BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051E12

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO96226.1|  sugar-porter family protein 7                          258   2e-80   Solanum lycopersicum
ref|XP_009777420.1|  PREDICTED: sugar transporter ERD6-like 7           257   2e-79   Nicotiana sylvestris
ref|XP_007050715.1|  Major facilitator superfamily protein isoform 1    254   9e-79   
ref|XP_002270927.2|  PREDICTED: sugar transporter ERD6-like 7           254   1e-78   Vitis vinifera
ref|XP_009614908.1|  PREDICTED: sugar transporter ERD6-like 7           254   2e-78   Nicotiana tomentosiformis
ref|XP_006358441.1|  PREDICTED: sugar transporter ERD6-like 7-like      253   3e-78   Solanum tuberosum [potatoes]
gb|KJB47013.1|  hypothetical protein B456_008G006300                    252   1e-77   Gossypium raimondii
gb|KJB47011.1|  hypothetical protein B456_008G006300                    252   1e-77   Gossypium raimondii
gb|EYU43551.1|  hypothetical protein MIMGU_mgv1a005532mg                250   5e-77   Erythranthe guttata [common monkey flower]
ref|XP_002302812.2|  sugar transporter family protein                   248   4e-76   Populus trichocarpa [western balsam poplar]
gb|KJB23160.1|  hypothetical protein B456_004G084300                    247   1e-75   Gossypium raimondii
emb|CBI32306.3|  unnamed protein product                                245   1e-75   Vitis vinifera
ref|XP_007162379.1|  hypothetical protein PHAVU_001G147100g             246   2e-75   Phaseolus vulgaris [French bean]
ref|XP_011079781.1|  PREDICTED: sugar transporter ERD6-like 7           245   4e-75   Sesamum indicum [beniseed]
ref|XP_010242566.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    244   5e-75   
ref|XP_004493632.1|  PREDICTED: sugar transporter ERD6-like 7-like      244   6e-75   Cicer arietinum [garbanzo]
emb|CDP03586.1|  unnamed protein product                                243   9e-75   Coffea canephora [robusta coffee]
ref|NP_001233882.1|  st3 protein                                        244   9e-75   
ref|XP_010242564.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    244   9e-75   Nelumbo nucifera [Indian lotus]
ref|XP_011009473.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    243   2e-74   Populus euphratica
ref|XP_002524779.1|  sugar transporter, putative                        243   2e-74   Ricinus communis
ref|XP_007162380.1|  hypothetical protein PHAVU_001G147200g             243   3e-74   Phaseolus vulgaris [French bean]
ref|XP_006409064.1|  hypothetical protein EUTSA_v10022677mg             243   3e-74   Eutrema salsugineum [saltwater cress]
ref|XP_003521224.1|  PREDICTED: sugar transporter ERD6-like 7-like      242   4e-74   Glycine max [soybeans]
gb|KHN19852.1|  Sugar transporter ERD6-like 7                           242   5e-74   Glycine soja [wild soybean]
emb|CDY01404.1|  BnaA07g11770D                                          242   7e-74   
emb|CDY12861.1|  BnaC07g15720D                                          242   7e-74   Brassica napus [oilseed rape]
gb|KDP21525.1|  hypothetical protein JCGZ_21996                         242   8e-74   Jatropha curcas
gb|ACU24439.1|  unknown                                                 234   9e-74   Glycine max [soybeans]
ref|XP_009103393.1|  PREDICTED: sugar transporter ERD6-like 7           241   1e-73   Brassica rapa
gb|KFK37554.1|  hypothetical protein AALP_AA4G271800                    241   1e-73   Arabis alpina [alpine rockcress]
emb|CDY39145.1|  BnaA07g01410D                                          241   2e-73   Brassica napus [oilseed rape]
ref|XP_002880340.1|  hypothetical protein ARALYDRAFT_483991             239   5e-73   
ref|NP_566120.1|  sugar transporter ERD6-like 7                         239   5e-73   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59997.1|  hypothetical protein M569_14807                         239   5e-73   Genlisea aurea
ref|XP_006444173.1|  hypothetical protein CICLE_v10024572mg             235   8e-73   
ref|XP_006479816.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    234   8e-73   
ref|XP_006479815.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    235   1e-72   
emb|CDX82668.1|  BnaC07g01980D                                          238   1e-72   
gb|KJB28576.1|  hypothetical protein B456_005G056400                    235   2e-72   Gossypium raimondii
ref|XP_004292608.2|  PREDICTED: sugar transporter ERD6-like 7           238   2e-72   Fragaria vesca subsp. vesca
gb|AAM61246.1|  putative sugar transporter                              238   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006479811.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    236   3e-72   
ref|XP_011009474.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    236   4e-72   Populus euphratica
ref|XP_006444171.1|  hypothetical protein CICLE_v10019923mg             237   4e-72   Citrus clementina [clementine]
ref|XP_006444169.1|  hypothetical protein CICLE_v10019923mg             237   4e-72   
ref|XP_010545070.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    236   6e-72   
gb|KJB28574.1|  hypothetical protein B456_005G056400                    235   7e-72   Gossypium raimondii
gb|KJB28575.1|  hypothetical protein B456_005G056400                    235   1e-71   Gossypium raimondii
ref|XP_003554233.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    235   2e-71   Glycine max [soybeans]
gb|KJB28573.1|  hypothetical protein B456_005G056400                    235   3e-71   Gossypium raimondii
ref|XP_010424172.1|  PREDICTED: sugar transporter ERD6-like 16          229   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_008449464.1|  PREDICTED: sugar transporter ERD6-like 7           234   5e-71   Cucumis melo [Oriental melon]
ref|XP_010667578.1|  PREDICTED: sugar transporter ERD6-like 7           234   5e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010112685.1|  Sugar transporter ERD6-like 7                      233   1e-70   
ref|XP_011033659.1|  PREDICTED: sugar transporter ERD6-like 7           234   1e-70   Populus euphratica
ref|XP_007222121.1|  hypothetical protein PRUPE_ppa004636mg             234   2e-70   Prunus persica
ref|XP_010507821.1|  PREDICTED: sugar transporter ERD6-like 7           232   2e-70   
ref|XP_008235073.1|  PREDICTED: sugar transporter ERD6-like 7           233   3e-70   Prunus mume [ume]
ref|XP_008223080.1|  PREDICTED: sugar transporter ERD6-like 16          233   3e-70   Prunus mume [ume]
ref|XP_004140089.1|  PREDICTED: sugar transporter ERD6-like 7-like      232   4e-70   Cucumis sativus [cucumbers]
ref|XP_006444168.1|  hypothetical protein CICLE_v10019918mg             232   5e-70   Citrus clementina [clementine]
ref|XP_004158614.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    232   5e-70   
ref|XP_009102177.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    231   5e-70   
ref|NP_568367.1|  sugar transporter ERD6-like 16                        232   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007201571.1|  hypothetical protein PRUPE_ppa018319mg             232   8e-70   
gb|KEH23721.1|  sugar porter (SP) family MFS transporter                231   8e-70   Medicago truncatula
ref|XP_010070277.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    231   9e-70   Eucalyptus grandis [rose gum]
ref|XP_010070278.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    231   9e-70   
emb|CDY13924.1|  BnaC09g39020D                                          225   1e-69   Brassica napus [oilseed rape]
ref|XP_007035424.1|  Major facilitator superfamily protein              231   2e-69   Theobroma cacao [chocolate]
ref|XP_010454136.1|  PREDICTED: sugar transporter ERD6-like 16 is...    230   2e-69   
ref|XP_010070290.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    229   4e-69   Eucalyptus grandis [rose gum]
ref|XP_002320384.1|  sugar transporter family protein                   228   8e-69   
ref|XP_010070313.1|  PREDICTED: sugar transporter ERD6-like 7           229   8e-69   Eucalyptus grandis [rose gum]
ref|XP_007200994.1|  hypothetical protein PRUPE_ppa005144mg             229   8e-69   Prunus persica
gb|AAM64736.1|  sugar transporter-like protein                          229   8e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010107672.1|  Sugar transporter ERD6-like 7                      228   9e-69   
ref|XP_008458507.1|  PREDICTED: sugar transporter ERD6-like 16          229   1e-68   Cucumis melo [Oriental melon]
ref|XP_010420663.1|  PREDICTED: sugar transporter ERD6-like 16 is...    228   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_008234934.1|  PREDICTED: sugar transporter ERD6-like 7           228   1e-68   
ref|XP_010492922.1|  PREDICTED: sugar transporter ERD6-like 16          228   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_002315546.2|  hypothetical protein POPTR_0010s02740g             228   2e-68   
ref|XP_004290697.1|  PREDICTED: sugar transporter ERD6-like 7           228   2e-68   Fragaria vesca subsp. vesca
ref|XP_010279404.1|  PREDICTED: sugar transporter ERD6-like 16 is...    227   3e-68   
ref|XP_002871845.1|  hypothetical protein ARALYDRAFT_488771             227   3e-68   
gb|KGN46180.1|  hypothetical protein Csa_6G067380                       226   4e-68   Cucumis sativus [cucumbers]
ref|XP_010279395.1|  PREDICTED: sugar transporter ERD6-like 16 is...    227   5e-68   Nelumbo nucifera [Indian lotus]
ref|XP_006287631.1|  hypothetical protein CARUB_v10000842mg             227   6e-68   Capsella rubella
ref|XP_004145042.1|  PREDICTED: sugar transporter ERD6-like 16-like     227   6e-68   
gb|KCW58966.1|  hypothetical protein EUGRSUZ_H01593                     220   7e-68   Eucalyptus grandis [rose gum]
ref|XP_008386584.1|  PREDICTED: sugar transporter ERD6-like 7           226   8e-68   
ref|XP_004153836.1|  PREDICTED: sugar transporter ERD6-like 16-like     226   9e-68   Cucumis sativus [cucumbers]
ref|XP_008368891.1|  PREDICTED: sugar transporter ERD6-like 7           226   1e-67   
ref|XP_006400439.1|  hypothetical protein EUTSA_v10013389mg             223   1e-67   
ref|XP_008386585.1|  PREDICTED: sugar transporter ERD6-like 7           225   2e-67   
ref|XP_004290698.1|  PREDICTED: sugar transporter ERD6-like 7           224   3e-67   Fragaria vesca subsp. vesca
emb|CDX92578.1|  BnaA10g16170D                                          225   3e-67   
gb|KCW58947.1|  hypothetical protein EUGRSUZ_H01571                     224   4e-67   Eucalyptus grandis [rose gum]
ref|XP_009120937.1|  PREDICTED: sugar transporter ERD6-like 16          224   5e-67   Brassica rapa
ref|XP_010420662.1|  PREDICTED: sugar transporter ERD6-like 16 is...    224   7e-67   Camelina sativa [gold-of-pleasure]
gb|KHN45387.1|  Sugar transporter ERD6-like 7                           222   9e-67   Glycine soja [wild soybean]
ref|XP_004292610.1|  PREDICTED: sugar transporter ERD6-like 7           223   1e-66   Fragaria vesca subsp. vesca
gb|KEH23691.1|  sugar porter (SP) family MFS transporter                223   1e-66   Medicago truncatula
ref|XP_010024483.1|  PREDICTED: sugar transporter ERD6-like 16 is...    223   2e-66   Eucalyptus grandis [rose gum]
ref|XP_011011018.1|  PREDICTED: sugar transporter ERD6-like 16          223   2e-66   Populus euphratica
gb|KEH23690.1|  sugar porter (SP) family MFS transporter                222   2e-66   Medicago truncatula
ref|XP_006400440.1|  hypothetical protein EUTSA_v10013389mg             222   3e-66   Eutrema salsugineum [saltwater cress]
ref|XP_008340870.1|  PREDICTED: sugar transporter ERD6-like 16          223   3e-66   
ref|XP_010546910.1|  PREDICTED: sugar transporter ERD6-like 16          223   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_008386586.1|  PREDICTED: sugar transporter ERD6-like 7           222   4e-66   
gb|KFK26120.1|  hypothetical protein AALP_AA8G206400                    222   4e-66   Arabis alpina [alpine rockcress]
ref|XP_008234933.1|  PREDICTED: sugar transporter ERD6-like 7           221   4e-66   
ref|XP_010242562.1|  PREDICTED: sugar transporter ERD6-like 7           222   7e-66   Nelumbo nucifera [Indian lotus]
ref|XP_004296777.1|  PREDICTED: sugar transporter ERD6-like 16 is...    221   9e-66   Fragaria vesca subsp. vesca
ref|XP_010649814.1|  PREDICTED: sugar transporter ERD6-like 16 is...    220   1e-65   
ref|XP_002278197.1|  PREDICTED: sugar transporter ERD6-like 16 is...    220   2e-65   Vitis vinifera
ref|XP_004134178.1|  PREDICTED: sugar transporter ERD6-like 16-like     220   3e-65   Cucumis sativus [cucumbers]
ref|XP_006419727.1|  hypothetical protein CICLE_v10004839mg             218   3e-65   
ref|XP_004171627.1|  PREDICTED: sugar transporter ERD6-like 16-like     220   4e-65   
emb|CAN63855.1|  hypothetical protein VITISV_008852                     221   4e-65   Vitis vinifera
emb|CDO98940.1|  unnamed protein product                                218   2e-64   Coffea canephora [robusta coffee]
ref|XP_006419729.1|  hypothetical protein CICLE_v10004839mg             218   2e-64   Citrus clementina [clementine]
ref|XP_006356995.1|  PREDICTED: sugar transporter ERD6-like 16-like     216   4e-64   Solanum tuberosum [potatoes]
emb|CBI26138.3|  unnamed protein product                                215   4e-64   Vitis vinifera
ref|XP_009352178.1|  PREDICTED: sugar transporter ERD6-like 16          217   5e-64   Pyrus x bretschneideri [bai li]
ref|XP_004229493.1|  PREDICTED: sugar transporter ERD6-like 16          215   1e-63   Solanum lycopersicum
ref|XP_009774897.1|  PREDICTED: sugar transporter ERD6-like 16 is...    215   2e-63   Nicotiana sylvestris
ref|XP_010105671.1|  Sugar transporter ERD6-like 16                     213   6e-63   
ref|XP_002516838.1|  sugar transporter, putative                        214   1e-62   
gb|EYU43869.1|  hypothetical protein MIMGU_mgv1a018596mg                213   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_009603614.1|  PREDICTED: sugar transporter ERD6-like 16 is...    212   2e-62   Nicotiana tomentosiformis
ref|XP_011090877.1|  PREDICTED: sugar transporter ERD6-like 16          211   4e-62   Sesamum indicum [beniseed]
ref|XP_008438775.1|  PREDICTED: sugar transporter ERD6-like 16 is...    210   9e-62   Cucumis melo [Oriental melon]
ref|XP_008438773.1|  PREDICTED: sugar transporter ERD6-like 16 is...    211   1e-61   Cucumis melo [Oriental melon]
gb|KJB72535.1|  hypothetical protein B456_011G183500                    209   2e-61   Gossypium raimondii
gb|KJB72536.1|  hypothetical protein B456_011G183500                    209   2e-61   Gossypium raimondii
gb|KJB72537.1|  hypothetical protein B456_011G183500                    209   3e-61   Gossypium raimondii
gb|KEH32265.1|  sugar porter (SP) family MFS transporter                206   2e-60   Medicago truncatula
ref|XP_010546662.1|  PREDICTED: sugar transporter ERD6-like 8           206   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_004508324.1|  PREDICTED: sugar transporter ERD6-like 16-like     207   3e-60   Cicer arietinum [garbanzo]
ref|XP_007050737.1|  Major facilitator superfamily protein              206   3e-60   
ref|XP_008223079.1|  PREDICTED: sugar transporter ERD6-like 16          206   3e-60   
ref|XP_003609563.1|  Sugar transporter ERD6-like protein                206   4e-60   Medicago truncatula
ref|XP_007226898.1|  hypothetical protein PRUPE_ppa016361mg             206   4e-60   
gb|KDP40049.1|  hypothetical protein JCGZ_02047                         204   2e-59   Jatropha curcas
gb|KHN33102.1|  Sugar transporter ERD6-like 16                          204   3e-59   Glycine soja [wild soybean]
gb|KEH36719.1|  sugar porter (SP) family MFS transporter                201   3e-59   Medicago truncatula
ref|XP_003547222.2|  PREDICTED: sugar transporter ERD6-like 16-like     204   3e-59   Glycine max [soybeans]
ref|XP_010464026.1|  PREDICTED: sugar transporter ERD6-like 8           204   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010485917.1|  PREDICTED: sugar transporter ERD6-like 8           203   5e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006594464.1|  PREDICTED: sugar transporter ERD6-like 16-li...    203   5e-59   
