length=207

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  257  VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  436
            VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  64   VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  123

Query  437  NLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  124  NLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  159



>emb|CAA68728.1| unnamed protein product [Spinacia oleracea]
Length=212

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 123/167 (74%), Gaps = 5/167 (3%)
 Frame = +2

Query  50   MAMAAQASLFA-SPLSaakpaadrvaaPWKQ-SLHCFSVVPRGLDKSTTAPCRPIRamae  223
            MAMA QA+LF+ S LS+AKP   R+   +KQ S   F+  P     S  A      A  +
Sbjct  1    MAMATQATLFSPSSLSSAKPIDTRLTTSFKQPSAVTFASKPASRHHSIRAAAA---AEGK  57

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
                  TKEAP GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  58   RAAATETKEAPKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  117

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP GE
Sbjct  118  TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGE  164



>gb|KDP21451.1| hypothetical protein JCGZ_21922 [Jatropha curcas]
Length=205

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  61   PVGFTPPELDPNTPSPIFSGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQG  120

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  121  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  157



>ref|XP_002520727.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF41689.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
Length=209

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  65   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQG  124

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  125  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  161



>emb|CAA32182.1| unnamed protein product [Spinacia oleracea]
Length=212

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 124/167 (74%), Gaps = 5/167 (3%)
 Frame = +2

Query  50   MAMAAQASLFA-SPLSaakpaadrvaaPWKQ-SLHCFSVVPRGLDKSTTAPCRPIRamae  223
            MAMA QA+LF+ S LS+AKP   R+   +KQ S   F+  P     S  A      A  +
Sbjct  1    MAMATQATLFSPSSLSSAKPIDTRLTTSFKQPSALSFASKPASRHHSIRAAAA---AEGK  57

Query  224  etteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMP  403
              T   TKEAP GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMP
Sbjct  58   AATPTETKEAPKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMP  117

Query  404  TGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            TGGAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP GE
Sbjct  118  TGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGE  164



>sp|P12353.2|PSAD_SPIOL RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Spinacia oleracea]
Length=212

 Score =   187 bits (476),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  68   PKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  127

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP GE
Sbjct  128  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGE  164



>gb|ABK21867.1| unknown [Picea sitchensis]
Length=234

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  90   PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  149

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  150  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  186



>ref|XP_009400838.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=207

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  439
            GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMR+G N
Sbjct  65   GFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPTGGAAIMRQGPN  124

Query  440  LLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  125  LLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  159



>gb|ABK21314.1| unknown [Picea sitchensis]
 gb|ABK24570.1| unknown [Picea sitchensis]
 gb|ABK26950.1| unknown [Picea sitchensis]
 gb|ABR17153.1| unknown [Picea sitchensis]
Length=234

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  90   PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  149

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  150  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  186



>ref|XP_010681150.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=217

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  439
            GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG N
Sbjct  75   GFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPN  134

Query  440  LLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  135  LLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  169



>ref|NP_001130880.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACF79256.1| unknown [Zea mays]
 gb|ACG34065.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACR35291.1| unknown [Zea mays]
 tpg|DAA52067.1| TPA: photosystem I reaction center subunit II [Zea mays]
Length=199

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56   PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  116  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  152



>pdb|4RKU|D Chain D, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=137

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  266  TPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLL  445
            TPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLL
Sbjct  1    TPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLL  60

Query  446  KLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            KLARKEQCLALGTRLRSKY I YQFYRVFP GE
Sbjct  61   KLARKEQCLALGTRLRSKYKIKYQFYRVFPSGE  93



>sp|P36213.1|PSAD_HORVU RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Hordeum vulgare]
 gb|AAA18567.1| PSI-D subunit [Hordeum vulgare subsp. vulgare]
 dbj|BAK07564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  439
            GF PP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG N
Sbjct  63   GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPN  122

Query  440  LLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LLKLARKEQCLALG RLRSKY I YQFYRVFP+GE
Sbjct  123  LLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGE  157



>gb|ACG41754.1| photosystem I reaction center subunit II [Zea mays]
Length=199

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56   PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLAR EQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  116  PNLLKLARNEQCLALGTRLRSKYKITYQFYRVFPNGE  152



>gb|ACG25364.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACG45485.1| photosystem I reaction center subunit II [Zea mays]
Length=204

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMREG
Sbjct  61   PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWVSPKEQVFEMPTGGAAIMREG  120

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  121  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  157



>ref|XP_003564108.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Brachypodium distachyon]
Length=204

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  439
            GF PP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG N
Sbjct  62   GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPN  121

Query  440  LLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LLKLARKEQCLALG RLRSKY I YQFYRVFP GE
Sbjct  122  LLKLARKEQCLALGNRLRSKYKIAYQFYRVFPSGE  156



>pdb|2WSC|D Chain D, Improved Model Of Plant Photosystem I
 pdb|2WSE|D Chain D, Improved Model Of Plant Photosystem I
 pdb|2WSF|D Chain D, Improved Model Of Plant Photosystem I
Length=212

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            FTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NL
Sbjct  71   FTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNL  130

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKLARKEQCLALGTRLRSKY I YQFYRVFP GE
Sbjct  131  LKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGE  164



>gb|AFW67274.1| photosystem I reaction center subunit II [Zea mays]
Length=236

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMREG
Sbjct  93   PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWVSPKEQVFEMPTGGAAIMREG  152

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  153  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGE  189



>ref|XP_002991814.1| hypothetical protein SELMODRAFT_26984, partial [Selaginella moellendorffii]
 gb|EFJ07076.1| hypothetical protein SELMODRAFT_26984, partial [Selaginella moellendorffii]
Length=147

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW S KEQIFEMPTGGAAIMR G
Sbjct  3    PAGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESGKEQIFEMPTGGAAIMRSG  62

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALGT+LRSK+ INYQFYRVFP+GE
Sbjct  63   PNLLKLARKEQCLALGTQLRSKFKINYQFYRVFPNGE  99



>ref|XP_001751403.1| predicted protein [Physcomitrella patens]
 gb|EDQ83720.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   178 bits (451),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  22   PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  81

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALG RLR+K+ I YQFYRVFP+GE
Sbjct  82   PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGE  118



>ref|XP_001768962.1| predicted protein [Physcomitrella patens]
 gb|EDQ66316.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   177 bits (450),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  22   PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  81

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALG RLR+K+ I YQFYRVFP+GE
Sbjct  82   PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGE  118



>pdb|3LW5|D Chain D, Improved Model Of Plant Photosystem I
Length=138

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +2

Query  278  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  457
            LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLAR
Sbjct  2    LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLAR  61

Query  458  KEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            KEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  62   KEQCLALGTRLRSKYKIKYQFYRVFPNGE  90



>ref|XP_001752431.1| predicted protein [Physcomitrella patens]
 gb|EDQ82670.1| predicted protein [Physcomitrella patens]
Length=210

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  66   PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  125

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLALG RLR+K+ I YQFYRVFP+GE
Sbjct  126  PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGE  162



>ref|XP_001765579.1| predicted protein [Physcomitrella patens]
 gb|EDQ69629.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  439
            GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G N
Sbjct  14   GFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSGPN  73

Query  440  LLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LLKLARKEQCLALG RLR+K+ I YQFYRVFP+GE
Sbjct  74   LLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGE  108



>emb|CAA54744.1| psaD [Spinacia oleracea]
Length=211

 Score =   176 bits (447),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 86/94 (91%), Gaps = 1/94 (1%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            FTPP LDPNTPSPIF GSTG LLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NL
Sbjct  71   FTPPELDPNTPSPIFAGSTG-LLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNL  129

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKLARKEQCLALGTRLRSKY I YQFYRVFP GE
Sbjct  130  LKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGE  163



>pdb|2O01|D Chain D, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=138

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  278  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  457
            LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLAR
Sbjct  2    LDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLAR  61

Query  458  KEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            KEQCLALGTRLRSKY I YQFYRVFP GE
Sbjct  62   KEQCLALGTRLRSKYKIKYQFYRVFPSGE  90



>gb|KHN02708.1| Photosystem I reaction center subunit II, chloroplastic [Glycine 
soja]
Length=241

 Score =   167 bits (422),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  281  DPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARK  460
            D   PSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARK
Sbjct  29   DHRGPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARK  88

Query  461  EQCLALGTRLRSKYXINYQFYRVFPHGE  544
            EQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  89   EQCLALGTRLRSKYKIKYQFYRVFPNGE  116


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  458  KEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            KEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  165  KEQCLALGTRLRSKYKIKYQFYRVFPNGE  193



>ref|XP_005647040.1| PSI-D1 precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE22496.1| PSI-D1 precursor [Coccomyxa subellipsoidea C-169]
Length=192

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            + PPTLDP+TPSPIFGGSTGGLLRKAQ+EEFYVITW + KEQ+FEMPTGGAAIMR G NL
Sbjct  50   WKPPTLDPSTPSPIFGGSTGGLLRKAQIEEFYVITWDAKKEQVFEMPTGGAAIMRSGPNL  109

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKLARKEQCLAL T+LR+K+  + Q YRVFP GE
Sbjct  110  LKLARKEQCLALLTQLRNKFKTDGQIYRVFPDGE  143



>ref|XP_011400522.1| Photosystem I reaction center subunit II, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27539.1| Photosystem I reaction center subunit II, chloroplastic [Auxenochlorella 
protothecoides]
Length=199

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            F+PPTLDP+TPSP FGGSTGGLLRKAQVEEF+VITW S KEQ+FEMPT GAAIMREG NL
Sbjct  56   FSPPTLDPDTPSPTFGGSTGGLLRKAQVEEFHVITWNSKKEQVFEMPTAGAAIMREGPNL  115

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKL+RKEQCLAL T+LR+K+ I+   YRVFP+GE
Sbjct  116  LKLSRKEQCLALLTQLRTKFKIDGAIYRVFPNGE  149



>ref|XP_002992973.1| hypothetical protein SELMODRAFT_448960 [Selaginella moellendorffii]
 gb|EFJ05919.1| hypothetical protein SELMODRAFT_448960 [Selaginella moellendorffii]
Length=976