gb|AAF27021.1|AC009177_11  putative sugar transporter                   202   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003541648.2|  PREDICTED: sugar transporter ERD6-like 16-li...    203   7e-59   Glycine max [soybeans]
gb|KJB22569.1|  hypothetical protein B456_004G054600                    202   8e-59   Gossypium raimondii
ref|NP_187166.2|  sugar transporter ERD6-like 8                         202   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37528.1|  Sugar transporter ERD6-like 16                          202   1e-58   Glycine soja [wild soybean]
ref|XP_006594462.1|  PREDICTED: sugar transporter ERD6-like 16-li...    204   1e-58   
gb|KEH36718.1|  sugar porter (SP) family MFS transporter                201   1e-58   Medicago truncatula
ref|XP_006594463.1|  PREDICTED: sugar transporter ERD6-like 16-li...    204   1e-58   Glycine max [soybeans]
gb|KEH36720.1|  sugar porter (SP) family MFS transporter                201   1e-58   Medicago truncatula
ref|XP_010941736.1|  PREDICTED: sugar transporter ERD6-like 16          202   1e-58   Elaeis guineensis
ref|XP_003541649.1|  PREDICTED: sugar transporter ERD6-like 16-like     202   2e-58   Glycine max [soybeans]
ref|XP_010242565.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    201   2e-58   
ref|XP_006845806.1|  hypothetical protein AMTR_s00019p00256160          202   2e-58   Amborella trichopoda
ref|XP_011090879.1|  PREDICTED: sugar transporter ERD6-like 16 is...    197   3e-58   
ref|XP_002882396.1|  sugar transporter family protein                   201   5e-58   
ref|XP_003594043.1|  Sugar transporter ERD6-like protein                201   6e-58   Medicago truncatula
ref|XP_007147846.1|  hypothetical protein PHAVU_006G159600g             201   7e-58   Phaseolus vulgaris [French bean]
ref|XP_010242561.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    198   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_006299027.1|  hypothetical protein CARUB_v10015164mg             199   2e-57   Capsella rubella
ref|XP_004486078.1|  PREDICTED: sugar transporter ERD6-like 16-like     199   2e-57   Cicer arietinum [garbanzo]
ref|XP_010242560.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    198   2e-57   Nelumbo nucifera [Indian lotus]
gb|KDO44994.1|  hypothetical protein CISIN_1g011956mg                   194   3e-57   Citrus sinensis [apfelsine]
gb|ADP37168.1|  putative ERD6-like transporter                          198   4e-57   Vitis vinifera
ref|XP_010660047.1|  PREDICTED: sugar transporter ERD6-like 8           198   5e-57   
ref|XP_010024484.1|  PREDICTED: sugar transporter ERD6-like 16 is...    197   6e-57   Eucalyptus grandis [rose gum]
ref|XP_009419855.1|  PREDICTED: sugar transporter ERD6-like 16 is...    197   6e-57   
ref|XP_009419854.1|  PREDICTED: sugar transporter ERD6-like 16 is...    197   9e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011090878.1|  PREDICTED: sugar transporter ERD6-like 16 is...    197   9e-57   Sesamum indicum [beniseed]
ref|XP_006433199.1|  hypothetical protein CICLE_v10001032mg             194   1e-56   
ref|XP_010666329.1|  PREDICTED: sugar transporter ERD6-like 16          196   2e-56   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY30026.1|  BnaC01g39820D                                          196   3e-56   Brassica napus [oilseed rape]
ref|XP_009124970.1|  PREDICTED: sugar transporter ERD6-like 8           195   5e-56   Brassica rapa
ref|XP_004164629.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    194   5e-56   
ref|XP_006845808.1|  hypothetical protein AMTR_s00019p00256320          196   6e-56   
ref|XP_009603503.1|  PREDICTED: sugar transporter ERD6-like 8           187   1e-55   
gb|KDO44991.1|  hypothetical protein CISIN_1g011956mg                   194   1e-55   Citrus sinensis [apfelsine]
ref|XP_006471873.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    194   1e-55   Citrus sinensis [apfelsine]
gb|KDO44992.1|  hypothetical protein CISIN_1g011956mg                   194   2e-55   Citrus sinensis [apfelsine]
ref|XP_006433198.1|  hypothetical protein CICLE_v10001032mg             194   2e-55   Citrus clementina [clementine]
emb|CBI34326.3|  unnamed protein product                                197   5e-55   Vitis vinifera
ref|XP_008795112.1|  PREDICTED: sugar transporter ERD6-like 16 is...    192   7e-55   Phoenix dactylifera
ref|XP_010912096.1|  PREDICTED: sugar transporter ERD6-like 16          192   1e-54   Elaeis guineensis
gb|KJB82599.1|  hypothetical protein B456_013G203800                    190   1e-54   Gossypium raimondii
ref|XP_010070279.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    191   1e-54   
ref|XP_010649823.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    191   2e-54   Vitis vinifera
ref|XP_010660044.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    191   2e-54   
gb|KDP26380.1|  hypothetical protein JCGZ_17538                         192   2e-54   Jatropha curcas
ref|XP_006838267.1|  hypothetical protein AMTR_s00103p00071860          191   3e-54   
ref|XP_010660043.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    191   4e-54   
ref|XP_010660042.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    191   4e-54   
ref|XP_011023524.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    187   5e-54   Populus euphratica
ref|XP_002512323.1|  sugar transporter, putative                        190   7e-54   Ricinus communis
ref|XP_010070295.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    182   2e-53   
ref|XP_006375782.1|  hypothetical protein POPTR_0013s02850g             187   2e-53   
emb|CBI34327.3|  unnamed protein product                                190   3e-53   Vitis vinifera
ref|XP_011023522.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    187   6e-53   Populus euphratica
ref|XP_002512320.1|  sugar transporter, putative                        186   7e-53   
ref|XP_006375783.1|  hypothetical protein POPTR_0013s02850g             186   1e-52   
ref|XP_002319570.2|  sugar transporter family protein                   186   1e-52   
ref|XP_010649825.1|  PREDICTED: sugar transporter ERD6-like 16 is...    186   2e-52   
ref|XP_010244606.1|  PREDICTED: sugar transporter ERD6-like 16          184   2e-52   
ref|XP_010649824.1|  PREDICTED: sugar transporter ERD6-like 16 is...    186   2e-52   Vitis vinifera
ref|XP_007030767.1|  Sugar transporter, putative                        185   3e-52   
gb|KJB45167.1|  hypothetical protein B456_007G293200                    185   4e-52   Gossypium raimondii
dbj|BAH01094.1|  unnamed protein product                                184   8e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575758.2|  PREDICTED: sugar transporter ERD6-like 16          183   1e-51   
gb|KDP23561.1|  hypothetical protein JCGZ_23394                         183   2e-51   Jatropha curcas
ref|XP_002894602.1|  hypothetical protein ARALYDRAFT_474748             183   2e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_004248997.1|  PREDICTED: sugar transporter ERD6-like 8           184   2e-51   
ref|XP_002278654.3|  PREDICTED: sugar transporter ERD6-like 7 iso...    183   2e-51   Vitis vinifera
ref|XP_006663074.1|  PREDICTED: sugar transporter ERD6-like 16-like     181   8e-51   Oryza brachyantha
ref|XP_010070291.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    181   1e-50   Eucalyptus grandis [rose gum]
gb|KCW58929.1|  hypothetical protein EUGRSUZ_H015511                    176   1e-50   Eucalyptus grandis [rose gum]
gb|KHG12383.1|  hypothetical protein F383_10647                         180   3e-50   Gossypium arboreum [tree cotton]
gb|KHG12382.1|  hypothetical protein F383_10647                         180   3e-50   Gossypium arboreum [tree cotton]
gb|ADE75821.1|  unknown                                                 180   4e-50   Picea sitchensis
ref|XP_003557831.1|  PREDICTED: sugar transporter ERD6-like 16          180   4e-50   Brachypodium distachyon [annual false brome]
gb|AAC64898.1|  Similar to Beta integral membrane protein homolog...    180   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850964.1|  sugar transporter ERD6-like 5                         179   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684724.1|  PREDICTED: sugar transporter ERD6-like 16 is...    177   6e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010684723.1|  PREDICTED: sugar transporter ERD6-like 16 is...    178   8e-50   
ref|XP_003580968.1|  PREDICTED: sugar transporter ERD6-like 5           179   9e-50   Brachypodium distachyon [annual false brome]
gb|KFK35614.1|  hypothetical protein AALP_AA4G014000                    178   1e-49   Arabis alpina [alpine rockcress]
ref|XP_002465229.1|  hypothetical protein SORBIDRAFT_01g034610          178   1e-49   
ref|XP_009414205.1|  PREDICTED: sugar transporter ERD6-like 16          178   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006301882.1|  hypothetical protein CARUB_v10022354mg             177   2e-49   Capsella rubella
ref|XP_010684721.1|  PREDICTED: sugar transporter ERD6-like 16 is...    177   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008674205.1|  PREDICTED: LOC100281158 isoform X2                 176   3e-49   Zea mays [maize]
ref|XP_010684722.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    177   3e-49   
ref|XP_010470371.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    177   3e-49   
ref|XP_010470369.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    177   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_007030780.1|  Major facilitator superfamily protein              177   3e-49   
ref|XP_006651406.1|  PREDICTED: sugar transporter ERD6-like 16-like     177   3e-49   Oryza brachyantha
emb|CBI26146.3|  unnamed protein product                                177   4e-49   Vitis vinifera
gb|ADW40547.1|  vacuolar monosaccharide symporter 1                     177   7e-49   Saccharum hybrid cultivar Q117
ref|XP_006361887.1|  PREDICTED: sugar transporter ERD6-like 5-like      176   9e-49   Solanum tuberosum [potatoes]
gb|AHG94614.1|  sugar transporter ERD6-like protein                     176   1e-48   Camellia sinensis [black tea]
tpg|DAA45486.1|  TPA: solute carrier family 2, facilitated glucos...    176   1e-48   
emb|CAN83661.1|  hypothetical protein VITISV_037729                     178   1e-48   Vitis vinifera
ref|XP_008450689.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    175   2e-48   
ref|XP_008450688.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    175   2e-48   
ref|XP_010111870.1|  Sugar transporter ERD6-like 5                      175   2e-48   
ref|NP_001050166.1|  Os03g0363600                                       176   3e-48   
dbj|BAJ94581.1|  predicted protein                                      172   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS60298.1|  hypothetical protein M569_14507                         167   3e-48   Genlisea aurea
ref|XP_011466327.1|  PREDICTED: sugar transporter ERD6-like 5           175   3e-48   Fragaria vesca subsp. vesca
ref|XP_002263418.1|  PREDICTED: sugar transporter ERD6-like 5           175   4e-48   
ref|XP_010511205.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    174   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_004157263.1|  PREDICTED: sugar transporter ERD6-like 5-like      174   4e-48   
ref|XP_004135636.1|  PREDICTED: sugar transporter ERD6-like 5-like      174   4e-48   
ref|XP_010511206.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    174   4e-48   
ref|NP_001147549.1|  LOC100281158                                       174   5e-48   
ref|XP_009119515.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    171   5e-48   Brassica rapa
ref|XP_010043109.1|  PREDICTED: sugar transporter ERD6-like 5           174   6e-48   Eucalyptus grandis [rose gum]
emb|CBI34338.3|  unnamed protein product                                174   7e-48   Vitis vinifera
gb|KCW85184.1|  hypothetical protein EUGRSUZ_B02014                     174   7e-48   Eucalyptus grandis [rose gum]
gb|EAZ27016.1|  hypothetical protein OsJ_10945                          173   8e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KGN66112.1|  hypothetical protein Csa_1G571840                       174   8e-48   Cucumis sativus [cucumbers]
ref|XP_009417911.1|  PREDICTED: sugar transporter ERD6-like 5           173   9e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008450691.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    173   9e-48   
ref|XP_009119507.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    172   2e-47   Brassica rapa
ref|XP_009119512.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    172   2e-47   
ref|XP_004230159.2|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    173   2e-47   
emb|CDP17977.1|  unnamed protein product                                173   2e-47   Coffea canephora [robusta coffee]
ref|XP_011087867.1|  PREDICTED: sugar transporter ERD6-like 5           172   2e-47   Sesamum indicum [beniseed]
ref|XP_009119503.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    172   2e-47   Brassica rapa
ref|XP_008246533.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    172   2e-47   Prunus mume [ume]
ref|XP_008795113.1|  PREDICTED: sugar transporter ERD6-like 16 is...    172   2e-47   
ref|XP_009620982.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    172   3e-47   
ref|XP_009119495.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    172   3e-47   
emb|CDY43482.1|  BnaA01g21370D                                          172   3e-47   
ref|XP_009119491.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    171   3e-47   
ref|XP_009119487.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    172   4e-47   
ref|XP_009119480.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    172   6e-47   
ref|XP_008681389.1|  PREDICTED: hypothetical protein isoform X2         171   8e-47   
ref|XP_008350755.1|  PREDICTED: sugar transporter ERD6-like 5           171   8e-47   
emb|CDP17983.1|  unnamed protein product                                171   9e-47   
ref|XP_009373955.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    171   1e-46   
ref|XP_010528860.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    168   2e-46   
ref|XP_008681387.1|  PREDICTED: hypothetical protein isoform X1         171   2e-46   
ref|XP_004984296.1|  PREDICTED: sugar transporter ERD6-like 16-like     170   2e-46   
ref|XP_003520821.1|  PREDICTED: sugar transporter ERD6-like 5-like      170   2e-46   
gb|KHN03017.1|  Sugar transporter ERD6-like 16                          166   3e-46   
ref|XP_008246532.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    170   3e-46   
ref|XP_010912098.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    169   3e-46   
ref|XP_010912097.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    169   4e-46   
ref|XP_006651405.1|  PREDICTED: sugar transporter ERD6-like 16-like     168   5e-46   
ref|XP_010528859.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    168   7e-46   
ref|XP_007147087.1|  hypothetical protein PHAVU_006G095200g             168   9e-46   
gb|KEH24531.1|  sugar porter (SP) family MFS transporter                166   1e-45   
gb|AAB70413.1|  Similar to Beta integral membrane protein (gb|U43...    166   3e-45   
ref|XP_010475711.1|  PREDICTED: sugar transporter ERD6-like 3           166   3e-45   
ref|NP_001050165.1|  Os03g0363500                                       167   4e-45   
ref|NP_001031005.1|  sugar transporter ERD6-like 3                      166   4e-45   
ref|XP_011462680.1|  PREDICTED: sugar transporter ERD6-like 16 is...    165   5e-45   
ref|XP_010550039.1|  PREDICTED: sugar transporter ERD6-like 3           166   5e-45   
ref|NP_563829.1|  sugar transporter ERD6-like 3                         166   6e-45   
gb|EEC75308.1|  hypothetical protein OsI_11676                          167   6e-45   
emb|CAB64733.1|  putative sugar transporter                             166   6e-45   
gb|ABN09011.1|  General substrate transporter; Sugar transporter ...    166   6e-45   
ref|XP_003626331.1|  Sugar transporter ERD6, putative                   166   7e-45   
emb|CDY32140.1|  BnaCnng06490D                                          166   7e-45   