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  278  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  457
            L P+TPSPIFGGSTGGLLRKAQVEEFYVITW S KEQIFEMPTGGAAIMR G NLLKLAR
Sbjct  840  LKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESGKEQIFEMPTGGAAIMRSGPNLLKLAR  899

Query  458  KEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            KEQCLALGT+LRSK+ INYQFYRVFP+GE
Sbjct  900  KEQCLALGTQLRSKFKINYQFYRVFPNGE  928



>gb|KIZ01091.1| Photosystem I reaction center subunit II, chloroplastic [Monoraphidium 
neglectum]
Length=187

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 94/136 (69%), Gaps = 18/136 (13%)
 Frame = +2

Query  137  QSLHCFSVVPRGLDKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGS  316
            +S+   SVV R  + +  A  +P                   FT PTL+P+TPSPIFGGS
Sbjct  22   KSMRVRSVVVRASEGAPAATAKP------------------AFTAPTLNPDTPSPIFGGS  63

Query  317  TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  496
            TGGLL+KAQVEEFYVITW S KEQIFEMP GGAAIMR+G NLLKLARKE CLAL T+LR+
Sbjct  64   TGGLLKKAQVEEFYVITWESAKEQIFEMPLGGAAIMRKGPNLLKLARKEHCLALTTQLRN  123

Query  497  KYXINYQFYRVFPHGE  544
            K+ I   FYRV+P GE
Sbjct  124  KFKIQPAFYRVYPTGE  139



>ref|XP_002953316.1| hypothetical protein VOLCADRAFT_121148 [Volvox carteri f. nagariensis]
 gb|EFJ45626.1| hypothetical protein VOLCADRAFT_121148 [Volvox carteri f. nagariensis]
Length=179

 Score =   155 bits (393),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            +TPPTL+P+TPSPIFGGSTGGLLRKAQ EEFYVITW S KEQIFEMPTGGAAIMR+G NL
Sbjct  36   WTPPTLNPDTPSPIFGGSTGGLLRKAQQEEFYVITWDSKKEQIFEMPTGGAAIMRQGPNL  95

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LK A+KEQCLAL T+LR+K+ +   FYRVFP G+
Sbjct  96   LKFAKKEQCLALTTQLRTKFKLTPAFYRVFPDGK  129



>ref|XP_003063552.1| photosystem I subunit II, chloroplast precursor [Micromonas pusilla 
CCMP1545]
 gb|EEH51925.1| photosystem I subunit II, chloroplast precursor [Micromonas pusilla 
CCMP1545]
Length=225

 Score =   156 bits (394),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            ++PP L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW +PKE IFEMPTGGAAIMR+G NL
Sbjct  70   WSPPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAPKEMIFEMPTGGAAIMRKGPNL  129

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKLARKEQCLAL   +R+K  IN   YRVFP GE
Sbjct  130  LKLARKEQCLALLNSMRAKNKINGCVYRVFPSGE  163



>ref|XP_002504652.1| photosystem I subunit II, chloroplast precursor [Micromonas sp. 
RCC299]
 gb|ACO65910.1| photosystem I subunit II, chloroplast precursor [Micromonas sp. 
RCC299]
Length=216

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            ++PP L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW +PKE IFEMPTGGAAIMR+G NL
Sbjct  61   WSPPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAPKEMIFEMPTGGAAIMRKGPNL  120

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKLARKEQCLAL   +R+K  IN   YRVFP GE
Sbjct  121  LKLARKEQCLALLNSMRAKNKINGCVYRVFPSGE  154



>ref|XP_003592408.1| Photosystem I reaction center subunit II [Medicago truncatula]
 gb|AES62659.1| photosystem I reaction center subunit II [Medicago truncatula]
Length=193

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 101/165 (61%), Gaps = 20/165 (12%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeet  229
            MAMA Q +LF  P   +    + V+ PWKQS       P     + ++  +         
Sbjct  1    MAMATQTTLFTPPF-FSAKPNEHVSVPWKQSPTLSFTNPNLFKLTISSNIK------TAA  53

Query  230  teaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTG  409
                  EAPVGFTPP LDPNTPSPIF              EF+VITW SPKEQIFE+  G
Sbjct  54   VTEEATEAPVGFTPPELDPNTPSPIFS-------------EFHVITWDSPKEQIFEIANG  100

Query  410  GAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            GAAIMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  101  GAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  145



>gb|KIZ02718.1| Photosystem I reaction center subunit II, chloroplastic [Monoraphidium 
neglectum]
Length=169

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            F+ PTL+P+TPSPIFGGSTGGLL+KAQVEEFYVITW S KEQIFEMP GGAAIMR+G NL
Sbjct  28   FSAPTLNPDTPSPIFGGSTGGLLKKAQVEEFYVITWESAKEQIFEMPLGGAAIMRKGPNL  87

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKLARKE CLAL T+LR+K+ I   FYRV+P GE
Sbjct  88   LKLARKEHCLALTTQLRNKFKIQPAFYRVYPTGE  121



>ref|XP_007226637.1| hypothetical protein PRUPE_ppa022366mg [Prunus persica]
 gb|EMJ27836.1| hypothetical protein PRUPE_ppa022366mg [Prunus persica]
Length=192

 Score =   153 bits (386),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 108/163 (66%), Gaps = 19/163 (12%)
 Frame = +2

Query  56   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeette  235
            MA QA+LF    SA K + +R   PWKQS+    + P+ L  S+T     I A AEE T 
Sbjct  1    MATQATLFTPTPSAPKTSVERSTVPWKQSVSSSFMAPKPLKLSSTTRTMRINAAAEEKTV  60

Query  236  aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  415
            AP KEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEF                    
Sbjct  61   APPKEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFL-------------------  101

Query  416  AIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            +IMREG NLLKLARKEQCLALGTRLRSKY I YQFYRVFP+GE
Sbjct  102  SIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGE  144



>gb|ABK96248.1| unknown [Populus trichocarpa x Populus deltoides]
Length=166

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  290  TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQC  469
             P   F  STGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQC
Sbjct  34   VPHHQFLVSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARKEQC  93

Query  470  LALGTRLRSKYXINYQFYRVFPHGE  544
            LALGTRLRSKY I YQFYRVFP+GE
Sbjct  94   LALGTRLRSKYKIKYQFYRVFPNGE  118



>ref|XP_007511428.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17549.1| predicted protein [Bathycoccus prasinos]
Length=199

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            ++ P LDPNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KEQIFEMPTGGAAIMR+G NL
Sbjct  58   WSAPKLDPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEQIFEMPTGGAAIMRKGPNL  117

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKLARKEQC+AL T  R+K   N   YRVFP GE
Sbjct  118  LKLARKEQCMALVTTFRAKKIANGCIYRVFPSGE  151



>emb|CEG01861.1| Photosystem I PsaD [Ostreococcus tauri]
Length=188

 Score =   151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P  +T P LDPNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KE IFEMPTGGAAIMR+G
Sbjct  43   PAVWTAPKLDPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEAIFEMPTGGAAIMRKG  102

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLAL    RSK  ++   YRVFP GE
Sbjct  103  PNLLKLARKEQCLALLNTFRSKMKLDGCIYRVFPSGE  139



>gb|EMS56878.1| Photosystem I reaction center subunit II, chloroplastic [Triticum 
urartu]
Length=156

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +2

Query  317  TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  496
            TGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG NLLKLARKEQCLALG RLRS
Sbjct  33   TGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGNRLRS  92

Query  497  KYXINYQFYRVFPHGE  544
            KY I YQFYRVFP+GE
Sbjct  93   KYKIAYQFYRVFPNGE  108



>ref|XP_005847397.1| hypothetical protein CHLNCDRAFT_35549 [Chlorella variabilis]
 gb|EFN55295.1| hypothetical protein CHLNCDRAFT_35549 [Chlorella variabilis]
Length=186

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P  + PP LD + PSPIFGGSTGGLLR+AQVEEF+VITW + KEQIFEMPTGGAAIMR+G
Sbjct  42   PKPWAPPALDASAPSPIFGGSTGGLLRQAQVEEFHVITWEAKKEQIFEMPTGGAAIMRQG  101

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
             NLLKLARKEQCLAL T+LR+K+  +   YRVFP+GE
Sbjct  102  PNLLKLARKEQCLALLTQLRTKFKTDGFIYRVFPNGE  138



>ref|XP_001697722.1| photosystem I reaction center subunit II, 20 kDa [Chlamydomonas 
reinhardtii]
 sp|Q39615.1|PSAD_CHLRE RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAL73208.1|AF335592_1 photosystem I subunit [Chlamydomonas reinhardtii]
 emb|CAA56122.1| psaD [Chlamydomonas reinhardtii]
 emb|CAA52440.1| PSI reaction center, subunit II [Chlamydomonas reinhardtii]
 gb|EDO99874.1| photosystem I reaction center subunit II, 20 kDa [Chlamydomonas 
reinhardtii]
Length=196

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            +T PTL+P+TPSPIFGGSTGGLLRKAQ EEFYVITW + KEQIFEMPTGGAAIMR+G NL
Sbjct  53   WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNL  112

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LK  +KEQCLAL T+LR+K+ +   FYRVFP G+
Sbjct  113  LKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGK  146



>ref|XP_001421350.1| psaD, PSI-D, subunit II, photosystem I protein [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99643.1| psaD, PSI-D, subunit II, photosystem I protein [Ostreococcus 
lucimarinus CCE9901]
Length=192

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            +T P L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KE IFEMPTGGAAIMR+G NL
Sbjct  50   WTAPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEAIFEMPTGGAAIMRKGPNL  109

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            LKLARKEQCLAL    R+K  ++   YRVFP GE
Sbjct  110  LKLARKEQCLALLNNFRAKMKLDGCIYRVFPSGE  143



>emb|CAL25356.1| photosystem I reaction center subunit II [Platanus x acerifolia]
Length=122

 Score =   143 bits (361),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  323  GLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKY  502
            GLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKY
Sbjct  1    GLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKY  60

Query  503  XINYQFYRVFPHGE  544
             I YQFYRVFP+GE
Sbjct  61   KIKYQFYRVFPNGE  74



>sp|Q9T4W8.1|PSAD_CYAPA RecName: Full=Photosystem I reaction center subunit II, cyanelle; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Cyanophora paradoxa]
 emb|CAB64901.1| photosystem I reaction centre subunit II precursor [Cyanophora 
paradoxa]
Length=220