ref|NP_849618.1|  sugar transporter ERD6-like 3                         166   7e-45   
emb|CDP17978.1|  unnamed protein product                                164   8e-45   
ref|XP_009110867.1|  PREDICTED: sugar transporter ERD6-like 3           165   9e-45   
emb|CDY31121.1|  BnaA08g26710D                                          165   9e-45   
ref|XP_010489519.1|  PREDICTED: sugar transporter ERD6-like 3           165   1e-44   
ref|XP_010040756.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    160   1e-44   
ref|XP_008366851.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    165   1e-44   
ref|XP_010025139.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    162   5e-44   
ref|XP_007147091.1|  hypothetical protein PHAVU_006G095600g             164   5e-44   
ref|XP_006417632.1|  hypothetical protein EUTSA_v10007539mg             163   5e-44   
ref|XP_004984297.1|  PREDICTED: sugar transporter ERD6-like 16-like     164   6e-44   
ref|XP_003553740.2|  PREDICTED: sugar transporter ERD6-like 5-like      164   6e-44   
gb|KCW61736.1|  hypothetical protein EUGRSUZ_H04441                     162   6e-44   
ref|NP_001159247.1|  hypothetical protein                               162   6e-44   
ref|XP_002889722.1|  hypothetical protein ARALYDRAFT_470966             163   6e-44   
gb|KCW44953.1|  hypothetical protein EUGRSUZ_L01459                     160   7e-44   
ref|XP_010674993.1|  PREDICTED: sugar transporter ERD6-like 5           163   7e-44   
gb|KCW61735.1|  hypothetical protein EUGRSUZ_H04441                     162   1e-43   
ref|XP_006304417.1|  hypothetical protein CARUB_v10010993mg             162   1e-43   
gb|KHG16714.1|  Sugar transporter ERD6-like 18                          162   1e-43   
ref|XP_010025138.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    162   1e-43   
gb|KJB45166.1|  hypothetical protein B456_007G293100                    162   1e-43   
ref|XP_010025137.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    162   1e-43   
dbj|BAJ93725.1|  predicted protein                                      162   2e-43   
ref|XP_010043108.1|  PREDICTED: sugar transporter ERD6-like 5           162   2e-43   
gb|KJB45165.1|  hypothetical protein B456_007G293100                    162   2e-43   
ref|NP_001140461.1|  hypothetical protein                               161   2e-43   
emb|CDY22657.1|  BnaC08g42910D                                          161   4e-43   
ref|XP_008672346.1|  PREDICTED: hypothetical protein isoform X1         161   4e-43   
ref|XP_002512324.1|  sugar transporter, putative                        161   4e-43   
ref|XP_003521722.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    160   5e-43   
ref|XP_006577261.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    160   6e-43   
ref|XP_010040747.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    155   9e-43   
gb|KFK43197.1|  hypothetical protein AALP_AA1G093000                    159   1e-42   
ref|XP_004494647.1|  PREDICTED: sugar transporter ERD6-like 5-like      159   1e-42   
ref|XP_010660064.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    159   2e-42   
ref|XP_010040746.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    155   2e-42   
gb|KCW61729.1|  hypothetical protein EUGRSUZ_H04439                     159   2e-42   
ref|XP_010660071.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    159   2e-42   
ref|XP_010027218.1|  PREDICTED: sugar transporter ERD6-like 5           159   2e-42   
gb|EMT10929.1|  Sugar transporter ERD6-like protein 16                  158   3e-42   
ref|XP_009118335.1|  PREDICTED: sugar transporter ERD6-like 3           159   3e-42   
gb|KDP23562.1|  hypothetical protein JCGZ_23395                         158   3e-42   
ref|XP_008438774.1|  PREDICTED: sugar transporter ERD6-like 16 is...    158   4e-42   
ref|XP_009148150.1|  PREDICTED: sugar transporter ERD6-like 3           158   4e-42   
emb|CDX93528.1|  BnaA06g05200D                                          158   4e-42   
ref|XP_009782756.1|  PREDICTED: sugar transporter ERD6-like 5           157   4e-42   
gb|KEH24532.1|  sugar porter (SP) family MFS transporter                157   4e-42   
emb|CDX95022.1|  BnaC05g06490D                                          158   5e-42   
ref|XP_010043132.1|  PREDICTED: sugar transporter ERD6-like 5           158   6e-42   
ref|XP_002457561.1|  hypothetical protein SORBIDRAFT_03g009340          157   8e-42   
ref|NP_001146190.1|  uncharacterized protein LOC100279760               157   9e-42   
ref|XP_004967879.1|  PREDICTED: sugar transporter ERD6-like 5-like      157   1e-41   
ref|XP_003626332.1|  Sugar transporter ERD6-like protein                157   1e-41   
emb|CBI34328.3|  unnamed protein product                                157   1e-41   
ref|XP_010660062.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    157   1e-41   
gb|EMS60488.1|  Sugar transporter ERD6-like 5                           156   2e-41   
ref|XP_010228594.1|  PREDICTED: sugar transporter ERD6-like 16 is...    155   2e-41   
ref|XP_010052631.1|  PREDICTED: sugar transporter ERD6-like 17 is...    154   5e-41   
gb|ABR16538.1|  unknown                                                 155   5e-41   
gb|ACN26851.1|  unknown                                                 155   6e-41   
ref|XP_010528843.1|  PREDICTED: sugar transporter ERD6-like 3           155   6e-41   
ref|XP_010528847.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    155   7e-41   
ref|XP_010228593.1|  PREDICTED: sugar transporter ERD6-like 16 is...    155   7e-41   
ref|XP_010052630.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    154   8e-41   
emb|CDX93527.1|  BnaA06g05210D                                          155   9e-41   
ref|XP_010674987.1|  PREDICTED: sugar transporter ERD6-like 5           154   9e-41   
ref|XP_011466331.1|  PREDICTED: sugar transporter ERD6-like 3           154   9e-41   
ref|XP_010674995.1|  PREDICTED: sugar transporter ERD6-like 5           154   1e-40   
ref|XP_010660048.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    154   1e-40   
gb|KCW61728.1|  hypothetical protein EUGRSUZ_H04438                     153   1e-40   
ref|XP_010052629.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    154   1e-40   
ref|XP_010660063.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    154   2e-40   
gb|KCW76704.1|  hypothetical protein EUGRSUZ_D01064                     151   2e-40   
ref|XP_007030778.1|  Major facilitator superfamily protein, putative    154   2e-40   
emb|CDX95021.1|  BnaC05g06500D                                          154   2e-40   
ref|XP_007205125.1|  hypothetical protein PRUPE_ppa004943mg             154   2e-40   
ref|XP_010550028.1|  PREDICTED: sugar transporter ERD6                  154   2e-40   
ref|XP_009148151.1|  PREDICTED: sugar transporter ERD6-like             154   2e-40   
gb|ABK24356.1|  unknown                                                 154   2e-40   
ref|XP_003520312.1|  PREDICTED: sugar transporter ERD6-like 6-like      153   3e-40   
ref|XP_010070297.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    145   3e-40   
ref|XP_010550074.1|  PREDICTED: sugar transporter ERD6-like 3           153   4e-40   
ref|XP_004291871.1|  PREDICTED: sugar transporter ERD6-like 6           153   4e-40   
gb|KCW76707.1|  hypothetical protein EUGRSUZ_D01065                     151   4e-40   
ref|XP_010025134.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    153   4e-40   
ref|XP_009364925.1|  PREDICTED: sugar transporter ERD6-like 6           153   4e-40   
ref|XP_010043131.1|  PREDICTED: sugar transporter ERD6-like 5           151   5e-40   
gb|KCW76709.1|  hypothetical protein EUGRSUZ_D01065                     151   5e-40   
gb|KCW85201.1|  hypothetical protein EUGRSUZ_B02026                     151   5e-40   
ref|NP_001147831.1|  solute carrier family 2, facilitated glucose...    152   5e-40   
ref|XP_010070296.1|  PREDICTED: sugar transporter ERD6-like 16 is...    147   5e-40   
ref|XP_010052634.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    150   6e-40   
gb|ADP37162.1|  putative ERD6-like transporter                          152   6e-40   
gb|KCW76708.1|  hypothetical protein EUGRSUZ_D01065                     151   6e-40   
ref|XP_010660051.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    152   7e-40   
ref|XP_006444170.1|  hypothetical protein CICLE_v10019923mg             150   7e-40   
emb|CDP17979.1|  unnamed protein product                                151   7e-40   
ref|XP_008220809.1|  PREDICTED: sugar transporter ERD6-like 6           152   7e-40   
emb|CDP07507.1|  unnamed protein product                                152   7e-40   
ref|XP_003547984.1|  PREDICTED: sugar transporter ERD6-like 6-lik...    152   8e-40   
emb|CDY32141.1|  BnaCnng06500D                                          152   8e-40   
ref|XP_007222428.1|  hypothetical protein PRUPE_ppa004911mg             152   8e-40   
ref|XP_010660049.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    152   1e-39   
gb|AET03897.2|  sugar porter (SP) family MFS transporter                150   1e-39   
gb|KCW76706.1|  hypothetical protein EUGRSUZ_D01065                     151   1e-39   
gb|ADP37159.1|  putative ERD6-like transporter                          151   1e-39   
ref|XP_008388057.1|  PREDICTED: sugar transporter ERD6-like 6           152   1e-39   
ref|XP_010043129.1|  PREDICTED: sugar transporter ERD6-like 5           151   1e-39   
ref|XP_010660061.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    152   1e-39   
ref|XP_010052628.1|  PREDICTED: sugar transporter ERD6-like 5           151   1e-39   
ref|XP_004509267.1|  PREDICTED: sugar transporter ERD6-like 6-like      151   1e-39   
ref|XP_009365553.1|  PREDICTED: sugar transporter ERD6-like 6           151   2e-39   
ref|XP_002440272.1|  hypothetical protein SORBIDRAFT_09g028840          151   2e-39   
ref|XP_010052626.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    151   2e-39   
ref|XP_006878598.1|  hypothetical protein AMTR_s00011p00254360          151   2e-39   
ref|XP_006655599.1|  PREDICTED: sugar transporter ERD6-like 6-like      151   2e-39   
gb|EYU45170.1|  hypothetical protein MIMGU_mgv1a004641mg                151   2e-39   
ref|XP_009118334.1|  PREDICTED: sugar transporter ERD6                  151   2e-39   
ref|XP_011048905.1|  PREDICTED: sugar transporter ERD6-like 5           151   2e-39   
ref|XP_002510395.1|  sugar transporter, putative                        151   2e-39   
gb|EMS53743.1|  Sugar transporter ERD6-like 6                           150   2e-39   
emb|CDY17555.1|  BnaC01g26790D                                          150   2e-39   
ref|XP_010052633.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    150   2e-39   
ref|XP_010660057.1|  PREDICTED: sugar transporter ERD6-like 10 is...    150   2e-39   
ref|XP_007156051.1|  hypothetical protein PHAVU_003G2541000g            149   2e-39   
ref|XP_003567863.1|  PREDICTED: sugar transporter ERD6-like 4           151   2e-39   
emb|CBI34335.3|  unnamed protein product                                150   2e-39   
gb|ADP37160.1|  putative ERD6-like transporter                          150   3e-39   
ref|XP_010052632.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    150   3e-39   
ref|XP_011074551.1|  PREDICTED: sugar transporter ERD6-like 6           150   3e-39   
ref|XP_010660053.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    150   3e-39   
dbj|BAJ95168.1|  predicted protein                                      150   3e-39   
gb|KDP38511.1|  hypothetical protein JCGZ_04436                         150   3e-39   
ref|XP_003629420.1|  Sugar transporter ERD6-like protein                150   3e-39   
ref|XP_007156050.1|  hypothetical protein PHAVU_003G2541000g            149   3e-39   
ref|XP_010660052.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    150   3e-39   
dbj|BAJ86023.1|  predicted protein                                      150   3e-39   
gb|KCW76710.1|  hypothetical protein EUGRSUZ_D01066                     150   4e-39   
emb|CDY22656.1|  BnaC08g42900D                                          150   4e-39   
ref|XP_004961185.1|  PREDICTED: sugar transporter ERD6-like 4-like      150   5e-39   
ref|XP_010111871.1|  Sugar transporter ERD6-like 5                      149   5e-39   
ref|XP_011466332.1|  PREDICTED: sugar transporter ERD6-like 17 is...    151   6e-39   
gb|EPS70247.1|  hypothetical protein M569_04513                         148   6e-39   
ref|XP_007017551.1|  Major facilitator superfamily protein isoform 1    150   6e-39   
ref|XP_008357197.1|  PREDICTED: sugar transporter ERD6-like 6           149   6e-39   
ref|XP_003629421.1|  Sugar transporter ERD6-like protein                149   8e-39   
ref|XP_003544408.1|  PREDICTED: sugar transporter ERD6-like 6-like      149   8e-39   
ref|XP_010424124.1|  PREDICTED: sugar transporter ERD6-like 9           149   8e-39   
ref|XP_006473510.1|  PREDICTED: sugar transporter ERD6-like 6-lik...    149   8e-39   
ref|XP_010485922.1|  PREDICTED: sugar transporter ERD6-like 9           149   1e-38   
ref|XP_010316370.1|  PREDICTED: sugar transporter ERD6-like 6 iso...    149   1e-38   
ref|NP_563830.1|  sugar transporter ERD6                                149   1e-38   
ref|XP_006417630.1|  hypothetical protein EUTSA_v10007451mg             149   1e-38   
gb|KCW68238.1|  hypothetical protein EUGRSUZ_F01888                     147   1e-38   
ref|XP_010043133.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    148   2e-38   
ref|XP_008444718.1|  PREDICTED: sugar transporter ERD6-like 6           148   2e-38   
ref|XP_006417631.1|  hypothetical protein EUTSA_v10007451mg             148   2e-38   
gb|KFK43198.1|  hypothetical protein AALP_AA1G093100                    148   2e-38   
ref|XP_006471867.1|  PREDICTED: sugar transporter ERD6-like 11-li...    145   2e-38   
ref|XP_002889723.1|  hypothetical protein ARALYDRAFT_888127             148   2e-38   
ref|XP_010688930.1|  PREDICTED: sugar transporter ERD6-like 6           148   2e-38   
emb|CDP17980.1|  unnamed protein product                                148   2e-38   
gb|EPS70659.1|  hypothetical protein M569_04101                         148   2e-38   
ref|NP_001289853.1|  sugar transporter ERD6-like 6                      148   3e-38   
ref|XP_010660054.1|  PREDICTED: sugar transporter ERD6-like 5           148   3e-38   
gb|EEC79713.1|  hypothetical protein OsI_21023                          148   3e-38   
ref|NP_001056353.1|  Os05g0567800                                       148   3e-38   
gb|EYU32776.1|  hypothetical protein MIMGU_mgv1a005335mg                148   3e-38   
ref|XP_002266704.1|  PREDICTED: sugar transporter ERD6-like 6           148   3e-38   
ref|XP_011024438.1|  PREDICTED: sugar transporter ERD6-like 6           148   3e-38   
emb|CAN72983.1|  hypothetical protein VITISV_009034                     148   3e-38   
ref|XP_003550382.1|  PREDICTED: sugar transporter ERD6-like 6-like      147   3e-38   
ref|XP_006340629.1|  PREDICTED: sugar transporter ERD6-like 6-like      147   3e-38   
ref|XP_008466559.1|  PREDICTED: sugar transporter ERD6-like 6           147   3e-38   
emb|CDY31120.1|  BnaA08g26700D                                          148   4e-38   
ref|XP_006473511.1|  PREDICTED: sugar transporter ERD6-like 6-lik...    147   4e-38   
ref|XP_010674988.1|  PREDICTED: sugar transporter ERD6-like 5           147   4e-38   
gb|EYU40169.1|  hypothetical protein MIMGU_mgv1a005232mg                147   4e-38   
gb|KDO79569.1|  hypothetical protein CISIN_1g011388mg                   145   4e-38   
gb|KDO84581.1|  hypothetical protein CISIN_1g011470mg                   147   4e-38   
gb|KJB63648.1|  hypothetical protein B456_010G009900                    146   4e-38   
ref|NP_001281110.1|  sugar transporter ERD6-like 6-like                 147   4e-38   
ref|XP_009110866.1|  PREDICTED: sugar transporter ERD6-like             147   4e-38   
ref|XP_004499162.1|  PREDICTED: sugar transporter ERD6-like 6-like      147   4e-38   
ref|XP_004147865.1|  PREDICTED: sugar transporter ERD6-like 6-like      147   4e-38   



>dbj|BAO96226.1| sugar-porter family protein 7, partial [Solanum lycopersicum]
Length=468

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 150/182 (82%), Gaps = 8/182 (4%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
            + K DR MVYLSTFVAVCGS +FGSCAGYSSPTQSAI +DLN SIAE+SLFGSILTFGAM
Sbjct  24   EKKQDRCMVYLSTFVAVCGSYSFGSCAGYSSPTQSAIREDLNLSIAEFSLFGSILTFGAM  83

Query  247  AGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATGYGMGVFSYV  405
             GAITSGPIAD++GRKG     +         IF   +GAL +DIGRLATGYGMGVFSYV
Sbjct  84   IGAITSGPIADYIGRKGAMRMSSGFCVAGWLAIF-FAQGALALDIGRLATGYGMGVFSYV  142

Query  406  VPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLC  585
            VPVFIAEIAPK+LRGALTT+NQLMI  GVSV+F+IGTM+TWRTLALTG+ PC +L  GL 
Sbjct  143  VPVFIAEIAPKDLRGALTTINQLMICCGVSVSFIIGTMMTWRTLALTGLIPCAILLFGLF  202

Query  586  II  591
            II
Sbjct  203  II  204



>ref|XP_009777420.1| PREDICTED: sugar transporter ERD6-like 7 [Nicotiana sylvestris]
Length=483

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 148/181 (82%), Gaps = 6/181 (3%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
            + K +R MVYLSTFVAVCGS AFGSCAGYSSPTQSAI +DLN SIAE+SLFGSILTFGAM
Sbjct  39   EKKQNRCMVYLSTFVAVCGSFAFGSCAGYSSPTQSAIREDLNLSIAEFSLFGSILTFGAM  98

Query  247  AGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVV  408
             GAITSGPIAD++GRKG     +             +GAL +DIGRLATGYGMGVFSYVV
Sbjct  99   IGAITSGPIADYIGRKGAMRMSSAFCVAGWFAIYFAQGALSLDIGRLATGYGMGVFSYVV  158

Query  409  PVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCI  588
            PVFIAEIAP++LRGALTT+NQLMI  GVSVAF+IGTM+TWRTLALTG+ PC +L  GL I
Sbjct  159  PVFIAEIAPRDLRGALTTINQLMICCGVSVAFIIGTMLTWRTLALTGLIPCAILLFGLFI  218

Query  589  I  591
            I
Sbjct  219  I  219



>ref|XP_007050715.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007050716.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94872.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94873.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=484

 Score =   254 bits (650),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 153/193 (79%), Gaps = 13/193 (7%)
 Frame = +1

Query  52   IGKEDDSKTDR-------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEY  210
            +  E+D  TD+       WMVYLSTFVAVCGS  FGSCAGYSSPTQ+AI++DL+ ++AEY
Sbjct  29   MADEEDGHTDQTSSKASLWMVYLSTFVAVCGSFEFGSCAGYSSPTQTAITEDLSLTLAEY  88

Query  211  SLFGSILTFGAMAGAITSGPIADFVGRKG-QENAEN*TIFTLL-----KGALVMDIGRLA  372
            S+FGSILTFGAM GAITSGPIADF+GRKG    A    +   L     KGAL +DIGRLA
Sbjct  89   SVFGSILTFGAMIGAITSGPIADFIGRKGAMRTATGFCVAGWLAIYFAKGALPLDIGRLA  148

Query  373  TGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGI  552
            TGYGMGVFSYVVPVFIAEIAPK LRGALTT+NQLMI TGVSVAF+IGT++TWRTLALTG+
Sbjct  149  TGYGMGVFSYVVPVFIAEIAPKNLRGALTTINQLMICTGVSVAFIIGTVLTWRTLALTGL  208

Query  553  XPCVVLGLGLCII  591
             PC +L  GL  I
Sbjct  209  IPCAILLCGLFFI  221



>ref|XP_002270927.2| PREDICTED: sugar transporter ERD6-like 7 [Vitis vinifera]
 gb|ADP37173.1| putative ERD6-like transporter [Vitis vinifera]
Length=490

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 152/203 (75%), Gaps = 6/203 (3%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
            ++ G+     AG +      +  SK   WMVYLSTFVAVCGS  FGSCAGYSSPTQ+AI 
Sbjct  25   LMQGQKNLPDAGGSGSEDQTDQSSKEHLWMVYLSTFVAVCGSFEFGSCAGYSSPTQTAIR  84

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQEN------AEN*TIFTLLKG  342
            +DL+ S+ EYS+FGSILTFGAM GAITSGPIADF+GRKG         A         +G
Sbjct  85   EDLDLSLGEYSVFGSILTFGAMIGAITSGPIADFIGRKGAMRVSSAFCAAGWLAIYFAEG  144

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
            AL +DIGRLATGYGMGVFSYVVPVFIAEIAPK LRGALTTLNQLMI TGVSVAF+IGT++
Sbjct  145  ALALDIGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTTLNQLMICTGVSVAFIIGTVL  204

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
            TWR LALTG+ PC V+  GL +I
Sbjct  205  TWRVLALTGLVPCAVVLFGLFLI  227



>ref|XP_009614908.1| PREDICTED: sugar transporter ERD6-like 7 [Nicotiana tomentosiformis]
Length=483

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 147/181 (81%), Gaps = 6/181 (3%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
            + K +R MVYL+TFVAVCGS AFGSCAGYSSPTQSAI +DLN SIAE+SLFGSILTFGAM
Sbjct  39   EKKQNRCMVYLTTFVAVCGSFAFGSCAGYSSPTQSAIREDLNLSIAEFSLFGSILTFGAM  98

Query  247  AGAITSGPIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSYVV  408
             GAITSGPIAD++GRKG     +             +GAL +DIGRLATGYGMGVFSYVV
Sbjct  99   IGAITSGPIADYIGRKGAMRMSSAFCVAGWLAIYFAQGALSLDIGRLATGYGMGVFSYVV  158

Query  409  PVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCI  588
            PVFIAEIAP++LRGALTT+NQLMI  GVSVAF+IGTM+TWR LALTG+ PC +L  GL I
Sbjct  159  PVFIAEIAPRDLRGALTTINQLMICCGVSVAFIIGTMLTWRALALTGLIPCAILLFGLFI  218

Query  589  I  591
            I
Sbjct  219  I  219



>ref|XP_006358441.1| PREDICTED: sugar transporter ERD6-like 7-like [Solanum tuberosum]
Length=480

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 146/181 (81%), Gaps = 6/181 (3%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
            + K DR MVYLSTFVAVCGS +FGSCAGYSSP QSAI +DLN SIAE+SLFGSILTFGAM
Sbjct  36   EKKQDRCMVYLSTFVAVCGSYSFGSCAGYSSPIQSAIREDLNLSIAEFSLFGSILTFGAM  95

Query  247  AGAITSGPIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSYVV  408
             GAITSGPIAD++GRKG     +             +GAL +DIGRLATGYGMGVFSYVV
Sbjct  96   IGAITSGPIADYIGRKGAMRMSSGFCVAGWLAIYFAQGALALDIGRLATGYGMGVFSYVV  155

Query  409  PVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCI  588
            PVFIAEIAPK+LRGALTT+NQLMI  GVSV+F+IGTM+TWR LALTG+ PC +L  GL I
Sbjct  156  PVFIAEIAPKDLRGALTTINQLMICCGVSVSFIIGTMMTWRMLALTGLIPCAILIFGLFI  215

Query  589  I  591
            I
Sbjct  216  I  216



>gb|KJB47013.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
Length=478

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 145/190 (76%), Gaps = 12/190 (6%)
 Frame = +1

Query  58   KED------DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            KED       SK   WMVY STFVAVCGS  FGSCAGYSSPTQ+AI  DL+ S+AEYS+F
Sbjct  32   KEDGYTDQTSSKASLWMVYFSTFVAVCGSFEFGSCAGYSSPTQTAIRTDLSLSLAEYSVF  91

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGY  381
            GSILTFGAM GAITSGPIADF+GRKG                   KGAL++D+GRLATGY
Sbjct  92   GSILTFGAMIGAITSGPIADFIGRKGAMRTATGFCVGGWLAIYFAKGALLLDVGRLATGY  151

Query  382  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPC  561
            GMGVFSYVVPVFIAEIAPK LRGALTT+NQLMI TGVSVAF+IGT++TWR LALTG+ PC
Sbjct  152  GMGVFSYVVPVFIAEIAPKNLRGALTTINQLMICTGVSVAFIIGTVLTWRALALTGLIPC  211

Query  562  VVLGLGLCII  591
             VL  GL  I
Sbjct  212  AVLLFGLFFI  221



>gb|KJB47011.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
 gb|KJB47012.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
 gb|KJB47014.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
Length=484

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 145/190 (76%), Gaps = 12/190 (6%)
 Frame = +1

Query  58   KED------DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            KED       SK   WMVY STFVAVCGS  FGSCAGYSSPTQ+AI  DL+ S+AEYS+F
Sbjct  32   KEDGYTDQTSSKASLWMVYFSTFVAVCGSFEFGSCAGYSSPTQTAIRTDLSLSLAEYSVF  91

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGY  381
            GSILTFGAM GAITSGPIADF+GRKG                   KGAL++D+GRLATGY
Sbjct  92   GSILTFGAMIGAITSGPIADFIGRKGAMRTATGFCVGGWLAIYFAKGALLLDVGRLATGY  151

Query  382  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPC  561
            GMGVFSYVVPVFIAEIAPK LRGALTT+NQLMI TGVSVAF+IGT++TWR LALTG+ PC
Sbjct  152  GMGVFSYVVPVFIAEIAPKNLRGALTTINQLMICTGVSVAFIIGTVLTWRALALTGLIPC  211

Query  562  VVLGLGLCII  591
             VL  GL  I
Sbjct  212  AVLLFGLFFI  221



>gb|EYU43551.1| hypothetical protein MIMGU_mgv1a005532mg [Erythranthe guttata]
Length=480

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 155/203 (76%), Gaps = 19/203 (9%)
 Frame = +1

Query  37   MAAPLIGKEDDS-----------KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQ  183
            M APLI   D+            K DR M+YL+TFVAVCGS AFG+CAGYSSPTQ+AI +
Sbjct  15   MRAPLITARDEISENGDRIKKAIKEDRCMIYLTTFVAVCGSYAFGACAGYSSPTQAAIRE  74

Query  184  DLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQE-------NAEN*TIFTLLKG  342
            D+N S+AEYSLFGSILTFGAM GAITSG IAD++GRKG          A   +IF   +G
Sbjct  75   DVNLSLAEYSLFGSILTFGAMIGAITSGKIADYIGRKGAMITSSGFCTAGWLSIF-FAQG  133

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
             +++D+GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTT+NQLMI  GVSV+F+IGT++
Sbjct  134  PVLLDVGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTINQLMICMGVSVSFIIGTLL  193

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
            TWR LAL GI PC VL +GL II
Sbjct  194  TWRVLALVGIVPCAVLLIGLAII  216



>ref|XP_002302812.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE82085.2| sugar transporter family protein [Populus trichocarpa]
Length=484

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 152/203 (75%), Gaps = 19/203 (9%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQD  186
            +GE +GS A         +  SK   WMVYLSTFVAVCGS AFGSCAGYSSPT++A+ +D
Sbjct  30   SGEQDGSFA---------QSSSKESAWMVYLSTFVAVCGSFAFGSCAGYSSPTENAVRED  80

Query  187  LNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTL--------LKG  342
            L+ S+AEYS+FGSILTFGAM GAITSGPIADF+GRKG       T F +         +G
Sbjct  81   LSLSLAEYSVFGSILTFGAMIGAITSGPIADFIGRKGALRVA--TSFCIAGWLAIYFAQG  138

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
             L +D+GRLATGYGMGVFSYVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++
Sbjct  139  VLALDLGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTATNQLMICGGVSVAFIIGTVL  198