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P  F+ PTL+ N P+PIFGGSTGGLLRKA+VEEFY ITWT   E +FE+PTGGAAIMR G
Sbjct  71   PKPFSVPTLNLNAPTPIFGGSTGGLLRKAEVEEFYSITWTGKSETVFELPTGGAAIMRAG  130

Query  434  ANLLKLARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
             NLL+LARKEQC+ALG +L+ K+ I +Y+ YRV+P GE
Sbjct  131  ENLLRLARKEQCIALGAQLKDKFKITDYKIYRVYPSGE  168



>emb|CBI26230.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 88/129 (68%), Gaps = 9/129 (7%)
 Frame = +2

Query  56   MAAQASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeette  235
            MA QASLF   LS  +        PWK S       P+ L KS+ AP   IRAMAEE   
Sbjct  1    MATQASLFTPTLSGDRVTV-----PWKSSSSLSFTTPK-LPKSSVAPRTTIRAMAEEAPT  54

Query  236  aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  415
                  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGA
Sbjct  55   KEA---PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGA  111

Query  416  AIMREGANL  442
            AIMR+G  +
Sbjct  112  AIMRQGVGV  120



>ref|YP_009029191.1| photosystem I reaction center subunit II (chloroplast) [Didymosphenia 
geminata]
 gb|AGH28722.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Didymosphenia geminata]
Length=139

 Score =   135 bits (341),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|YP_004376584.1| photosystem I ferredoxin-binding protein (chloroplast) [Fistulifera 
solaris]
 dbj|BAK18950.1| photosystem I ferredoxin-binding protein (chloroplast) [Fistulifera 
solaris]
Length=139

 Score =   135 bits (341),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|WP_009769007.1| PsaD protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ66743.1| PsaD protein [Oscillatoriales cyanobacterium JSC-12]
Length=139

 Score =   135 bits (341),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            PIFGGSTGGLL KA VEE Y ITW+SPKEQ+FEMPT GAA+MR+G NLL LARKEQCLAL
Sbjct  10   PIFGGSTGGLLTKALVEEKYAITWSSPKEQVFEMPTAGAAVMRQGDNLLYLARKEQCLAL  69

Query  479  GTRLRSKYXINYQFYRVFPHGE  544
            GT+L++K+ I+Y+ YRVFP+G+
Sbjct  70   GTQLKTKFKIDYKIYRVFPNGD  91



>ref|YP_003734986.1| photosystem I protein subunit II [Durinskia baltica]
 gb|ADI40201.1| photosystem I protein subunit II [Durinskia baltica]
Length=139

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    NY+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGE  91



>ref|YP_003734548.1| ferredoxin-binding protein II [Kryptoperidinium foliaceum]
 gb|ADI40333.1| ferredoxin-binding protein II [Kryptoperidinium foliaceum]
Length=139

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    NY+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGE  91



>ref|YP_009029026.1| photosystem I reaction center subunit II (chloroplast) [Cylindrotheca 
closterium]
 gb|AGH28565.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Cylindrotheca closterium]
Length=139

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSAKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    NY+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGE  91



>ref|YP_009059209.1| photosystem I reaction center subunit II (chloroplast) [Eunotia 
naegelii]
 gb|AHI51156.1| photosystem I reaction center subunit II (chloroplast) [Eunotia 
naegelii]
Length=139

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    NY+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGE  91



>ref|YP_005089671.1| psaD gene product (chloroplast) [Ulnaria acus]
 gb|AEX37796.1| photosystem I subunit II (chloroplast) [Ulnaria acus]
Length=139

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSTKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    NY+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGE  91



>ref|YP_009093018.1| photosystem I subunit II (chloroplast) [Rhizosolenia imbricata]
 gb|AIR75691.1| photosystem I subunit II (chloroplast) [Rhizosolenia imbricata]
Length=139

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    NY+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKLNNYKIYRIFPSGE  91



>ref|YP_009029302.1| photosystem I reaction center subunit II (chloroplast) [Leptocylindrus 
danicus]
 gb|AGH28833.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Leptocylindrus danicus]
Length=139

 Score =   133 bits (335),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAA+MR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAVMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR      Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRGFKINGYKIYRIFPSGE  91



>ref|YP_874394.1| photosystem I ferredoxin-binding protein [Phaeodactylum tricornutum]
 gb|ABK20617.1| photosystem I ferredoxin-binding protein [Phaeodactylum tricornutum]
Length=139

 Score =   133 bits (335),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMP GGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSPKEQIFEMPIGGAAIMRSGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|YP_009092872.1| photosystem I subunit II (chloroplast) [Chaetoceros simplex]
 gb|AIR75263.1| photosystem I subunit II (chloroplast) [Chaetoceros simplex]
Length=139

 Score =   133 bits (335),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|YP_009093339.1| photosystem I subunit II (chloroplast) [Cerataulina daemon]
 gb|AIR76012.1| photosystem I subunit II (chloroplast) [Cerataulina daemon]
Length=139

 Score =   133 bits (334),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|YP_009029445.1| photosystem I reaction center subunit II (chloroplast) [Lithodesmium 
undulatum]
 gb|AGH28976.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Lithodesmium undulatum]
Length=139

 Score =   133 bits (334),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSNKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|WP_016872271.1| MULTISPECIES: Photosystem I reaction center subunit II [Fischerella]
Length=142

 Score =   133 bits (334),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LARKEQC+A
Sbjct  9    TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGQNLLYLARKEQCIA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG +LR     +Y+ YR++P+GE
Sbjct  69   LGGQLRKFKITDYKIYRIYPNGE  91



>ref|NP_043647.1| photosystem I subunit II [Odontella sinensis]
 sp|P49481.1|PSAD_ODOSI RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Odontella sinensis]
 emb|CAA91679.1| PSI, ferredoxin-binding protein II [Odontella sinensis]
Length=139

 Score =   133 bits (334),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|YP_009019626.1| photosystem I reaction center subunit II (chloroplast) [Gracilaria 
salicornia]
 gb|AHH24594.1| photosystem I reaction center subunit II (chloroplast) [Gracilaria 
salicornia]
Length=141

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            T+D   PSP FGGSTGG LR A++EE Y ITWTS KEQIFEMPTGGAAIM+EG NLL LA
Sbjct  4    TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKKEQIFEMPTGGAAIMQEGNNLLYLA  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            RKEQCLALGT+L++++ I +++ YR+FP+ E
Sbjct  64   RKEQCLALGTQLKTQFKITDFKIYRIFPNSE  94



>ref|YP_009028878.1| photosystem I reaction center subunit II (chloroplast) [Coscinodiscus 
radiatus]
 gb|AGH28422.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Coscinodiscus radiatus]
Length=139

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>gb|EHC11738.1| photosystem I protein PsaD [Fischerella sp. JSC-11]
Length=159

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            F   TL   TP  IFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NL
Sbjct  17   FMAETLSGQTP--IFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGQNL  74

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            L LARKEQC+ALG +LR     +Y+ YR++P+GE
Sbjct  75   LYLARKEQCIALGGQLRKFKITDYKIYRIYPNGE  108



>gb|AFR24825.1| photosystem I reaction center subunit II [uncultured Pelagomonas]
Length=139

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TLD    +PIFGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLDSQIQTPIFGGSTGGWLRAAQIEEKYAITWSSAKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|WP_028824843.1| Photosystem I reaction center subunit II [Proteobacteria bacterium 
JGI 0000113-P07]
Length=139

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TLD    +PIFGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLDSQIQTPIFGGSTGGWLRAAQIEEKYAITWSSAKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINDYKIYRIFPSGE  91



>ref|YP_003002042.1| photosystem I reaction center subunit II [Aureococcus anophagefferens]
 gb|ACS36806.1| photosystem I reaction center subunit II [Aureococcus anophagefferens]
Length=139

 Score =   131 bits (330),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TLD    +P+FGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLDSQIQTPLFGGSTGGWLRAAQIEEKYAITWSSSKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKITDYKIYRIFPSGE  91



>ref|WP_017321535.1| Photosystem I reaction center subunit II [cyanobacterium PCC 
7702]
 sp|O07115.1|PSAD_MASLA RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D [Mastigocladus 
laminosus]
 gb|AAC64637.1| photosystem I protein PsaD [Fischerella sp. PCC 7605]
Length=142

 Score =   131 bits (330),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAA MR+G NLL LARKEQC+A
Sbjct  9    TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAKMRQGQNLLYLARKEQCIA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG++LR     +Y+ YR++P+GE
Sbjct  69   LGSQLRRLKITDYKIYRIYPNGE  91



>ref|YP_001936347.1| photosystem I subunit II [Heterosigma akashiwo]
 gb|ABV65953.1| photosystem I reaction center subunit II [Heterosigma akashiwo]
 gb|ABV70094.1| photosystem I reaction center subunit II [Heterosigma akashiwo]
Length=139

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  T SPIFGGSTGG LR A++EE YVITW+S KEQ+FEMPTGGAAIM +G NLL LA
Sbjct  2    TLNLQTFSPIFGGSTGGWLRAAEIEEKYVITWSSSKEQLFEMPTGGAAIMLQGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LRS    +Y+ YR+FP+GE
Sbjct  62   RKEQCLALGTQLRSFKINDYKIYRLFPNGE  91



>ref|WP_016876091.1| Photosystem I reaction center subunit II [Chlorogloeopsis fritschii]
Length=142

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAA MR+G NLL LARKEQC+A
Sbjct  9    TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAKMRQGQNLLYLARKEQCIA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG++LR     +Y+ YR++P+GE
Sbjct  69   LGSQLRRFKITDYKIYRIYPNGE  91



>gb|KCW60797.1| hypothetical protein EUGRSUZ_H03534 [Eucalyptus grandis]
Length=186

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 103/168 (61%), Gaps = 20/168 (12%)
 Frame = +2

Query  50   MAMAAQASLFASPLSaakpaadrvaaPWKQSLHCFSV-VPRGLDKSTTAPCRPIRamaee  226
            MAMA QASLF +P      +  R+A  WKQS    S   PR L  S   P   IRA A E
Sbjct  1    MAMATQASLF-TPALTGLRSGKRIALAWKQSASFLSFPNPRELKFS---PRTTIRAAAGE  56

Query  227  ttea--ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEM  400
                    +EAP+GFT P LD NTPSPIF GST GLL KA              EQIFEM
Sbjct  57   GKAETPAKEEAPIGFTSPELDQNTPSPIFSGSTDGLLCKA-------------PEQIFEM  103

Query  401  PTGGAAIMREGANLLKLARKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            P GG AI+R+G N LKLARKEQCLALGTRLRSKY I YQFYRV P+G+
Sbjct  104  PMGGIAIVRQGPNPLKLARKEQCLALGTRLRSKYKIKYQFYRVLPNGK  151



>ref|YP_009028619.1| photosystem I reaction center subunit II (chloroplast) [Asterionella 
formosa]
 gb|AGH28170.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Asterionella formosa]
Length=139

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPT GAAIMR G NLL L+
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSNKEQIFEMPTAGAAIMRNGENLLYLS  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    NY+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGE  91



>ref|WP_026795097.1| MULTISPECIES: Photosystem I reaction center subunit II [Planktothrix]
Length=142

 Score =   131 bits (329),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 70/85 (82%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NL+ LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTKALVEEKYAITWTSSKEQVFEMPTGGAAIMNEGDNLMYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LRSK+     NY+ YRVFP+GE
Sbjct  70   GTQLRSKFKPKIDNYKIYRVFPNGE  94



>ref|WP_008189408.1| PsaD [Moorea producens]
 gb|EGJ29445.1| PsaD [Moorea producens 3L]
Length=142

 Score =   131 bits (329),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAEVEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+LR+K+     +Y+ YRV+P+GE
Sbjct  69   LGTQLRTKFKPKIEDYKIYRVYPNGE  94



>ref|WP_017300022.1| Photosystem I reaction center subunit II [Nodosilinea nodulosa]
Length=142

 Score =   130 bits (328),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KAQVEE Y ITWTSPK+Q+FEMPTGGAA M EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAQVEEKYAITWTSPKKQVFEMPTGGAAFMNEGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+LR+K+     +Y+ YRV+P GE
Sbjct  69   LGTQLRTKFKPRIDDYKVYRVYPSGE  94



>ref|YP_001293570.1| photosystem I subunit II [Rhodomonas salina]
 gb|ABO70759.1| photosystem I subunit II [Rhodomonas salina]
Length=141

 Score =   130 bits (328),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+   PSP F GSTGG LR A+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LA
Sbjct  4    TLNLQIPSPTFEGSTGGWLRAAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGENLLYLA  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            RKEQCLAL T++++ + I +Y+ YR+FP GE
Sbjct  64   RKEQCLALATQVKNSFKITDYKVYRIFPSGE  94



>ref|YP_009093191.1| photosystem I subunit II (chloroplast) [Roundia cardiophora]
 gb|AIR75864.1| photosystem I subunit II (chloroplast) [Roundia cardiophora]
Length=139

 Score =   130 bits (328),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLAL T+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALSTQLRTFKINDYKIYRIFPSGE  91



>ref|YP_009028747.1| photosystem I reaction center subunit II (chloroplast) [Asterionellopsis 
glacialis]
 gb|AGH28296.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Asterionellopsis glacialis]
Length=139

 Score =   130 bits (328),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITW S KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWGSNKEQIFEMPTGGAAIMRNGDNLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALG +LR+    NY+ YR+FP GE
Sbjct  62   RKEQCLALGMQLRTFKIDNYKIYRIFPSGE  91



>ref|YP_009093464.1| photosystem I subunit II (chloroplast) [Thalassiosira weissflogii]
 gb|AIR76137.1| photosystem I subunit II (chloroplast) [Thalassiosira weissflogii]
Length=139

 Score =   130 bits (327),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLAL T+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALSTQLRTFKINDYKIYRIFPSGE  91



>ref|WP_018400163.1| Photosystem I reaction center subunit II [filamentous cyanobacterium 
ESFC-1]
Length=142

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA+VEE Y ITWTSPKEQ+FEMPTGGAAIM EG N+L+LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTKAKVEEKYAITWTSPKEQVFEMPTGGAAIMNEGENMLELARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +Y+ YR++P+GE
Sbjct  70   GTQLRTKFKPKMEDYKIYRIYPNGE  94



>ref|NP_050759.1| photosystem I subunit II (chloroplast) [Guillardia theta]
 sp|O78502.1|PSAD_GUITH RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Guillardia theta]
 gb|AAC35693.1| PSI ferredoxin-binding protein II (chloroplast) [Guillardia theta]
Length=141

 Score =   130 bits (327),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+   PSP F GSTGG LR A+ EE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LA
Sbjct  4    TLNLQIPSPTFEGSTGGWLRAAETEEKYAITWTSPKEQVFEMPTGGAAIMRKGENLLYLA  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            RKEQCLALGT++++ + I +Y+ YR+FP GE
Sbjct  64   RKEQCLALGTQVKTSFKITDYKIYRIFPSGE  94



>ref|YP_874547.1| photosystem I ferredoxin-binding protein [Thalassiosira pseudonana]
 ref|XP_002297531.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|ABK20770.1| photosystem I ferredoxin-binding protein [Thalassiosira pseudonana]
 gb|EED86171.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=139

 Score =   130 bits (327),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSTKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLAL T+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALSTQLRTFKINDYKIYRIFPSGE  91



>gb|AIA21513.1| photosystem I subunit II [Pyropia fucicola]
Length=141

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  269  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  448
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  449  LARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            LA+KEQCLALGT+L+SK+ I +Y+ YRVFP+GE
Sbjct  62   LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGE  94



>ref|YP_007947808.1| photosystem I subunit II (chloroplast) [Pyropia haitanensis]
 gb|AGG37057.1| photosystem I subunit II (chloroplast) [Pyropia haitanensis]
Length=141

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  269  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  448
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  449  LARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            LA+KEQCLALGT+L+SK+ I +Y+ YRVFP+GE
Sbjct  62   LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGE  94



>ref|YP_536961.1| photosystem I subunit II [Pyropia yezoensis]
 sp|Q1XDK7.1|PSAD_PYRYE RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Pyropia yezoensis]
 dbj|BAE92404.1| Photosystem I reaction centre subunit II [Pyropia yezoensis]
 gb|AGH27605.1| photosystem I subunit II (chloroplast) [Pyropia yezoensis]
Length=141

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  269  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  448
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  449  LARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            LA+KEQCLALGT+L+SK+ I +Y+ YRVFP+GE
Sbjct  62   LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGE  94



>gb|AJO68451.1| photosystem I subunit II (chloroplast) [Gracilariopsis lemaneiformis]
Length=141

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            T+D   PSP FGGSTGG LR A++EE Y ITWTS +EQIFEMPTGG+AIMREG NLL LA
Sbjct  4    TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKQEQIFEMPTGGSAIMREGNNLLYLA  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            +KEQCLAL ++L +K+ I +++ YR+FP+GE
Sbjct  64   KKEQCLALSSQLNTKFKITDFKIYRIFPNGE  94



>ref|WP_009787700.1| photosystem I subunit II [Lyngbya sp. PCC 8106]
 gb|EAW33738.1| photosystem I subunit II [Lyngbya sp. PCC 8106]
Length=142

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            PIFGGSTGGLL KA++EE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PIFGGSTGGLLSKAEIEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +++ YR++P+GE
Sbjct  70   GTQLRTKFKPKIEDFKIYRIYPNGE  94



>ref|WP_023068767.1| photosystem I reaction center subunit II [Lyngbya aestuarii]
 gb|ERT04980.1| photosystem I reaction center subunit II [Lyngbya aestuarii BL 
J]
Length=142

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            PIFGGSTGGLL KA++EE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PIFGGSTGGLLSKAEIEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +++ YR++P+GE
Sbjct  70   GTQLRTKFKPKMEDFKIYRIYPNGE  94



>ref|WP_026733629.1| Photosystem I reaction center subunit II [Fischerella sp. PCC 
9605]
Length=142

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P+FGGSTGGLL+KA+VEE Y ITWTSPK+Q+FEMPTGG+AIMR+G NLL LARKEQC+A
Sbjct  9    TPVFGGSTGGLLKKAEVEEKYAITWTSPKQQVFEMPTGGSAIMRQGENLLYLARKEQCIA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG +LR     +Y+ YR++P+GE
Sbjct  69   LGGQLRKFKITDYKIYRIYPNGE  91



>gb|AFC39948.1| photosystem I subunit II [Porphyra umbilicalis]
Length=141

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  269  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  448
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR+G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRDGENLLY  61

Query  449  LARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            LA+KEQCLALGT+L+ K+ I +Y+ YRVFP+GE
Sbjct  62   LAKKEQCLALGTQLKGKFKISDYKIYRVFPNGE  94



>ref|YP_008965721.1| photosystem I reaction center subunit II (chloroplast) [Porphyridium 
purpureum]
 dbj|BAO23697.1| photosystem I reaction center subunit II (chloroplast) [Porphyridium 
purpureum]
Length=142

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            T++   PSP FGGSTGG LR A+ EE Y ITWT  KE+IFE+PTGGAAIMREG NLL LA
Sbjct  4    TINLQMPSPTFGGSTGGWLRAAETEEKYAITWTGKKEEIFEIPTGGAAIMREGDNLLYLA  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            RKEQCLALGT+LR+ + I +Y+ YR+FP GE
Sbjct  64   RKEQCLALGTQLRNSFKISDYKIYRIFPTGE  94



>sp|O96800.1|PSAD_SKECO RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Skeletonema costatum]
 emb|CAA10621.1| PSI ferredoxin-binding protein II [Skeletonema costatum]
Length=139

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGG+AIMR G NLL LA
Sbjct  2    TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSAKEQIFEMPTGGSAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLAL T+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALSTQLRTFKINDYKIYRIFPSGE  91



>ref|WP_015145740.1| PsaD [Pleurocapsa minor]
 gb|AFY79442.1| PsaD [Pleurocapsa sp. PCC 7327]
Length=142