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
            TWR LALTG+ PC +L  GL +I
Sbjct  199  TWRALALTGLVPCAILVFGLFLI  221



>gb|KJB23160.1| hypothetical protein B456_004G084300 [Gossypium raimondii]
Length=480

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 150/194 (77%), Gaps = 14/194 (7%)
 Frame = +1

Query  52   IGKEDDSKTDR--------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAE  207
            IG E++  TD         WMVYLSTFVAVCGS AFGS AGYSSPTQ+AI++DL+ ++AE
Sbjct  24   IGDEENVYTDEETSGKASLWMVYLSTFVAVCGSFAFGSSAGYSSPTQTAITKDLSLTLAE  83

Query  208  YSLFGSILTFGAMAGAITSGPIADFVGRKG-QENAEN*TIFTLL-----KGALVMDIGRL  369
            YS+FGSILTFGAM GA TSGPIADF+GRKG    A   ++   L     KGAL +DIGRL
Sbjct  84   YSVFGSILTFGAMIGATTSGPIADFIGRKGAMRTATGFSVAGWLAIYFAKGALSLDIGRL  143

Query  370  ATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTG  549
            ATGYGMGVFSYVVPVFIAEIAPK LRGALTT NQLMI   VSVAF+IGT++TWRTLALTG
Sbjct  144  ATGYGMGVFSYVVPVFIAEIAPKNLRGALTTANQLMICCAVSVAFIIGTVLTWRTLALTG  203

Query  550  IXPCVVLGLGLCII  591
            + PC +L  GL  I
Sbjct  204  LIPCAILLFGLFFI  217



>emb|CBI32306.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MVYLSTFVAVCGS  FGSCAGYSSPTQ+AI +DL+ S+ EYS+FGSILTFGAM GAITSG
Sbjct  1    MVYLSTFVAVCGSFEFGSCAGYSSPTQTAIREDLDLSLGEYSVFGSILTFGAMIGAITSG  60

Query  268  PIADFVGRKGQEN------AEN*TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
            PIADF+GRKG         A         +GAL +DIGRLATGYGMGVFSYVVPVFIAEI
Sbjct  61   PIADFIGRKGAMRVSSAFCAAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPVFIAEI  120

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRGALTTLNQLMI TGVSVAF+IGT++TWR LALTG+ PC V+  GL +I
Sbjct  121  APKNLRGALTTLNQLMICTGVSVAFIIGTVLTWRVLALTGLVPCAVVLFGLFLI  174



>ref|XP_007162379.1| hypothetical protein PHAVU_001G147100g [Phaseolus vulgaris]
 gb|ESW34373.1| hypothetical protein PHAVU_001G147100g [Phaseolus vulgaris]
Length=473

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 150/203 (74%), Gaps = 11/203 (5%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
             +G+  G+  PL+G+++           WMVY STFVAV GS  FG+C GYSSPTQ AIS
Sbjct  8    EDGTQKGIREPLVGEQNHQLVQPTTGHPWMVYFSTFVAVWGSYEFGTCVGYSSPTQEAIS  67

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKG  342
            +DLN S+AEYSLFGSIL+FGAM GAITSGPIADF+GRKG     +        I    +G
Sbjct  68   KDLNLSLAEYSLFGSILSFGAMVGAITSGPIADFIGRKGAMRVSSAFCVAGWLIIYFAEG  127

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
             + +DI R+ATGYGMGVFSYVVPVFIAEIAPKELRG LTTLNQ MIV+GVSV+F+IG ++
Sbjct  128  PVPLDIARIATGYGMGVFSYVVPVFIAEIAPKELRGTLTTLNQFMIVSGVSVSFIIGNVL  187

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
            +WRTLALTGI P  +L LGL  I
Sbjct  188  SWRTLALTGIIPAAILLLGLFFI  210



>ref|XP_011079781.1| PREDICTED: sugar transporter ERD6-like 7 [Sesamum indicum]
Length=485

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 154/202 (76%), Gaps = 18/202 (9%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQD  186
            NG+ E        PL   +  SK +R MVYL+TF+AVCGS AFG CAGYSSPTQ+AI +D
Sbjct  31   NGDEE-------KPL---KTSSKEERCMVYLTTFIAVCGSYAFGCCAGYSSPTQAAIRED  80

Query  187  LNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQE-------NAEN*TIFTLLKGA  345
            +  S+AEYSLFGSILTFGAM GAITSG IAD++GRKG          A   +I+   +GA
Sbjct  81   VKLSLAEYSLFGSILTFGAMIGAITSGKIADYIGRKGAMIVSSAFCTAGWLSIY-FAQGA  139

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
            L++DIGRLATGYGMGVFSYVVPVFIAEIAPK+LRGALTT+NQLMI TGVSV+F+IGT +T
Sbjct  140  LLLDIGRLATGYGMGVFSYVVPVFIAEIAPKDLRGALTTVNQLMICTGVSVSFIIGTFLT  199

Query  526  WRTLALTGIXPCVVLGLGLCII  591
            WR LAL GI PC VL  GL II
Sbjct  200  WRALALVGIVPCAVLLFGLVII  221



>ref|XP_010242566.1| PREDICTED: sugar transporter ERD6-like 7 isoform X3 [Nelumbo 
nucifera]
Length=452

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 150/193 (78%), Gaps = 11/193 (6%)
 Frame = +1

Query  46   PLI-----GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEY  210
            PLI     G+    K   WMVY STFVAVCGS  FGSCAGYSSPTQSAI +DL  S+A+Y
Sbjct  23   PLIRNIEHGENKGGKEQVWMVYFSTFVAVCGSFEFGSCAGYSSPTQSAIREDLGLSLAQY  82

Query  211  SLFGSILTFGAMAGAITSGPIADFVGRKGQE--NAEN*T----IFTLLKGALVMDIGRLA  372
            S+FGSILTFGAM GAITSGPIADF+GRKG    +A   T         +GAL++DIGRL+
Sbjct  83   SVFGSILTFGAMIGAITSGPIADFIGRKGAMWMSAAFCTGGWLAIYFAEGALLLDIGRLS  142

Query  373  TGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGI  552
            TGYGMGVFSYVVPVFIAE+APK+LRG LTT+NQLMI +GVSVA++IGT++TWR LALTG+
Sbjct  143  TGYGMGVFSYVVPVFIAEMAPKDLRGGLTTVNQLMICSGVSVAYIIGTVLTWRALALTGL  202

Query  553  XPCVVLGLGLCII  591
             PC +L LGL  I
Sbjct  203  IPCFILFLGLFFI  215



>ref|XP_004493632.1| PREDICTED: sugar transporter ERD6-like 7-like [Cicer arietinum]
Length=473

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 149/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  22   GSTAGMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            G+  G+  PL+  +  ++ D    WMVY +TF+AVCGS  FG+CAGYSSPTQ AI +DL+
Sbjct  12   GTHKGITEPLLEGKHHARKDHHHPWMVYFTTFIAVCGSYEFGACAGYSSPTQEAIRKDLS  71

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKGALVM  354
             S+AEYSLFGSILTFGAM GAITSGPIADFVGRKG     +        +    +  + +
Sbjct  72   LSLAEYSLFGSILTFGAMIGAITSGPIADFVGRKGAMRVSSAFCIAGWLVIYFSQNPVPL  131

Query  355  DIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRT  534
            DIGRLATGYGMGVFSYVVPVF+AEIAPKELRGALTTLNQ MIVT VSV+F+IGT+++WR 
Sbjct  132  DIGRLATGYGMGVFSYVVPVFVAEIAPKELRGALTTLNQFMIVTAVSVSFIIGTVLSWRA  191

Query  535  LALTGIXPCVVLGLGLCII  591
            LA+ G+ P  VL LGL  I
Sbjct  192  LAIIGLIPTAVLLLGLFFI  210



>emb|CDP03586.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MVYLSTFVAVCG+  FG CAGYSSPTQSAI +DLN SI+EYSLFGSILTFGAM GAITSG
Sbjct  1    MVYLSTFVAVCGAYEFGCCAGYSSPTQSAIREDLNLSISEYSLFGSILTFGAMIGAITSG  60

Query  268  PIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
            PIADFVGRKG     +             KGA+ +DIGR+ATGYGMGVFSYVVPVFIAEI
Sbjct  61   PIADFVGRKGAMRLASGFCVAGWLAIYFSKGAVPLDIGRMATGYGMGVFSYVVPVFIAEI  120

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK+LRGALTT+NQ MIV GVSV+F+IGT++ WRTLAL G+ PC VL LGL +I
Sbjct  121  APKDLRGALTTINQFMIVAGVSVSFIIGTLLAWRTLALVGLLPCAVLLLGLFMI  174



>ref|NP_001233882.1| st3 protein [Solanum lycopersicum]
 emb|CAC00697.2| putative sugar transporter [Solanum lycopersicum]
Length=480

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 145/182 (80%), Gaps = 8/182 (4%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
            + K DR MVYLST VAV GS + GSCAGYSSPTQSAI +DLN SIA+ SLFGSI TFGAM
Sbjct  36   EKKQDRCMVYLSTLVAVRGSYSLGSCAGYSSPTQSAIREDLNLSIAQISLFGSIWTFGAM  95

Query  247  AGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATGYGMGVFSYV  405
             GAITSGPIAD++GRKG     +         IF   +GAL +DIGRLATGYGMGVFSYV
Sbjct  96   IGAITSGPIADYIGRKGAMRMSSGFCVAGWLAIF-FAQGALALDIGRLATGYGMGVFSYV  154

Query  406  VPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLC  585
            VPVFIAEIAPK+LRGALTT+NQLMI  GVSV+F+IGTM+TWRTLALTG+ PC +L  GL 
Sbjct  155  VPVFIAEIAPKDLRGALTTINQLMICCGVSVSFIIGTMMTWRTLALTGLIPCAILLFGLF  214

Query  586  II  591
            II
Sbjct  215  II  216



>ref|XP_010242564.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Nelumbo 
nucifera]
Length=479

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 150/193 (78%), Gaps = 11/193 (6%)
 Frame = +1

Query  46   PLI-----GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEY  210
            PLI     G+    K   WMVY STFVAVCGS  FGSCAGYSSPTQSAI +DL  S+A+Y
Sbjct  23   PLIRNIEHGENKGGKEQVWMVYFSTFVAVCGSFEFGSCAGYSSPTQSAIREDLGLSLAQY  82

Query  211  SLFGSILTFGAMAGAITSGPIADFVGRKGQE--NAEN*T----IFTLLKGALVMDIGRLA  372
            S+FGSILTFGAM GAITSGPIADF+GRKG    +A   T         +GAL++DIGRL+
Sbjct  83   SVFGSILTFGAMIGAITSGPIADFIGRKGAMWMSAAFCTGGWLAIYFAEGALLLDIGRLS  142

Query  373  TGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGI  552
            TGYGMGVFSYVVPVFIAE+APK+LRG LTT+NQLMI +GVSVA++IGT++TWR LALTG+
Sbjct  143  TGYGMGVFSYVVPVFIAEMAPKDLRGGLTTVNQLMICSGVSVAYIIGTVLTWRALALTGL  202

Query  553  XPCVVLGLGLCII  591
             PC +L LGL  I
Sbjct  203  IPCFILFLGLFFI  215



>ref|XP_011009473.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Populus 
euphratica]
Length=478

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 152/207 (73%), Gaps = 16/207 (8%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKED------DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  174
            +N      +  PL+ ++D       SK    MVYLSTFVAVCGS AFGSCAGYSSPT++A
Sbjct  11   KNRAEHEDVREPLMDEQDGSFAQSSSKESARMVYLSTFVAVCGSFAFGSCAGYSSPTENA  70

Query  175  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL------  336
            + +DL+ S+AEYS+FGSILTFGAM GAITSGPIAD +GRKG       T F +       
Sbjct  71   VREDLSLSLAEYSVFGSILTFGAMIGAITSGPIADLIGRKGALRVA--TSFCVAGWLAIY  128

Query  337  --KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVI  510
              +G L +D+GRLATGYGMGVFSYVVPVFIAEIAPK LRGALTT NQLMI  GVSVAF+I
Sbjct  129  FAQGVLALDLGRLATGYGMGVFSYVVPVFIAEIAPKSLRGALTTTNQLMICGGVSVAFII  188

Query  511  GTMVTWRTLALTGIXPCVVLGLGLCII  591
            GT++TWR LALTG+ PC +L  GL +I
Sbjct  189  GTVLTWRALALTGLVPCAILVFGLFLI  215



>ref|XP_002524779.1| sugar transporter, putative [Ricinus communis]
 gb|EEF37622.1| sugar transporter, putative [Ricinus communis]
Length=481

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 147/196 (75%), Gaps = 14/196 (7%)
 Frame = +1

Query  46   PLIGKE--DDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSI  201
            PL+GK   D+    R      WMVYLSTFV+VCGS  FG CAGYSSPTQ AI++DL+ S+
Sbjct  23   PLMGKNLADEENGSREQNISNWMVYLSTFVSVCGSFEFGCCAGYSSPTQDAITEDLSLSL  82

Query  202  AEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDIG  363
            AEYS+FGSILTFGAM GAITSG IADF+GRKG                   KGAL +DIG
Sbjct  83   AEYSVFGSILTFGAMIGAITSGLIADFIGRKGAMRVAAALCVAGWLFIYFAKGALALDIG  142

Query  364  RLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLAL  543
            RLATGYGMGVFSYVVPVF+AEIAPK LRGALTTLNQLMI +GVSV ++IGT++TWRTLAL
Sbjct  143  RLATGYGMGVFSYVVPVFVAEIAPKNLRGALTTLNQLMICSGVSVFYIIGTVITWRTLAL  202

Query  544  TGIXPCVVLGLGLCII  591
             G+ PC +L  GL +I
Sbjct  203  CGLVPCAILIFGLFLI  218



>ref|XP_007162380.1| hypothetical protein PHAVU_001G147200g [Phaseolus vulgaris]
 gb|ESW34374.1| hypothetical protein PHAVU_001G147200g [Phaseolus vulgaris]
Length=472

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 146/205 (71%), Gaps = 15/205 (7%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDD-----SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
             E    G+  PL+GK D      SK   WMVY  TFVAVCGS  FG+CAGYSSPTQ AI 
Sbjct  7    EESVQKGIREPLVGKPDQQLVHTSKGHPWMVYFCTFVAVCGSYEFGACAGYSSPTQDAIR  66

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------  336
            +D + S+AEYSLFGSILTFGAMAGAITSGPIADF+GRKG       + F ++        
Sbjct  67   KDFSLSLAEYSLFGSILTFGAMAGAITSGPIADFIGRKGAMRVS--SAFCVVGWLAIYFS  124

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
            +G + +DIGRLATGYGMGVFSYVVPVF+AEIAPKELRG LTTLNQ MI   VSVAF IG 
Sbjct  125  EGPVPLDIGRLATGYGMGVFSYVVPVFVAEIAPKELRGTLTTLNQFMITAAVSVAFTIGN  184