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 70/85 (82%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTKADVEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            G +LR+K+     NY+ YR++P+GE
Sbjct  70   GAQLRTKFKPKIENYKIYRIYPNGE  94



>ref|NP_053889.1| photosystem I subunit II [Porphyra purpurea]
 sp|P51279.1|PSAD_PORPU RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Porphyra purpurea]
 gb|AAC08165.1| Photosystem I reaction centre subunit II (chloroplast) [Porphyra 
purpurea]
Length=141

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  269  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  448
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR+G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRDGENLLY  61

Query  449  LARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            LA+KEQCLALGT+L+ K+ I +Y+ YRVFP+GE
Sbjct  62   LAKKEQCLALGTQLKGKFKISDYKIYRVFPNGE  94



>gb|AIR75448.1| photosystem I subunit II (chloroplast) [Cyclotella sp. L04_2]
 gb|AIR75589.1| photosystem I subunit II (chloroplast) [Cyclotella sp. WC03_2]
Length=138

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  278  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  457
            L+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGG+AIMR G NLL LAR
Sbjct  3    LNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGSAIMRSGENLLYLAR  62

Query  458  KEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            KEQCLAL T+LR+    +Y+ YR+FP GE
Sbjct  63   KEQCLALMTQLRTFKINDYKIYRIFPSGE  91



>ref|WP_016866973.1| Photosystem I reaction center subunit II [Fischerella muscicola]
Length=140

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LARKEQ +A
Sbjct  9    TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGQNLLYLARKEQGIA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG +LR     +Y+ YR++P+GE
Sbjct  69   LGGQLRKFKITDYKIYRIYPNGE  91



>ref|YP_003002181.1| photosystem I reaction center subunit II (chloroplast) [Aureoumbra 
lagunensis]
 gb|ACS36893.1| photosystem I reaction center subunit II (chloroplast) [Aureoumbra 
lagunensis]
Length=139

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TLD    +PIF GSTGG LR AQVEE Y ITW S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLDSQIQTPIFEGSTGGWLRAAQVEEKYAITWGSSKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLALGT+LR+    +Y+ YR+FP GE
Sbjct  62   RKEQCLALGTQLRTFKITDYKIYRIFPSGE  91



>ref|WP_008312724.1| PsaD [Leptolyngbya sp. PCC 6406]
Length=142

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KA VEE Y ITWTS +EQ+FE+PTGGAAIM EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAAVEEKYAITWTSTQEQVFELPTGGAAIMNEGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+LR+K+    ++Y+ YR++P+GE
Sbjct  69   LGTQLRTKFKPKIVDYKIYRIYPNGE  94



>ref|YP_008144865.1| photosystem I reaction center subunit II [Grateloupia taiwanensis]
 gb|AGO19836.1| photosystem I reaction center subunit II [Grateloupia taiwanensis]
Length=133

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = +2

Query  293  PSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCL  472
            PSP FGGSTGG LR A++EE Y ITWTS  EQIFEMPTGGAAIMREG NLL LA+KEQCL
Sbjct  2    PSPTFGGSTGGWLRAAEIEEKYAITWTSKSEQIFEMPTGGAAIMREGNNLLYLAKKEQCL  61

Query  473  ALGTRLRSKYXI-NYQFYRVFPHGE  544
            AL T+LR+K+ I +++ YR+FP GE
Sbjct  62   ALSTQLRAKFKITDFKIYRIFPDGE  86



>ref|WP_015173693.1| photosystem I protein PsaD [Geitlerinema sp. PCC 7407]
 gb|AFY68129.1| photosystem I protein PsaD [Geitlerinema sp. PCC 7407]
Length=142

 Score =   128 bits (322),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KA+VEE Y ITWTS K+Q+FEMPTGGAA+M EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAEVEEKYAITWTSKKQQVFEMPTGGAAVMNEGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LG +LR+K+     +Y+ YRVFP+GE
Sbjct  69   LGAQLRTKFKPKMEDYKIYRVFPNGE  94



>ref|WP_006616635.1| MULTISPECIES: photosystem I protein PsaD [Arthrospira]
 gb|EDZ95101.1| photosystem I protein PsaD [Arthrospira maxima CS-328]
 dbj|BAI90809.1| photosystem I reaction center subunit II [Arthrospira platensis 
NIES-39]
 emb|CCE16228.1| Photosystem I reaction center subunit II (Photosystem I 16 kDa 
polypeptide) (PSI-D) [Arthrospira sp. PCC 8005]
 gb|EKD05964.1| photosystem I protein PsaD [Arthrospira platensis C1]
 emb|CDM94815.1| Photosystem I reaction center subunit II (Photosystem I 16 kDa 
polypeptide) (PSI-D) [Arthrospira sp. PCC 8005]
 gb|KDR56251.1| Photosystem I reaction center subunit II [Arthrospira platensis 
str. Paraca]
Length=142

 Score =   128 bits (322),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL KAQVEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLA
Sbjct  9    APKFGGSTGGLLTKAQVEEKYAITWTSTKEQVFEMPTGGAAIMNEGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+LR+K+     +++ YR+FP+GE
Sbjct  69   LGTQLRTKFKPKIEDFKIYRIFPNGE  94



>ref|WP_026788324.1| MULTISPECIES: Photosystem I reaction center subunit II [Planktothrix]
Length=142

 Score =   128 bits (321),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NL+ LA KEQCLAL
Sbjct  10   PKFGGSTGGLLTKALVEEKYAITWTSSKEQVFEMPTGGAAIMNEGDNLMYLALKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LRSK+     NY+ YRVFP+GE
Sbjct  70   GTQLRSKFKPKIDNYKIYRVFPNGE  94



>gb|AIA21307.1| photosystem I subunit II [Pyropia kanakaensis]
Length=141

 Score =   128 bits (321),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  269  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  448
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  449  LARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            LA+KEQCLALGT+L+ K+ I +Y+ YRVFP+GE
Sbjct  62   LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGE  94



>ref|WP_017662216.1| Photosystem I reaction center subunit II [Geitlerinema sp. PCC 
7105]
Length=142

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKADVEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+LR+K+     +++ YR++P+GE
Sbjct  69   LGTQLRTKFKPKIEDFKIYRIYPNGE  94



>ref|WP_011613167.1| photosystem I protein PsaD [Trichodesmium erythraeum]
 gb|ABG52837.1| photosystem I protein PsaD [Trichodesmium erythraeum IMS101]
Length=142

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            PIFGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM +G NLL LARKEQCLAL
Sbjct  10   PIFGGSTGGLLTKAEVEEKYAITWTSSKEQVFEMPTGGAAIMNQGENLLYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHG  541
            GT+LR+K+     N++ YRVFP G
Sbjct  70   GTQLRTKFKPKIDNFKIYRVFPDG  93



>ref|WP_035996822.1| Photosystem I reaction center subunit II [Leptolyngbya sp. JSC-1]
Length=142

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KA  EE Y ITWTS KEQ+FEMPTGGAA+MR+G NLL LARKEQC+A
Sbjct  9    TPIFGGSTGGLLSKADEEEKYAITWTSSKEQVFEMPTGGAAVMRQGENLLYLARKEQCIA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LG +LRSK+     +Y+ YRVFP GE
Sbjct  69   LGAQLRSKFKPKIEDYKIYRVFPSGE  94



>ref|WP_015195039.1| photosystem I protein PsaD [Stanieria cyanosphaera]
 gb|AFZ37380.1| photosystem I protein PsaD [Stanieria cyanosphaera PCC 7437]
Length=142

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL KAQVEE Y ITWTSPKEQ+FEMPTGGAA M EG N+L LARKEQC+A
Sbjct  9    APQFGGSTGGLLYKAQVEEKYAITWTSPKEQVFEMPTGGAATMNEGDNILYLARKEQCIA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            +G +LR+K+     NY+ YR++P+GE
Sbjct  69   MGAQLRTKFKPKIENYKIYRIYPNGE  94



>ref|WP_035986603.1| Photosystem I reaction center subunit II [Leptolyngbya sp. KIOST-1]
Length=142

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KAQVEE Y ITWTSPK+Q+FEMPTGGAA M EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAQVEEKYAITWTSPKKQVFEMPTGGAAFMNEGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LG +LR+K+     NY+ YRV+  GE
Sbjct  69   LGRQLRAKFKPRIENYKIYRVYASGE  94



>ref|YP_063618.1| photosystem I subunit II [Gracilaria tenuistipitata var. liui]
 gb|AAT79693.1| photosystem I reaction center subunit II [Gracilaria tenuistipitata 
var. liui]
Length=141

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            T+D   PSP FGGSTGG LR A++EE Y ITWTS +EQIFEMP GGAAIMREG NLL LA
Sbjct  4    TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKQEQIFEMPIGGAAIMREGNNLLYLA  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            RKEQCLAL T+L+ ++ I +++ YR+FP+ E
Sbjct  64   RKEQCLALSTQLKMQFKIKDFKIYRIFPNSE  94



>ref|WP_015182846.1| PsaD [Microcoleus sp. PCC 7113]
 gb|AFZ18697.1| PsaD [Microcoleus sp. PCC 7113]
Length=141

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 2/85 (2%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KAQVEE Y ITWTSPK+Q+FEMPTGGAA+M EG NLL L+RKE C+A
Sbjct  9    APIFGGSTGGLLTKAQVEEKYAITWTSPKQQVFEMPTGGAAVMNEGDNLLYLSRKEYCIA  68

Query  476  L-GTRLRSKYXI-NYQFYRVFPHGE  544
            L G +LR+K+ I NY+ YR+FP+GE
Sbjct  69   LGGQQLRAKFKINNYKIYRIFPNGE  93



>ref|WP_017304392.1| Photosystem I reaction center subunit II [Spirulina subsalsa]
Length=142

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTKADVEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +Y+ YR++P+GE
Sbjct  70   GTQLRTKFKPKIEDYKIYRIYPNGE  94



>ref|YP_009027562.1| photosystem I subunit II [Pyropia perforata]
 gb|AGQ17098.1| photosystem I subunit II [Pyropia perforata]
 gb|AHB35056.1| photosystem I subunit II (chloroplast) [Pyropia perforata]
 gb|AHB35265.1| photosystem I subunit II (chloroplast) [Pyropia perforata]
 gb|AIA19427.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA19636.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA19845.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20263.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20472.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20681.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20890.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA21099.1| photosystem I subunit II [Pyropia perforata]
Length=141