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
            +++WR LALTG+ P  VL  GL  I
Sbjct  185  VLSWRALALTGLIPTAVLLFGLFFI  209



>ref|XP_006409064.1| hypothetical protein EUTSA_v10022677mg [Eutrema salsugineum]
 gb|ESQ50517.1| hypothetical protein EUTSA_v10022677mg [Eutrema salsugineum]
Length=468

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 155/202 (77%), Gaps = 12/202 (6%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQD  186
            E++GS   +  PL+ K+  +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  D
Sbjct  6    ESDGSRE-VREPLVHKDMAESKPEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRND  64

Query  187  LNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGA  345
            ++ SIAE+SLFGS+LTFGAM GAITSGPIAD +GRKG     +         IF   KG 
Sbjct  65   ISLSIAEFSLFGSLLTFGAMIGAITSGPIADLIGRKGAMRVSSAFCVAGWLAIF-FAKGV  123

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
            + +D+GRLATGYGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VT
Sbjct  124  VALDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTVVT  183

Query  526  WRTLALTGIXPCVVLGLGL-CI  588
            WR LAL GI PC V  LGL CI
Sbjct  184  WRVLALIGIIPCAVSFLGLFCI  205



>ref|XP_003521224.1| PREDICTED: sugar transporter ERD6-like 7-like [Glycine max]
Length=471

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 149/201 (74%), Gaps = 9/201 (4%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQD  186
             + +  G+  PL+  E +   ++   WMVY STF+AVCGS  FG+CAGYSSPTQ AI +D
Sbjct  8    EDRTQKGIREPLVVGEQNHHANKGHPWMVYFSTFIAVCGSYEFGACAGYSSPTQDAIRKD  67

Query  187  LNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKGAL  348
            L+ S+AEYSLFGSILTFGAM GAITSGP+ADF+GRKG     +        +    +G +
Sbjct  68   LSLSLAEYSLFGSILTFGAMVGAITSGPLADFIGRKGAMRVSSAFCVAGWLVIYFSEGPV  127

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
             +DIGRLATGYGMGVFSYVVPVF+AEIAPKELRGALTTLNQ MIVT VSV+F+IG +++W
Sbjct  128  PLDIGRLATGYGMGVFSYVVPVFVAEIAPKELRGALTTLNQFMIVTAVSVSFIIGNVLSW  187

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LA+ G+ P  VL LGL  I
Sbjct  188  RALAIIGLVPTAVLLLGLFFI  208



>gb|KHN19852.1| Sugar transporter ERD6-like 7 [Glycine soja]
Length=478

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 149/201 (74%), Gaps = 9/201 (4%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQD  186
             + +  G+  PL+  E +   ++   WMVY STF+AVCGS  FG+CAGYSSPTQ AI +D
Sbjct  8    EDRTQKGIREPLVVGEQNHHANKGHPWMVYFSTFIAVCGSYEFGACAGYSSPTQDAIRKD  67

Query  187  LNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKGAL  348
            L+ S+AEYSLFGSILTFGAM GAITSGP+ADF+GRKG     +        +    +G +
Sbjct  68   LSLSLAEYSLFGSILTFGAMVGAITSGPLADFIGRKGAMRVSSAFCVAGWLVIYFSEGPV  127

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
             +DIGRLATGYGMGVFSYVVPVF+AEIAPKELRGALTTLNQ MIVT VSV+F+IG +++W
Sbjct  128  PLDIGRLATGYGMGVFSYVVPVFVAEIAPKELRGALTTLNQFMIVTAVSVSFIIGNVLSW  187

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LA+ G+ P  VL LGL  I
Sbjct  188  RALAIIGLVPTAVLLLGLFFI  208



>emb|CDY01404.1| BnaA07g11770D [Brassica napus]
Length=468

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 149/191 (78%), Gaps = 11/191 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ K+  +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  16   PLVDKDMAESKPEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  75

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATG  378
            GS+LTFGAM GAITSGPIAD +GRKG     +         IF   KG + +D+GRLATG
Sbjct  76   GSLLTFGAMIGAITSGPIADLIGRKGAMRVSSAFCVVGWLAIF-FAKGVVALDLGRLATG  134

Query  379  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXP  558
            YGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G+ P
Sbjct  135  YGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGLIP  194

Query  559  CVVLGLGL-CI  588
            C V  LGL CI
Sbjct  195  CAVSILGLFCI  205



>emb|CDY12861.1| BnaC07g15720D [Brassica napus]
Length=466

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 149/191 (78%), Gaps = 11/191 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ K+  +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  14   PLVDKDMAESKPEQTWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  73

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATG  378
            GS+LTFGAM GAITSGPIAD VGRKG     +         IF   KG + +D+GRLATG
Sbjct  74   GSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIF-FAKGVVALDLGRLATG  132

Query  379  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXP  558
            YGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F++GTMVTWR LAL G+ P
Sbjct  133  YGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIVGTMVTWRVLALIGLIP  192

Query  559  CVVLGLGL-CI  588
            C V  LGL CI
Sbjct  193  CAVSILGLFCI  203



>gb|KDP21525.1| hypothetical protein JCGZ_21996 [Jatropha curcas]
Length=484

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 140/181 (77%), Gaps = 6/181 (3%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            +++ SK   WMVY STFVAVCGS  FG CAGYSSPTQ AI++DL+ S+AEYS+FGSILTF
Sbjct  38   EQNSSKESVWMVYQSTFVAVCGSFEFGCCAGYSSPTQDAITEDLSLSLAEYSVFGSILTF  97

Query  238  GAMAGAITSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDIGRLATGYGMGVFS  399
            GAM GAITSGPIADF+GRKG                   KG L +D GRLATGYGMGVFS
Sbjct  98   GAMIGAITSGPIADFIGRKGAMRVSAAFCVAGWLAIYFAKGVLALDFGRLATGYGMGVFS  157

Query  400  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLG  579
            YVVPVFIAEIAPK LRGALTTLNQLMI  GVSV ++IGT++TWR LALTG+ PC +L LG
Sbjct  158  YVVPVFIAEIAPKNLRGALTTLNQLMICGGVSVFYIIGTVLTWRALALTGLVPCGILLLG  217

Query  580  L  582
            L
Sbjct  218  L  218



>gb|ACU24439.1| unknown [Glycine max]
Length=223

 Score =   234 bits (596),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 141/198 (71%), Gaps = 8/198 (4%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNF  195
             EG   G+  PL+ +   SK   WMVY + FVAVCGS  FG+CAGYSSPTQ AI +D + 
Sbjct  8    EEGMQKGVREPLVVRA--SKGHPWMVYFTAFVAVCGSYEFGACAGYSSPTQDAIRKDFSL  65

Query  196  SIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN------*TIFTLLKGALVMD  357
            S+AEYSLFGSILTFGAM GAITSGPIADF+GRKG     +        +    +G + +D
Sbjct  66   SLAEYSLFGSILTFGAMVGAITSGPIADFIGRKGAMRVSSAFCVAGWLVIYFAEGPVYLD  125

Query  358  IGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTL  537
            IGRL+TGYGMGVFSYVVPVF+AEIAPKELRG LTTLNQ MI   VSV+F IG + +WR L
Sbjct  126  IGRLSTGYGMGVFSYVVPVFVAEIAPKELRGTLTTLNQFMITAAVSVSFTIGNVFSWRVL  185

Query  538  ALTGIXPCVVLGLGLCII  591
            A+ G+ P  VL LGL  I
Sbjct  186  AIIGLIPTAVLLLGLFFI  203



>ref|XP_009103393.1| PREDICTED: sugar transporter ERD6-like 7 [Brassica rapa]
Length=468

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 149/191 (78%), Gaps = 11/191 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ K+  +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  16   PLVDKDMAESKPEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  75

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATG  378
            GS+LTFGAM GAITSGPIAD +GRKG     +         IF   KG + +D+GRLATG
Sbjct  76   GSLLTFGAMIGAITSGPIADLIGRKGAMRVSSAFCVVGWLAIF-FAKGVVALDLGRLATG  134

Query  379  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXP  558
            YGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G+ P
Sbjct  135  YGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGLIP  194

Query  559  CVVLGLGL-CI  588
            C V  LGL CI
Sbjct  195  CAVSILGLFCI  205



>gb|KFK37554.1| hypothetical protein AALP_AA4G271800 [Arabis alpina]
Length=468

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 148/191 (77%), Gaps = 11/191 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ KE   SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP QSAI  DL+ +IAE+SLF
Sbjct  16   PLVHKEMAGSKPEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQSAIRNDLSLTIAEFSLF  75

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATG  378
            GS+LTFGAM GAITSGPIAD +GRKG     +         IF   KG + +D+GRLATG
Sbjct  76   GSLLTFGAMIGAITSGPIADLLGRKGAMRVSSAFCVVGWLAIF-FAKGVVALDLGRLATG  134

Query  379  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXP  558
            YGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI P
Sbjct  135  YGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTVVTWRVLALIGIIP  194

Query  559  CVVLGLGL-CI  588
            C V  LGL CI
Sbjct  195  CAVSFLGLFCI  205



>emb|CDY39145.1| BnaA07g01410D [Brassica napus]
Length=463

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 148/191 (77%), Gaps = 11/191 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ K   +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVEKHVAESKQEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATG  378
            GS+LTFGAM GAITSGPIAD +GRKG     +         IF   KG + +D+GRLATG
Sbjct  71   GSLLTFGAMFGAITSGPIADSIGRKGAMRVSSAFCVAGWLAIF-FAKGVVALDLGRLATG  129

Query  379  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXP  558
            YGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G+ P
Sbjct  130  YGMGAFSYVVPIFIAEIAPKAFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGLIP  189

Query  559  CVVLGLGL-CI  588
            C V  LGL CI
Sbjct  190  CAVSFLGLFCI  200



>ref|XP_002880340.1| hypothetical protein ARALYDRAFT_483991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56599.1| hypothetical protein ARALYDRAFT_483991 [Arabidopsis lyrata subsp. 
lyrata]
Length=464

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 149/201 (74%), Gaps = 10/201 (5%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDL  189
            ++  +  +  PL+ K    SK D+ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL
Sbjct  2    SKAKSDAVREPLVDKNMAGSKPDQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDL  61

Query  190  NFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGAL  348
            + +IAE+SLFGS+LTFGAM GAITSGPIAD VGRKG     +         IF   KG +
Sbjct  62   SLTIAEFSLFGSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIF-FAKGVV  120

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
             +D+GRLATGYGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTW
Sbjct  121  PLDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTLVTW  180

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LAL GI PC    LGL  I
Sbjct  181  RVLALIGIIPCAASFLGLFFI  201



>ref|NP_566120.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 ref|NP_850483.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 sp|P93051.2|ERDL7_ARATH RecName: Full=Sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 gb|AAD13706.2| putative sugar transporter [Arabidopsis thaliana]
 gb|AAM53273.1| putative putative sister-chromatide cohesion protein [Arabidopsis 
thaliana]
 gb|AAN15372.1| putative putative sister-chromatide cohesion protein [Arabidopsis 
thaliana]
 gb|AEC10924.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 gb|AEC10925.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
Length=463

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 145/192 (76%), Gaps = 12/192 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ K    SK D+ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVDKNMAGSKPDQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*--------TIFTLLKGALVMDIGRLAT  375
            GS+LTFGAM GAITSGPIAD VGRKG     +          IF   KG + +D+GRLAT
Sbjct  71   GSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIIFA--KGVVALDLGRLAT  128

Query  376  GYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIX  555
            GYGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI 
Sbjct  129  GYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTLVTWRVLALIGII  188

Query  556  PCVVLGLGLCII  591
            PC    LGL  I
Sbjct  189  PCAASFLGLFFI  200



>gb|EPS59997.1| hypothetical protein M569_14807, partial [Genlisea aurea]
Length=454

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 145/191 (76%), Gaps = 9/191 (5%)
 Frame = +1

Query  46   PLIGKED---DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSL  216
            PLI  E+   + K  RWMVY ST +A+CGS +FGSCAGYSSPTQ+AI +D+N S+ EYSL
Sbjct  5    PLIPPEESPENGKEQRWMVYFSTLIAICGSYSFGSCAGYSSPTQAAIREDVNLSLPEYSL  64

Query  217  FGSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATG  378
            FGSILTFGAM GAITSG IAD  GR+G     +             +G +++D+GRLATG
Sbjct  65   FGSILTFGAMIGAITSGKIADSSGRRGAMLVSSGFCTAGWLFIYFAQGTVLLDVGRLATG  124

Query  379  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXP  558
            YGMGVFSYVVPVFIAEI+PK+LRGALTTLNQLMI TGVSV+F+IGT++ WR LAL GI P
Sbjct  125  YGMGVFSYVVPVFIAEISPKDLRGALTTLNQLMICTGVSVSFIIGTLLPWRVLALVGIVP  184

Query  559  CVVLGLGLCII  591
            C VL +GL  I
Sbjct  185  CAVLVVGLLFI  195



>ref|XP_006444173.1| hypothetical protein CICLE_v10024572mg [Citrus clementina]
 gb|ESR57413.1| hypothetical protein CICLE_v10024572mg [Citrus clementina]
Length=330

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   RTNNKKVNPCMVYFSTPIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GAITSGPIA++VGRKG       ++F +         +G   +DIGRLATGYGMGV
Sbjct  92   GAMIGAITSGPIANYVGRKGAMRVS--SVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGV  149

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI PC +L 
Sbjct  150  FSYVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILF  209

Query  574  LGLCII  591
            LGL  I
Sbjct  210  LGLFFI  215



>ref|XP_006479816.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X6 [Citrus 
sinensis]
Length=324

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   RTNNKKVNPCMVYFSTPIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GAITSGPIA++VGRKG       ++F +         +G   +DIGRLATGYGMGV
Sbjct  92   GAMIGAITSGPIANYVGRKGAMRVS--SVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGV  149

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI PC +L 
Sbjct  150  FSYVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILF  209

Query  574  LGLCII  591
            LGL  I
Sbjct  210  LGLFFI  215



>ref|XP_006479815.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X5 [Citrus 
sinensis]
Length=341

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   RTNNKKVNPCMVYFSTPIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GAITSGPIA++VGRKG       ++F +         +G   +DIGRLATGYGMGV
Sbjct  92   GAMIGAITSGPIANYVGRKGAMRVS--SVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGV  149

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI PC +L 
Sbjct  150  FSYVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILF  209

Query  574  LGLCII  591
            LGL  I
Sbjct  210  LGLFFI  215



>emb|CDX82668.1| BnaC07g01980D [Brassica napus]
Length=463

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ K   +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVEKHLAESKQEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATG  378
            GS+LTFGAM GAITSGPIAD +GRKG     +         IF    G + +D+GRLATG
Sbjct  71   GSLLTFGAMFGAITSGPIADSIGRKGAMRVSSAFCVAGWLAIF-FANGVVALDLGRLATG  129

Query  379  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXP  558
            YGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G+ P
Sbjct  130  YGMGAFSYVVPIFIAEIAPKAFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGLVP  189

Query  559  CVVLGLGL-CI  588
            C V  LGL CI
Sbjct  190  CAVSFLGLFCI  200