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  269  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  448
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   +  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKSDSKFEMPTGGTATMRNGENLLY  61

Query  449  LARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            LA+KEQCLALGT+L+ K+ I +Y+ YRVFP+GE
Sbjct  62   LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGE  94



>gb|AIA20054.1| photosystem I subunit II [Pyropia perforata]
Length=141

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  269  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  448
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   +  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKSDSKFEMPTGGTATMRNGENLLY  61

Query  449  LARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            LA+KEQCLALGT+L+ K+ I +Y+ YRVFP+GE
Sbjct  62   LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGE  94



>ref|WP_019505782.1| Photosystem I reaction center subunit II [Pleurocapsa sp. PCC 
7319]
Length=142

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PQFGGSTGGLLTKAEVEEKYAITWTSKKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            G +LR+K+     +Y+ YRVFP GE
Sbjct  70   GAQLRTKFKPRIQDYKIYRVFPSGE  94



>ref|WP_013323038.1| photosystem I protein PsaD [Cyanothece sp. PCC 7822]
 gb|ADN14945.1| photosystem I protein PsaD [Cyanothece sp. PCC 7822]
Length=141

 Score =   126 bits (316),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA +EE Y ITWTSPKEQ+FE+PTGGAAIM EG NLL LARKEQC+AL
Sbjct  9    PKFGGSTGGLLSKANLEEKYAITWTSPKEQVFELPTGGAAIMNEGDNLLYLARKEQCIAL  68

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            G + RSK+     NY+ YR+FP+GE
Sbjct  69   GGQFRSKFKPKIDNYKIYRIFPNGE  93



>ref|YP_007627400.1| photosystem I subunit II [Chondrus crispus]
 emb|CCP38147.1| photosystem I subunit II [Chondrus crispus]
Length=141

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            T++   PSP FGGSTGG LR A++EE Y ITWTS  EQIFEMPTGGAAIMREG NLL LA
Sbjct  4    TINFKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKSEQIFEMPTGGAAIMREGDNLLYLA  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            +KEQCLAL  +LR  + I +++ YR+FP+GE
Sbjct  64   KKEQCLALSAQLRKSFKIRDFKIYRIFPNGE  94



>ref|YP_005088653.1| photosystem I subunit II [Phaeocystis antarctica]
 gb|AEK26757.1| photosystem I subunit II [Phaeocystis antarctica]
Length=141

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  278  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  457
            LD    SP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT G+AIM++G NLL LA+
Sbjct  5    LDLQIASPTFGGSTGGWLRAAETEEKYAITWTSKKEQIFEMPTSGSAIMQKGENLLYLAK  64

Query  458  KEQCLALGTRLRSKYXIN-YQFYRVFPHGE  544
            KEQCLALGT+LR+ + IN Y+ YR+FP+ E
Sbjct  65   KEQCLALGTQLRTSFKINDYKIYRIFPNSE  94



>gb|AAP79147.1| photosystem I protein PsaD [Bigelowiella natans]
Length=278

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  254  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  433
            P  FTPPTLDPNTP P F G+TGGLLR A  +EFY IT+ SPK+QIFEMPTGGAA MR+G
Sbjct  73   PYVFTPPTLDPNTPMPRFQGNTGGLLRSASFQEFYAITFESPKDQIFEMPTGGAAEMRKG  132

Query  434  ANLLKLARKEQCLALGTRLRSKYXINYQFYRV  529
             NL+K ARKEQCLAL T+LR+K+ I+   YR+
Sbjct  133  KNLVKFARKEQCLALLTQLRTKFKIDGFIYRI  164



>gb|EDX77926.1| photosystem I reaction center subunit II [Coleofasciculus chthonoplastes 
PCC 7420]
Length=156

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P+FGGSTGGLL KAQVEE Y ITWTS K+Q+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  24   PLFGGSTGGLLTKAQVEEKYAITWTSSKKQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  83

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+++     +Y+ YR++P GE
Sbjct  84   GTQLRTQFKPKMEDYKIYRIYPSGE  108



>ref|WP_044204978.1| Photosystem I reaction center subunit II [Coleofasciculus chthonoplastes]
Length=150

 Score =   125 bits (315),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P+FGGSTGGLL KAQVEE Y ITWTS K+Q+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  18   PLFGGSTGGLLTKAQVEEKYAITWTSSKKQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  77

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+++     +Y+ YR++P GE
Sbjct  78   GTQLRTQFKPKMEDYKIYRIYPSGE  102



>ref|YP_004072560.1| photosystem I reaction center subunit II [Thalassiosira oceanica 
CCMP1005]
 gb|ADB27514.1| photosystem I reaction center subunit II [Thalassiosira oceanica 
CCMP1005]
 gb|EJK52341.1| hypothetical protein THAOC_28388 [Thalassiosira oceanica]
 gb|EJK54217.1| hypothetical protein THAOC_26187 [Thalassiosira oceanica]
 gb|EJK55845.1| hypothetical protein THAOC_24369 [Thalassiosira oceanica]
Length=139

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            T++  T  P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGG+AIMR G NLL LA
Sbjct  2    TVNLKTSFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGSAIMRNGENLLYLA  61

Query  455  RKEQCLALGTRLRSKYXINYQFYRVFPHGE  544
            RKEQCLAL T+L++    +Y+ YR+FP GE
Sbjct  62   RKEQCLALSTQLKTFKVNDYKIYRIFPSGE  91



>ref|WP_006632802.1| photosystem I protein PsaD [Microcoleus vaginatus]
 gb|EGK88021.1| photosystem I protein PsaD [Microcoleus vaginatus FGP-2]
Length=141

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            PIFGGSTGGLL KA VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL L RKEQC+AL
Sbjct  10   PIFGGSTGGLLTKALVEEKYAITWTSPKEQVFEMPTGGAAIMRQGDNLLYLPRKEQCIAL  69

Query  479  -GTRLRSKYXI-NYQFYRVFPHG  541
             G +LR+K+ I NY+ YRVFP G
Sbjct  70   GGQQLRAKFKITNYKIYRVFPDG  92



>ref|YP_008145427.1| photosystem I subunit II (chloroplast) [Phaeocystis globosa]
 gb|AGO44889.1| photosystem I subunit II (chloroplast) [Phaeocystis globosa]
Length=141

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  278  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  457
            LD    SP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT G+AIM++G NLL LA+
Sbjct  5    LDLQIASPTFGGSTGGWLRAAETEEKYAITWTSKKEQIFEMPTSGSAIMQKGENLLYLAK  64

Query  458  KEQCLALGTRLRSKYXIN-YQFYRVFPHGE  544
            KEQCLALGT+LR+ + +N Y+ YR+FP+ E
Sbjct  65   KEQCLALGTQLRTSFKVNDYKIYRIFPNSE  94



>ref|WP_012165369.1| photosystem I protein PsaD [Acaryochloris marina]
 gb|ABW30106.1| photosystem I protein PsaD [Acaryochloris marina MBIC11017]
Length=139

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P+FGGSTGGLL  A+ EE Y ITWTSPK+Q+FEMPTGGAA+M EG NLL LARKEQCLA
Sbjct  9    TPLFGGSTGGLLSSAETEEKYAITWTSPKQQVFEMPTGGAAVMNEGENLLYLARKEQCLA  68

Query  476  LGTR-LRSKYXINYQFYRVFPHG  541
            LG R LR+K  ++Y+ YRV P G
Sbjct  69   LGLRQLRTKKIMDYKIYRVLPDG  91



>ref|WP_010468189.1| photosystem I protein PsaD [Acaryochloris sp. CCMEE 5410]
Length=139

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P+FGGSTGGLL  A+ EE Y ITWTSPK+Q+FEMPTGGAA+M EG NLL LARKEQCLA
Sbjct  9    TPLFGGSTGGLLSSAETEEKYAITWTSPKQQVFEMPTGGAAVMNEGENLLYLARKEQCLA  68

Query  476  LGTR-LRSKYXINYQFYRVFPHG  541
            LG R LR+K  ++Y+ YRV P G
Sbjct  69   LGLRQLRTKKIMDYKIYRVLPDG  91



>gb|ACF24542.1| photosystem I reaction center subunit II [Gymnochlora stellata]
Length=277

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
            FT P LDPNTP P F G+TGGLLR A  +EFY IT+ SPKEQIFEMPTGGAA MR+G NL
Sbjct  77   FTAPALDPNTPMPRFQGNTGGLLRSASFQEFYAITFESPKEQIFEMPTGGAAEMRKGPNL  136

Query  443  LKLARKEQCLALGTRLRSKYXINYQFYRV  529
            +K ARKEQCLAL T+LR+K+ IN   YR+
Sbjct  137  VKFARKEQCLALLTQLRTKFKINGNIYRI  165



>ref|WP_026721381.1| Photosystem I reaction center subunit II [Fischerella sp. PCC 
9431]
Length=140

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL+KA+VEE Y ITWTS KEQ+FEMPTGGAA+M +G NLL LARKEQC+A
Sbjct  9    TPKFGGSTGGLLKKAEVEEKYAITWTSSKEQVFEMPTGGAAVMSQGENLLYLARKEQCIA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG +LR     +Y+ YR++P+GE
Sbjct  69   LGGQLRKFKITDYKIYRIYPNGE  91



>ref|WP_017309650.1| Photosystem I reaction center subunit II [Fischerella sp. PCC 
9339]
Length=140

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL+KA+VEE Y ITWTS KEQ+FEMPTGGAA+M +G NLL LARKEQC+A
Sbjct  9    TPKFGGSTGGLLKKAEVEEKYAITWTSAKEQVFEMPTGGAAVMSQGQNLLYLARKEQCIA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG +LR     +Y+ YR++P+GE
Sbjct  69   LGGQLRKFKITDYKIYRIYPNGE  91



>ref|WP_006509381.1| PsaD [Xenococcus sp. PCC 7305]
 gb|ELS03529.1| PsaD [Xenococcus sp. PCC 7305]
Length=142

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL  A+VEE Y ITWTS KEQ+FEMPTGGAAIM  G NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTAAEVEEKYAITWTSSKEQVFEMPTGGAAIMNSGENLLYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +Y+ YRVFP+GE
Sbjct  70   GTQLRTKFKPRIQDYKVYRVFPNGE  94



>gb|AHY04349.1| photosystem I reaction center subunit II (chloroplast) [Chrysochromulina 
sp. CCMP291]
Length=141

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  278  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  457
            L+   PSP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT GAAIM+ G NLL LA+
Sbjct  5    LNLQIPSPTFGGSTGGWLRSAETEEKYAITWTSKKEQIFEMPTSGAAIMKSGENLLYLAK  64

Query  458  KEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            KEQCLALGT+LR+ + I +Y+ YR+FP+ E
Sbjct  65   KEQCLALGTQLRTLFKISDYKIYRIFPNSE  94



>ref|WP_017715328.1| Photosystem I reaction center subunit II [Oscillatoria sp. PCC 
10802]
Length=142

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM +G NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAEVEEKYAITWTSSKEQVFEMPTGGAAIMHQGQNLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LG +LR+K+     +Y+ YR++ +GE
Sbjct  69   LGAQLRTKFKPKIEDYKIYRIYANGE  94



>ref|WP_015157762.1| PsaD [Chamaesiphon minutus]
 gb|AFY91567.1| PsaD [Chamaesiphon minutus PCC 6605]
Length=138

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGGSTGGLL KA VEE Y ITW SPKEQ+FEMPTGGAA M  G NLL  ARKEQCLA
Sbjct  9    TPIFGGSTGGLLSKADVEEKYAITWNSPKEQVFEMPTGGAATMVSGDNLLNFARKEQCLA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG +LR     NY+ YR+ P GE
Sbjct  69   LGGQLRKYKINNYKVYRILPKGE  91



>ref|WP_007305646.1| Photosystem I protein PsaD [Crocosphaera watsonii]
 gb|EAM50690.1| Photosystem I protein PsaD [Crocosphaera watsonii WH 8501]
 emb|CCQ60541.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0401]
 emb|CCQ48941.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 8502]
 emb|CCQ56533.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0005]
 emb|CCQ65642.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0402]
Length=142

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA+ EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGLLSKAEREEKYAITWTSKKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +Y+ YRV+P GE
Sbjct  70   GTQLRTKFKPRIQDYKIYRVYPSGE  94



>ref|WP_036530202.1| Photosystem I reaction center subunit II [Neosynechococcus sphagnicola]
 gb|KGF74025.1| Photosystem I reaction center subunit II [Neosynechococcus sphagnicola 
sy1]
Length=139

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P+FGGSTGGLL  A VEE Y ITWTSPK Q+FEMPTGGAA M+EG NLL LARKEQCLAL
Sbjct  10   PLFGGSTGGLLTNADVEEKYAITWTSPKAQVFEMPTGGAATMQEGENLLPLARKEQCLAL  69

Query  479  GTRLRSKYXINYQFYRVFPHGE  544
            GT+LR     +Y+ YR+FP G+
Sbjct  70   GTQLRKFKITDYKIYRIFPGGD  91



>ref|WP_017288063.1| Photosystem I reaction center subunit II [Leptolyngbya boryana]
Length=140

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P+FGGSTGGLL KA VEE Y ITW+SPKEQ+FEMP  GAA MR+G NLL LARKE CLA
Sbjct  9    APLFGGSTGGLLTKALVEEKYAITWSSPKEQVFEMPMCGAAKMRQGDNLLYLARKEHCLA  68

Query  476  LGTRLRSKYXI-NYQFYRVFPHGE  544
            LG +LR+K+ I NY+ YRVFP+GE
Sbjct  69   LGGQLRTKFKITNYKIYRVFPNGE  92



>ref|WP_007356552.1| MULTISPECIES: photosystem I protein PsaD [Kamptonema]
 emb|CBN57352.1| photosystem I protein PsaD [ [[Oscillatoria] sp. PCC 6506]
Length=141

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            PIFGGSTGGLL KA VEE Y ITW+SPKEQ+FEMPTGGAAIMR+G NLL L RKEQC+AL
Sbjct  10   PIFGGSTGGLLTKALVEEKYAITWSSPKEQVFEMPTGGAAIMRQGDNLLYLPRKEQCIAL  69

Query  479  -GTRLRSKYXI-NYQFYRVFPHG  541
             G +LR+K+ I NY+ YR+FP G
Sbjct  70   GGQQLRAKFKITNYKIYRIFPDG  92



>ref|WP_041622790.1| Photosystem I reaction center subunit II [Oscillatoria nigro-viridis]
Length=141

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P+FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMP+GGAAIMR+G NLL L RKEQC+AL
Sbjct  10   PLFGGSTGGLLTKALVEEKYAITWTSPKEQVFEMPSGGAAIMRQGDNLLHLPRKEQCIAL  69

Query  479  -GTRLRSKYXI-NYQFYRVFPHG  541
             G +LR+K+ I NY+ YRVFP G
Sbjct  70   GGQQLRAKFKITNYKIYRVFPDG  92



>emb|CDY22079.1| BnaA09g01080D [Brassica napus]
Length=150

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 90/132 (68%), Gaps = 15/132 (11%)
 Frame = +2

Query  56   MAAQAS-LFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLDKSTTAPCRPIRamaeett  232
            MAAQAS LF+S ++ A  +         + LH F+   R   +S + P   IRA   ++ 
Sbjct  1    MAAQASGLFSSAVTTAATSGV-------KKLHLFTTSHR--PRSLSFPKTAIRAEKADSA  51

Query  233  ea-----ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFE  397
             A       +EAPVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFE
Sbjct  52   AAAPAAAVKEEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFE  111

Query  398  MPTGGAAIMREG  433
            MPTGGAAIMREG
Sbjct  112  MPTGGAAIMREG  123



>ref|YP_007878240.1| photosystem I subunit II (chloroplast) [Calliarthron tuberculosum]
 gb|AGA63851.1| photosystem I subunit II (chloroplast) [Calliarthron tuberculosum]
Length=141

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            T++   PSP FGGSTGG LR A+VEE Y ITW S KEQIFEMPTGGAAIMRE  NLL L+
Sbjct  4    TINFQMPSPTFGGSTGGWLRSAEVEEKYAITWNSKKEQIFEMPTGGAAIMREDDNLLYLS  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            RKEQCLAL ++L SK+ I + + YR+FP GE
Sbjct  64   RKEQCLALSSQLLSKFKIRDCKIYRIFPSGE  94



>ref|WP_015124443.1| PsaD [Synechococcus sp. PCC 6312]
 gb|AFY60899.1| PsaD [Synechococcus sp. PCC 6312]
Length=140

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P++ GSTGGLL KA+VEE Y ITWTSPKEQ+FEMPT GAA+MREG NL+ LARKEQCLAL
Sbjct  10   PLYAGSTGGLLTKAEVEEKYAITWTSPKEQVFEMPTAGAAVMREGENLVYLARKEQCLAL  69

Query  479  GT-RLRSKYXINYQFYRVFPHGE  544
               +LR +   NYQ YR+FP GE
Sbjct  70   AAQQLRPRKINNYQIYRIFPDGE  92



>ref|WP_016859046.1| Photosystem I reaction center subunit II [Fischerella muscicola]
Length=140

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAA+M +G NLL LARKEQ +A
Sbjct  9    TPKFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAVMSQGQNLLYLARKEQGIA  68

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG +LR     +Y+ YR++P+GE
Sbjct  69   LGGQLRKFKITDYKIYRIYPNGE  91



>gb|AFZ10051.1| photosystem I protein PsaD [Oscillatoria nigro-viridis PCC 7112]
Length=154

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P+FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMP+GGAAIMR+G NLL L RKEQC+AL
Sbjct  23   PLFGGSTGGLLTKALVEEKYAITWTSPKEQVFEMPSGGAAIMRQGDNLLHLPRKEQCIAL  82

Query  479  -GTRLRSKYXI-NYQFYRVFPHG  541
             G +LR+K+ I NY+ YRVFP G
Sbjct  83   GGQQLRAKFKITNYKIYRVFPDG  105



>ref|YP_277398.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AAU81920.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AAX13897.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AEI29557.1| photosystem I subunit II [Emiliania huxleyi]
Length=142

 Score =   123 bits (308),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +2

Query  263  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  442
             T   L+   P+P FGGSTGG LR A++EE Y ITWTS KEQIFEMPT GAAIM++G NL
Sbjct  1    MTSDVLNLQIPTPTFGGSTGGWLRAAEIEEKYAITWTSKKEQIFEMPTSGAAIMQKGENL  60

Query  443  LKLARKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            L LA+KEQCLAL T+LR+ + I +Y+ YR+FP+ E
Sbjct  61   LYLAKKEQCLALSTQLRTLFKISDYKIYRIFPNSE  95



>ref|YP_009051089.1| photosystem I subunit II [Galdieria sulphuraria]
 ref|XP_005705023.1| [pt] photosystem I subunit II [Galdieria sulphuraria]
 gb|ADO32968.1| photosystem I 20kDa subunit [Galdieria sulphuraria]
 gb|EME28503.1| [pt] photosystem I subunit II [Galdieria sulphuraria]
 gb|AIG92532.1| photosystem I subunit II [Galdieria sulphuraria]
Length=141

 Score =   123 bits (308),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            TL+   PSP FGGSTGG LR A+ EE Y ITW S  E++FEMPT GAA+MR G NLL  A
Sbjct  4    TLNLKMPSPSFGGSTGGWLRSAENEEKYAITWISKNEEVFEMPTAGAALMRSGENLLYFA  63

Query  455  RKEQCLALGTRLRSKYXI-NYQFYRVFPHGE  544
            RKEQCL+LGT+L++++ I NY+ YRVFP+GE
Sbjct  64   RKEQCLSLGTQLKTQFKIDNYKIYRVFPNGE  94



>gb|AJH65942.1| photosystem I reaction center subunit II [Vertebrata lanosa]
Length=143

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  275  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  454
            T++   PSP FGGSTGG LR A+VEE Y ITW S  + IFEMPTGG+AIM EG NLL LA
Sbjct  4    TINFKIPSPTFGGSTGGWLRSAEVEEKYAITWNSKNKDIFEMPTGGSAIMAEGDNLLYLA  63