>gb|KJB28576.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=373

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 144/197 (73%), Gaps = 12/197 (6%)
 Frame = +1

Query  37   MAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            +  PLIG +D+           WMV L TFVAVCGS  FGSC GYS+PTQSAIS+DLN S
Sbjct  20   LEKPLIGADDEKIVVHHENGSIWMVLLCTFVAVCGSFEFGSCVGYSAPTQSAISEDLNLS  79

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDI  360
            ++E+S+FGSILT GAM GA+TSG IAD +GRKG          T        KGA+ +DI
Sbjct  80   LSEFSMFGSILTIGAMLGAVTSGRIADMIGRKGAMRLSAGFCITGWLAVYFSKGAVSLDI  139

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR +TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG SVAF+IGT++ WR LA
Sbjct  140  GRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSVAFLIGTIIPWRELA  199

Query  541  LTGIXPCVVLGLGLCII  591
            LTG+ PC+ L +GLC I
Sbjct  200  LTGLVPCIFLFVGLCFI  216



>ref|XP_004292608.2| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 145/201 (72%), Gaps = 8/201 (4%)
 Frame = +1

Query  13   ENEGSTAGMAAPLI--GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQD  186
            E   +   +  PL+  G +  SK D+WMVYLSTFVAVCGS  FG C GYSSPTQSAI +D
Sbjct  13   EENSAHHEVKRPLVDGGLDHGSKGDQWMVYLSTFVAVCGSYEFGCCVGYSSPTQSAIRED  72

Query  187  LNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGAL  348
            LN ++A++++FGSILTFGAM GAIT GPI DF+GRKG     +             +GA+
Sbjct  73   LNLTLAQFAMFGSILTFGAMIGAITIGPITDFIGRKGALRFSSIVCLAGWLAIYFSEGAV  132

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
            V+DIGR+A GYGMG FSYVVPVF+AEIAPK LRG LT LNQLMIV GVSV+F+IG +V+W
Sbjct  133  VLDIGRMAKGYGMGAFSYVVPVFVAEIAPKHLRGTLTALNQLMIVAGVSVSFIIGVVVSW  192

Query  529  RTLALTGIXPCVVLGLGLCII  591
            RTLAL G+ PC V   GL  I
Sbjct  193  RTLALIGLVPCAVTIFGLFFI  213



>gb|AAM61246.1| putative sugar transporter [Arabidopsis thaliana]
Length=463

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 144/192 (75%), Gaps = 12/192 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ K    SK D+ WMVYLSTFVAVCG  AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVDKNMAGSKPDQPWMVYLSTFVAVCGPFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*--------TIFTLLKGALVMDIGRLAT  375
            GS+LTFGAM GAITSGPIAD VGRKG     +          IF   KG + +D+GRLAT
Sbjct  71   GSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIIFA--KGVVALDLGRLAT  128

Query  376  GYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIX  555
            GYGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI 
Sbjct  129  GYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTLVTWRVLALIGII  188

Query  556  PCVVLGLGLCII  591
            PC    LGL  I
Sbjct  189  PCAASFLGLFFI  200



>ref|XP_006479811.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X1 [Citrus 
sinensis]
 ref|XP_006479812.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X2 [Citrus 
sinensis]
 ref|XP_006479813.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X3 [Citrus 
sinensis]
 ref|XP_006479814.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X4 [Citrus 
sinensis]
Length=407

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   RTNNKKVNPCMVYFSTPIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GAITSGPIA++VGRKG       ++F +         +G   +DIGRLATGYGMGV
Sbjct  92   GAMIGAITSGPIANYVGRKGAMRVS--SVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGV  149

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI PC +L 
Sbjct  150  FSYVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILF  209

Query  574  LGLCII  591
            LGL  I
Sbjct  210  LGLFFI  215



>ref|XP_011009474.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Populus 
euphratica]
Length=437

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 141/176 (80%), Gaps = 10/176 (6%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MVYLSTFVAVCGS AFGSCAGYSSPT++A+ +DL+ S+AEYS+FGSILTFGAM GAITSG
Sbjct  1    MVYLSTFVAVCGSFAFGSCAGYSSPTENAVREDLSLSLAEYSVFGSILTFGAMIGAITSG  60

Query  268  PIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIA  423
            PIAD +GRKG       T F +         +G L +D+GRLATGYGMGVFSYVVPVFIA
Sbjct  61   PIADLIGRKGALRVA--TSFCVAGWLAIYFAQGVLALDLGRLATGYGMGVFSYVVPVFIA  118

Query  424  EIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            EIAPK LRGALTT NQLMI  GVSVAF+IGT++TWR LALTG+ PC +L  GL +I
Sbjct  119  EIAPKSLRGALTTTNQLMICGGVSVAFIIGTVLTWRALALTGLVPCAILVFGLFLI  174



>ref|XP_006444171.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 ref|XP_006479808.1| PREDICTED: sugar transporter ERD6-like 7-like [Citrus sinensis]
 gb|ESR57411.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=478

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   QANNKKVNPCMVYFSTLIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GAITSGPIAD++GRKG       ++F +         +G   +DIGRLATGYGMGV
Sbjct  92   GAMIGAITSGPIADYIGRKGAMRVS--SVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGV  149

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI PC +L 
Sbjct  150  FSYVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILF  209

Query  574  LGLCII  591
            LGL  I
Sbjct  210  LGLFFI  215



>ref|XP_006444169.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 gb|ESR57409.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=483

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  37   QANNKKVNPCMVYFSTLIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  96

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GAITSGPIAD++GRKG       ++F +         +G   +DIGRLATGYGMGV
Sbjct  97   GAMIGAITSGPIADYIGRKGAMRVS--SVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGV  154

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI PC +L 
Sbjct  155  FSYVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILF  214

Query  574  LGLCII  591
            LGL  I
Sbjct  215  LGLFFI  220



>ref|XP_010545070.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545071.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545072.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545074.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
Length=464

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 10/200 (5%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            N G       PL+ K+   K ++ WM YLSTFVAVCGS AFGSCAGYSSP Q+AI +DL+
Sbjct  3    NGGGDGEAREPLVQKKLAEKEEQLWMGYLSTFVAVCGSFAFGSCAGYSSPAQAAIREDLS  62

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALV  351
             S+AE+SLFGS+LTFGAM GAI  GPIAD VGRKG     +         IF   KG + 
Sbjct  63   LSLAEFSLFGSLLTFGAMIGAIMCGPIADLVGRKGAMRVSSAFCVVGWLAIF-FAKGPVA  121

Query  352  MDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWR  531
            +DIGRLATGYGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSVAF+IGT++TWR
Sbjct  122  LDIGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVAFIIGTVLTWR  181

Query  532  TLALTGIXPCVVLGLGL-CI  588
             LALTGI PC +  +GL CI
Sbjct  182  VLALTGIIPCAISFIGLFCI  201



>gb|KJB28574.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=413

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 144/197 (73%), Gaps = 12/197 (6%)
 Frame = +1

Query  37   MAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            +  PLIG +D+           WMV L TFVAVCGS  FGSC GYS+PTQSAIS+DLN S
Sbjct  20   LEKPLIGADDEKIVVHHENGSIWMVLLCTFVAVCGSFEFGSCVGYSAPTQSAISEDLNLS  79

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDI  360
            ++E+S+FGSILT GAM GA+TSG IAD +GRKG          T        KGA+ +DI
Sbjct  80   LSEFSMFGSILTIGAMLGAVTSGRIADMIGRKGAMRLSAGFCITGWLAVYFSKGAVSLDI  139

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR +TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG SVAF+IGT++ WR LA
Sbjct  140  GRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSVAFLIGTIIPWRELA  199

Query  541  LTGIXPCVVLGLGLCII  591
            LTG+ PC+ L +GLC I
Sbjct  200  LTGLVPCIFLFVGLCFI  216



>gb|KJB28575.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=444

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 144/197 (73%), Gaps = 12/197 (6%)
 Frame = +1

Query  37   MAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            +  PLIG +D+           WMV L TFVAVCGS  FGSC GYS+PTQSAIS+DLN S
Sbjct  20   LEKPLIGADDEKIVVHHENGSIWMVLLCTFVAVCGSFEFGSCVGYSAPTQSAISEDLNLS  79

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDI  360
            ++E+S+FGSILT GAM GA+TSG IAD +GRKG          T        KGA+ +DI
Sbjct  80   LSEFSMFGSILTIGAMLGAVTSGRIADMIGRKGAMRLSAGFCITGWLAVYFSKGAVSLDI  139

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR +TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG SVAF+IGT++ WR LA
Sbjct  140  GRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSVAFLIGTIIPWRELA  199

Query  541  LTGIXPCVVLGLGLCII  591
            LTG+ PC+ L +GLC I
Sbjct  200  LTGLVPCIFLFVGLCFI  216



>ref|XP_003554233.1| PREDICTED: sugar transporter ERD6-like 7-like isoform 1 [Glycine 
max]
Length=466

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 142/198 (72%), Gaps = 8/198 (4%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNF  195
             EG   G+  PL+ +   SK   WMVY +TFVAVCGS  FG+CAGYSSPTQ AI +D + 
Sbjct  8    EEGMQKGVREPLVVRA--SKGHPWMVYFTTFVAVCGSYEFGACAGYSSPTQDAIRKDFSL  65

Query  196  SIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN------*TIFTLLKGALVMD  357
            S+AEYSLFGSILTFGAM GAITSGPIADF+GRKG     +        +    +G + +D
Sbjct  66   SLAEYSLFGSILTFGAMVGAITSGPIADFIGRKGAMRVSSAFCVAGWLVIYFAEGPVYLD  125

Query  358  IGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTL  537
            IGRL+TGYGMGVFSYVVPVF+AEIAPKELRG LTTLNQ MI   VSV+F IG + +WR L
Sbjct  126  IGRLSTGYGMGVFSYVVPVFVAEIAPKELRGTLTTLNQFMITAAVSVSFTIGNVFSWRVL  185

Query  538  ALTGIXPCVVLGLGLCII  591
            A+ G+ P  VL LGL  I
Sbjct  186  AIIGLIPTAVLLLGLFFI  203



>gb|KJB28573.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=480

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 144/197 (73%), Gaps = 12/197 (6%)
 Frame = +1

Query  37   MAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            +  PLIG +D+           WMV L TFVAVCGS  FGSC GYS+PTQSAIS+DLN S
Sbjct  20   LEKPLIGADDEKIVVHHENGSIWMVLLCTFVAVCGSFEFGSCVGYSAPTQSAISEDLNLS  79

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDI  360
            ++E+S+FGSILT GAM GA+TSG IAD +GRKG          T        KGA+ +DI
Sbjct  80   LSEFSMFGSILTIGAMLGAVTSGRIADMIGRKGAMRLSAGFCITGWLAVYFSKGAVSLDI  139

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR +TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG SVAF+IGT++ WR LA
Sbjct  140  GRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSVAFLIGTIIPWRELA  199

Query  541  LTGIXPCVVLGLGLCII  591
            LTG+ PC+ L +GLC I
Sbjct  200  LTGLVPCIFLFVGLCFI  216



>ref|XP_010424172.1| PREDICTED: sugar transporter ERD6-like 16, partial [Camelina 
sativa]
Length=284

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 144/208 (69%), Gaps = 11/208 (5%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPT  165
            +  G+       +  P +  +DD K         MV  STFVAVCGS  FGSC GYS+PT
Sbjct  9    VERGDIANKVEDLGKPFLTDQDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSAPT  68

Query  166  QSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT-----  330
            QS+I QDLN S+AE+S+FGSILT GAM GA+ SG ++DF GRKG          T     
Sbjct  69   QSSIRQDLNLSLAEFSMFGSILTIGAMIGAVMSGKVSDFSGRKGAMRTSACFCITGWVAV  128

Query  331  -LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFV  507
               KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F+
Sbjct  129  FFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVSFL  188

Query  508  IGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IG++++W+TLALTG+ PC+VL  GLC I
Sbjct  189  IGSLISWKTLALTGLAPCIVLLFGLCFI  216



>ref|XP_008449464.1| PREDICTED: sugar transporter ERD6-like 7 [Cucumis melo]
Length=473

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 146/209 (70%), Gaps = 13/209 (6%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKE----DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPT  165
            I   E E        P +  E     +S+  R WMVYLS+ VAVCGS  FG+CAGYSSPT
Sbjct  3    IRQDEEESGQEAAGQPFLQDESKWTHNSEERRPWMVYLSSLVAVCGSYEFGTCAGYSSPT  62

Query  166  QSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TI  324
            QSAI  DL+ S+AE+SLFGSILTFGAM GAITSGPI D +GRKG              TI
Sbjct  63   QSAIINDLHLSLAEFSLFGSILTFGAMIGAITSGPIGDLLGRKGAMRVATGACVAGWLTI  122

Query  325  FTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  504
            +   +G + +D+GR ATGYGMGVFSYVVPVFIAEIAPK LRGALTTLNQ MI T VS++F
Sbjct  123  Y-FAQGVVALDVGRFATGYGMGVFSYVVPVFIAEIAPKNLRGALTTLNQFMICTAVSISF  181

Query  505  VIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +IG +++WRTLALT + PCV+L  GL  I
Sbjct  182  IIGNVLSWRTLALTALVPCVILTFGLFFI  210



>ref|XP_010667578.1| PREDICTED: sugar transporter ERD6-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 139/183 (76%), Gaps = 6/183 (3%)
 Frame = +1

Query  61   EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  240
            E+ S+   WMVYLSTFVAVCGS  FG+CAGYSSPTQSAI+ +L  S A+Y+LFGSILT G
Sbjct  41   ENGSRRHPWMVYLSTFVAVCGSYEFGACAGYSSPTQSAITAELGLSTAQYALFGSILTVG  100

Query  241  AMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSY  402
            AM GAITSGPIADF+GRKG     +             KG+L +DIGRLA GYGMG FSY
Sbjct  101  AMIGAITSGPIADFIGRKGAMRVYSAFCVGGWLAIYFAKGSLALDIGRLAGGYGMGAFSY  160

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            VVPV+IAEIAP  LRGALTTLNQ+MI  GVSVAF+IG ++ WR LALTG+ PCV+L LGL
Sbjct  161  VVPVYIAEIAPVHLRGALTTLNQVMICAGVSVAFIIGIVLPWRALALTGLIPCVILLLGL  220

Query  583  CII  591
              I
Sbjct  221  FFI  223



>ref|XP_010112685.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC34643.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=450

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 136/194 (70%), Gaps = 12/194 (6%)
 Frame = +1

Query  46   PLIGKEDDS------KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAE  207
            PL   ED S      K + WMVYLSTFVAVCGS  FG+CAGYSSPTQSAI +DLN S+A+
Sbjct  14   PLFAVEDGSPAHEYSKDNPWMVYLSTFVAVCGSYEFGTCAGYSSPTQSAIREDLNLSLAD  73