Query  455  RKEQCLALGTRLRSKYXIN-YQFYRVFPHGE  544
            +KEQCLAL  +L+SK+ IN ++ YR+FP+GE
Sbjct  64   KKEQCLALSNQLKSKFKINDFKIYRIFPNGE  94



>ref|WP_012629607.1| photosystem I protein PsaD [Cyanothece sp. PCC 7425]
 gb|ACL46557.1| photosystem I protein PsaD [Cyanothece sp. PCC 7425]
Length=140

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P+FGGSTGGLL KA  EE Y ITWTSP EQ+FEMPTGGAA+MR+G NLL LARKEQC+AL
Sbjct  10   PLFGGSTGGLLSKATTEEKYAITWTSPVEQVFEMPTGGAAVMRQGDNLLYLARKEQCIAL  69

Query  479  -GTRLRSKYXINYQFYRVFPHGE  544
             G +LR K   NY+ YRVF  GE
Sbjct  70   GGQQLRPKKITNYKIYRVFADGE  92



>gb|EDX84590.1| photosystem I reaction center subunit II [Synechococcus sp. PCC 
7335]
Length=155

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 68/85 (80%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL  A VEE Y ITWTS KEQ+FEMPTGGAA M EG NLL+LARKEQCLAL
Sbjct  8    PKFGGSTGGLLTAAFVEERYAITWTSSKEQVFEMPTGGAATMNEGENLLELARKEQCLAL  67

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            G +LR+K+     +Y+ YR+FP+GE
Sbjct  68   GAQLRTKFKPKITDYKIYRIFPNGE  92



>ref|WP_038016768.1| Photosystem I reaction center subunit II, partial [Synechococcus 
sp. PCC 7335]
Length=139

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 68/85 (80%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL  A VEE Y ITWTS KEQ+FEMPTGGAA M EG NLL+LARKEQCLAL
Sbjct  8    PKFGGSTGGLLTAAFVEERYAITWTSSKEQVFEMPTGGAATMNEGENLLELARKEQCLAL  67

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            G +LR+K+     +Y+ YR+FP+GE
Sbjct  68   GAQLRTKFKPKITDYKIYRIFPNGE  92



>ref|WP_015956499.1| photosystem I protein PsaD [Cyanothece sp. PCC 7424]
 gb|ACK72916.1| photosystem I protein PsaD [Cyanothece sp. PCC 7424]
Length=141

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA++EE Y ITWTSPKEQ+FEMPTGGAAIM EG N+L L+RKEQCLAL
Sbjct  9    PKFGGSTGGLLSKAKLEEKYAITWTSPKEQVFEMPTGGAAIMNEGDNILYLSRKEQCLAL  68

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            G + R+++     N++ YR+FP+GE
Sbjct  69   GGQFRTQFKPKIENFKIYRIFPNGE  93



>ref|WP_010871317.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 ref|NP_440008.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 sp|P19569.2|PSAD_SYNY3 RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 pdb|4KT0|D Chain D, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|D Chain D, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|DD Chain d, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|4 Chain 4, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 gb|AAA88625.1| photosystem I subunit II [Synechocystis sp.]
 dbj|BAA16688.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 dbj|BAK48859.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 dbj|BAL27858.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31028.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34197.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50390.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 gb|AGF50377.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
Length=141

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 67/85 (79%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA  EE Y ITWTS  EQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  9    PKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  68

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +Y+ YRV+P GE
Sbjct  69   GTQLRTKFKPKIQDYKIYRVYPSGE  93



>ref|WP_012593753.1| MULTISPECIES: photosystem I protein PsaD [Cyanothece]
 gb|ACK64476.1| photosystem I protein PsaD [Cyanothece sp. PCC 8801]
 gb|ACU99346.1| photosystem I protein PsaD [Cyanothece sp. PCC 8802]
Length=142

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            SP FGGSTGGLL KA  EE Y ITWTS  EQ+FEMPTGGAAIM +G NLL LARKEQCLA
Sbjct  9    SPKFGGSTGGLLSKADREEKYAITWTSTTEQVFEMPTGGAAIMNKGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+LR+K+     +Y+ YR++P GE
Sbjct  69   LGTQLRTKFKPKIQDYKIYRIYPSGE  94



>ref|WP_039725494.1| MULTISPECIES: Photosystem I reaction center subunit II [Oscillatoriophycideae]
 gb|KIF13826.1| Photosystem I reaction center subunit II [Aphanocapsa montana 
BDHKU210001]
 gb|KIF38764.1| Photosystem I reaction center subunit II [Lyngbya confervoides 
BDU141951]
Length=142

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL  A VEE Y ITWTS KEQ+FEMPTGG+AIM EG NLL LARKEQCLA
Sbjct  9    TPKFGGSTGGLLTAAAVEEKYAITWTSSKEQVFEMPTGGSAIMNEGENLLYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LG +LR+K+     +Y+ YR++P GE
Sbjct  69   LGAQLRTKFKPRIQDYKIYRIYPSGE  94



>ref|WP_009544162.1| MULTISPECIES: photosystem I protein PsaD [Cyanothece]
Length=142

 Score =   120 bits (302),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA+ EE Y ITWTS  EQ+FEMPTGGAAIM EG NLL L+RKEQCLAL
Sbjct  10   PKFGGSTGGLLSKAEREEKYAITWTSKTEQVFEMPTGGAAIMNEGENLLYLSRKEQCLAL  69

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +Y+ YR++P GE
Sbjct  70   GTQLRTKFKPKIQDYKIYRIYPSGE  94



>ref|WP_006530712.1| PsaD [Gloeocapsa sp. PCC 73106]
 gb|ELR96477.1| PsaD [Gloeocapsa sp. PCC 73106]
Length=142

 Score =   120 bits (301),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL  A  EE Y ITWTS KEQ+FEMPTGGAAIM EG N+L LARKEQCLA
Sbjct  9    TPKFGGSTGGLLSAADREEKYAITWTSSKEQVFEMPTGGAAIMNEGDNILYLARKEQCLA  68

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LG +LR+K+     N++ YRVFP+GE
Sbjct  69   LGGQLRTKFKPKIENFKIYRVFPNGE  94



>ref|WP_028947468.1| Photosystem I reaction center subunit II [Synechocystis sp. PCC 
6714]
 gb|AIE75111.1| photosystem I subunit II (PsaD) [Synechocystis sp. PCC 6714]
Length=141

 Score =   120 bits (301),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 67/85 (79%), Gaps = 3/85 (4%)
 Frame = +2

Query  299  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  478
            P FGGSTGGLL KA  EE Y ITWTS  EQ+FEMPTGGAAIM +G NLL LARKEQCLAL
Sbjct  9    PKFGGSTGGLLSKADREEKYAITWTSASEQVFEMPTGGAAIMNQGENLLYLARKEQCLAL  68

Query  479  GTRLRSKYX---INYQFYRVFPHGE  544
            GT+LR+K+     +Y+ YRV+P GE
Sbjct  69   GTQLRTKFKPKIQDYKIYRVYPSGE  93



>ref|WP_027844942.1| Photosystem I reaction center subunit II [Mastigocoleus testarum]
Length=140

 Score =   120 bits (300),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +PIFGG+TGGLL+KAQ EE Y ITWTSPKEQ+FE+PTGGAA+M EG NL+ L RKE C+A
Sbjct  9    TPIFGGNTGGLLQKAQEEEKYAITWTSPKEQVFELPTGGAAVMNEGENLIYLPRKEHCIA  68

Query  476  LGTR-LRSKYXINYQFYRVFPHGE  544
            LG R LR     +Y+ YR++P+GE
Sbjct  69   LGVRKLRPLKITDYKIYRIYPNGE  92



>ref|WP_002738785.1| photosystem I reaction center subunit II [Microcystis aeruginosa]
 emb|CCH94447.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9432]
 emb|CCH96336.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9717]
 gb|ELP52789.1| photosystem I reaction center subunit II [Microcystis aeruginosa 
TAIHU98]
 gb|EPF19444.1| Photosystem I 16 kDa polypeptide [Microcystis aeruginosa SPC777]
 gb|EPF19589.1| Photosystem I 16 kDa polypeptide [Microcystis aeruginosa SPC777]
Length=141

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL KA +EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQ LA
Sbjct  8    APKFGGSTGGLLAKADLEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQALA  67

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+ R+K+     +Y+ YR++P GE
Sbjct  68   LGTQFRTKFKPKIEDYKIYRIYPSGE  93



>ref|WP_006275750.1| MULTISPECIES: Photosystem I protein PsaD [Nostocaceae]
 gb|EFA71172.1| Photosystem I protein PsaD [Cylindrospermopsis raciborskii CS-505]
 gb|EFA72050.1| Photosystem I protein PsaD [Raphidiopsis brookii D9]
Length=138

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P+FGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAA MR G NLL +ARKE  +A
Sbjct  8    TPLFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAATMRTGENLLYIARKEYGIA  67

Query  476  LGTRLRSKYXINYQFYRVFPHGE  544
            LG +LR     +Y+ YR+ P GE
Sbjct  68   LGAQLRKFKITDYKVYRILPSGE  90



>dbj|GAL93034.1| photosystem I subunit II (PsaD) [Microcystis aeruginosa NIES-44]
Length=141

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL KA +EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKE  LA
Sbjct  8    APKFGGSTGGLLAKADLEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEHALA  67

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+LR+K+     +Y+ YR++P GE
Sbjct  68   LGTQLRTKFKPKIEDYKIYRIYPSGE  93



>ref|WP_002796771.1| Photosystem I reaction center subunit II [Microcystis aeruginosa]
 dbj|BAG02152.1| photosystem I subunit II [Microcystis aeruginosa NIES-843]
 emb|CCI24167.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9809]
Length=141

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  296  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  475
            +P FGGSTGGLL KA +EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKE  LA
Sbjct  8    APKFGGSTGGLLTKADLEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEHALA  67

Query  476  LGTRLRSKYX---INYQFYRVFPHGE  544
            LGT+LR+K+     +Y+ YR++P GE
Sbjct  68   LGTQLRTKFKPKIEDYKIYRIYPSGE  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335