Query  208  YSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRL  369
            YSLFGSILTFGAM GAITSG IAD VGRKG          T        K AL +DIGRL
Sbjct  74   YSLFGSILTFGAMIGAITSGTIADLVGRKGAMRVYTAFCVTGWLSIYFAKDALALDIGRL  133

Query  370  ATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTG  549
            ATGYGMG FSYVVPVFIAEIAPK  RG LT  NQ MI  GVSV+F+IG ++TWR LAL  
Sbjct  134  ATGYGMGAFSYVVPVFIAEIAPKNHRGLLTASNQFMICAGVSVSFIIGNVLTWRALALVA  193

Query  550  IXPCVVLGLGLCII  591
            + PC VL  GL  I
Sbjct  194  LIPCAVLLFGLSFI  207



>ref|XP_011033659.1| PREDICTED: sugar transporter ERD6-like 7 [Populus euphratica]
Length=482

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 150/214 (70%), Gaps = 18/214 (8%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGK----EDDSKTD--------RWMVYLSTFVAVCGSCAFGSCA  147
            +  +N+G+      PL+ K    E+ S +          WMVYLSTFVAV GS   GSC+
Sbjct  7    IENDNDGALEDAREPLMPKNSSYEEGSGSQCSSNNTGTAWMVYLSTFVAVAGSFEVGSCS  66

Query  148  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*---  318
            GYSSPTQ A+ +DL+ SIAEYSLFGSILT GAM GAITSGPIAD++GRKG     +    
Sbjct  67   GYSSPTQKAMREDLSLSIAEYSLFGSILTVGAMIGAITSGPIADYIGRKGAMRFSSTFCV  126

Query  319  ---TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  489
                     KGAL +DIGRLATGYGMG  S+VVPVFIAEIAPK LRG LTT+ QLM+ TG
Sbjct  127  AGWLAIYFAKGALALDIGRLATGYGMGALSFVVPVFIAEIAPKNLRGTLTTVTQLMVATG  186

Query  490  VSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            VSVAF+IGT++ WR LALTG+ PCV+L +GL +I
Sbjct  187  VSVAFIIGTVLRWRVLALTGVIPCVILHVGLFLI  220



>ref|XP_007222121.1| hypothetical protein PRUPE_ppa004636mg [Prunus persica]
 gb|EMJ23320.1| hypothetical protein PRUPE_ppa004636mg [Prunus persica]
Length=499

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 151/217 (70%), Gaps = 23/217 (11%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKE------------DDSKTDR----WMVYLSTFVAVCGSCAFG  138
            NGEN  +   +  PL  K+            D+  T++    WMV LST VAVCGS  FG
Sbjct  11   NGENN-TLEDLEQPLFIKQEKIVSYEEEYGSDEKSTEKSGSIWMVLLSTCVAVCGSFEFG  69

Query  139  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*  318
            SC GYS+PTQSAI +DLN S+A++S+FGSILT GAM GAITSG IADF+GRKG       
Sbjct  70   SCVGYSAPTQSAIREDLNLSLAQFSMFGSILTIGAMLGAITSGRIADFLGRKGAMRMSAS  129

Query  319  TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  480
               T        KGAL +DIGR  TGYG+GVFSYVVP+FIAEIAPK LRGALTTLNQLMI
Sbjct  130  FCITGWLAIFFSKGALSLDIGRFFTGYGIGVFSYVVPIFIAEIAPKNLRGALTTLNQLMI  189

Query  481  VTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            VTG SVAFVIGT+++W TLALTGI PC+ L +GL  +
Sbjct  190  VTGASVAFVIGTIISWTTLALTGIVPCIFLLVGLWFV  226



>ref|XP_010507821.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=437

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 138/175 (79%), Gaps = 8/175 (5%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MVYLSTFVAVCGS AFGSCAG+SSPTQ+AI  DL+ +IAE+SLFGS+LTFGAM GAITSG
Sbjct  1    MVYLSTFVAVCGSFAFGSCAGFSSPTQAAIRNDLSLTIAEFSLFGSLLTFGAMIGAITSG  60

Query  268  PIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
            PIAD VGRKG     +         IF   KG + +D+GRLATGYGMG FSYVVP+FIAE
Sbjct  61   PIADLVGRKGAMRVSSAFCVVGWLAIF-FAKGVVTLDLGRLATGYGMGAFSYVVPIFIAE  119

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI PC    LGL +I
Sbjct  120  IAPKTFRGALTTLNQILICTGVSVSFIIGTLVTWRVLALIGIIPCAASFLGLFLI  174



>ref|XP_008235073.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=480

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 144/202 (71%), Gaps = 20/202 (10%)
 Frame = +1

Query  10   GENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDL  189
            G  +GS+ G           +K D+WMVYLSTFVAVCGS  FG   GYSSPTQSAI +DL
Sbjct  28   GAGDGSSHG----------STKGDQWMVYLSTFVAVCGSYEFGCGVGYSSPTQSAIRKDL  77

Query  190  NFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGA  345
            N S+AEYS+FGSILTFGAM GAIT GPI DF+GRKG        +F +         KGA
Sbjct  78   NLSLAEYSMFGSILTFGAMIGAITIGPITDFLGRKGALRMS--CVFCVAGWLAIYFSKGA  135

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
            L +DIGRLATGYG G FSY+VPVFIAEIAPK LRG LT +NQLMIVTGVSV+F+IG +V+
Sbjct  136  LSLDIGRLATGYGSGAFSYIVPVFIAEIAPKNLRGRLTAINQLMIVTGVSVSFIIGVVVS  195

Query  526  WRTLALTGIXPCVVLGLGLCII  591
            WR LA+ GI PC V+  GL  I
Sbjct  196  WRALAIIGIVPCAVIIFGLFFI  217



>ref|XP_008223080.1| PREDICTED: sugar transporter ERD6-like 16 [Prunus mume]
Length=499

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 152/217 (70%), Gaps = 23/217 (11%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKE------------DDSKTDR----WMVYLSTFVAVCGSCAFG  138
            NGEN  +   +  PL+ K+            D+  T++    WMV LST VAVCGS  FG
Sbjct  11   NGENN-TLEDLEQPLVIKQEKIVSYEDEYGSDEKSTEKSGSIWMVLLSTCVAVCGSFEFG  69

Query  139  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*  318
            SC GYS+PTQSAI +DLN S+A++S+FGSILT GAM GAITSG IADF+GRKG       
Sbjct  70   SCVGYSAPTQSAIREDLNLSLAQFSMFGSILTIGAMLGAITSGRIADFLGRKGAMRMSAS  129

Query  319  TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  480
               T        KGAL ++IGR  TGYG+GVFSYVVP+FIAEIAPK LRGALTTLNQLMI
Sbjct  130  FCITGWLAIFFSKGALSLEIGRFFTGYGIGVFSYVVPIFIAEIAPKNLRGALTTLNQLMI  189

Query  481  VTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            VTG SVAFVIGT+++W TLALTGI PC+ L +GL  +
Sbjct  190  VTGASVAFVIGTIISWTTLALTGIVPCIFLLVGLWFV  226



>ref|XP_004140089.1| PREDICTED: sugar transporter ERD6-like 7-like [Cucumis sativus]
 gb|KGN47881.1| hypothetical protein Csa_6G409380 [Cucumis sativus]
Length=473

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 143/204 (70%), Gaps = 12/204 (6%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKE----DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
            E  G  A    P +  E     +S+  R WMVYLST VAVCGS  FG+CAGYSSPTQSAI
Sbjct  8    EESGQEAA-GQPFLQDESKWTHNSEERRPWMVYLSTLVAVCGSYEFGTCAGYSSPTQSAI  66

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLK  339
              DL+ S+AE+SLFGSILTFGAM GAITSGPI D +GRKG                   +
Sbjct  67   INDLHLSLAEFSLFGSILTFGAMIGAITSGPIGDLLGRKGAMRVATGACVAGWLAIYFAQ  126

Query  340  GALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTM  519
            G + +DIGR ATGYGMGVFSYVVP+FIAEIAPK LRGALTTLNQ MI T VS++F+IG +
Sbjct  127  GVVALDIGRFATGYGMGVFSYVVPIFIAEIAPKNLRGALTTLNQFMICTAVSISFIIGNV  186

Query  520  VTWRTLALTGIXPCVVLGLGLCII  591
            ++WRTLAL G+ PCV+L  GL  I
Sbjct  187  LSWRTLALIGLVPCVILTFGLFFI  210



>ref|XP_006444168.1| hypothetical protein CICLE_v10019918mg [Citrus clementina]
 ref|XP_006479807.1| PREDICTED: sugar transporter ERD6-like 7-like [Citrus sinensis]
 gb|ESR57408.1| hypothetical protein CICLE_v10019918mg [Citrus clementina]
 gb|KDO87481.1| hypothetical protein CISIN_1g011565mg [Citrus sinensis]
Length=483

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 141/185 (76%), Gaps = 6/185 (3%)
 Frame = +1

Query  55   GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILT  234
            GK+  SK   +MVYLST VAV GS +FG+  GYSSPTQ+AI +DL+ S+AEYS+FGSILT
Sbjct  36   GKKTGSKDSLYMVYLSTLVAVSGSYSFGTGVGYSSPTQNAIREDLSLSLAEYSVFGSILT  95

Query  235  FGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVF  396
            FGAM GAITSGPIADF+GRKG     +             +GAL +D+GRLATGYGMG+F
Sbjct  96   FGAMIGAITSGPIADFIGRKGAMRVSSFVCIAGWLAIYFSEGALSLDLGRLATGYGMGIF  155

Query  397  SYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGL  576
            SYVVPVF AEIAPKELRGALT+ NQL+IV G S  F+IGT+ TWRTLAL G+ PC VL L
Sbjct  156  SYVVPVFTAEIAPKELRGALTSANQLLIVIGASTFFIIGTVATWRTLALVGVIPCAVLLL  215

Query  577  GLCII  591
            GL +I
Sbjct  216  GLFLI  220



>ref|XP_004158614.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 7-like 
[Cucumis sativus]
Length=473

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 143/204 (70%), Gaps = 12/204 (6%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKE----DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
            E  G  A    P +  E     +S+  R WMVYLST VAVCGS  FG+CAGYSSPTQSAI
Sbjct  8    EESGQEAA-GQPFLQDESKWTHNSEERRPWMVYLSTLVAVCGSYEFGTCAGYSSPTQSAI  66

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLK  339
              DL+ S+AE+SLFGSILTFGAM GAITSGPI D +GRKG                   +
Sbjct  67   INDLHLSLAEFSLFGSILTFGAMIGAITSGPIGDLLGRKGAMRVATGACVAGWLAIYFAQ  126

Query  340  GALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTM  519
            G + +DIGR ATGYGMGVFSYVVP+FIAEIAPK LRGALTTLNQ MI T VS++F+IG +
Sbjct  127  GVVALDIGRFATGYGMGVFSYVVPIFIAEIAPKNLRGALTTLNQFMICTAVSISFIIGNV  186

Query  520  VTWRTLALTGIXPCVVLGLGLCII  591
            ++WRTLAL G+ PCV+L  GL  I
Sbjct  187  LSWRTLALIGLVPCVILTFGLFFI  210



>ref|XP_009102177.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 7 
[Brassica rapa]
Length=463

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 145/191 (76%), Gaps = 11/191 (6%)
 Frame = +1

Query  46   PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            PL+ K   +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVEKHVAESKQEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATG  378
            GS+LTFGAM GAITSGPIAD +GRKG     +         IF   KG + +D+GRLATG
Sbjct  71   GSLLTFGAMFGAITSGPIADSIGRKGAMRVSSAFCVAGWLAIF-FAKGVVALDLGRLATG  129

Query  379  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXP  558
            YGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G   
Sbjct  130  YGMGAFSYVVPIFIAEIAPKAFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGXDT  189

Query  559  CVVLGLGL-CI  588
              V  LGL CI
Sbjct  190  IAVSFLGLFCI  200



>ref|NP_568367.1| sugar transporter ERD6-like 16 [Arabidopsis thaliana]
 sp|Q8LBI9.2|EDL16_ARATH RecName: Full=Sugar transporter ERD6-like 16 [Arabidopsis thaliana]
 gb|AAL36051.1| AT5g18840/F17K4_90 [Arabidopsis thaliana]
 gb|AAN18269.1| At5g18840/F17K4_90 [Arabidopsis thaliana]
 gb|AED92620.1| sugar transporter ERD6-like 16 [Arabidopsis thaliana]
Length=482

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 143/206 (69%), Gaps = 11/206 (5%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             GE       +  P +  EDD K         MV  STFVAVCGS  FGSC GYS+PTQS
Sbjct  11   RGEIVNKVEDLGKPFLTHEDDEKESENNESYLMVLFSTFVAVCGSFEFGSCVGYSAPTQS  70

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            +I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKG          T       
Sbjct  71   SIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCITGWLAVFF  130

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F+IG
Sbjct  131  TKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSVSFLIG  190

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            ++++W+TLALTG+ PC+VL  GLC I
Sbjct  191  SLISWKTLALTGLAPCIVLLFGLCFI  216



>ref|XP_007201571.1| hypothetical protein PRUPE_ppa018319mg [Prunus persica]
 gb|EMJ02770.1| hypothetical protein PRUPE_ppa018319mg [Prunus persica]
Length=494

 Score =   232 bits (591),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 135/183 (74%), Gaps = 6/183 (3%)
 Frame = +1

Query  61   EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  240
               +K D+WMVYLSTFVAVCGS  FG   GYSSPTQSAI +DLN S+AEYS+FGSILTFG
Sbjct  35   HGSTKGDQWMVYLSTFVAVCGSYEFGCGVGYSSPTQSAIRKDLNLSLAEYSMFGSILTFG  94

Query  241  AMAGAITSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDIGRLATGYGMGVFSY  402
            AM GAIT GPI DF+GRKG                   KGAL +DIGRLATGYG G FSY
Sbjct  95   AMIGAITIGPITDFLGRKGALRMSCGFCVAGWLAIYFSKGALSLDIGRLATGYGSGAFSY  154

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            +VPVFIAEIAPK LRG LT +NQLMIVTGVSV+F+IG +V+WR LA+ GI PC V+  GL
Sbjct  155  IVPVFIAEIAPKNLRGRLTAINQLMIVTGVSVSFIIGVVVSWRALAIIGIVPCAVIIFGL  214

Query  583  CII  591
              I
Sbjct  215  FFI  217



>gb|KEH23721.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=475

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 146/205 (71%), Gaps = 13/205 (6%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDD----SKTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  174
             +G   GM  PLIG+ ++    +  D    WM+Y +TF+AVCGS  FG+C GYSSP Q A
Sbjct  8    EDGKQKGMREPLIGEHNNQLVHANKDHHYPWMLYFTTFIAVCGSYEFGACTGYSSPAQDA  67

Query  175  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN------*TIFTLL  336
            I +DLN S+ EYSLFGSILTFGAM GAITSGPIA+FVGRKG     +        +    
Sbjct  68   IRRDLNLSLEEYSLFGSILTFGAMIGAITSGPIAEFVGRKGAMRVSSAFSIAGWLVIYFS  127

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
            +G + +DIGRL TGYGMGVFS+VVP+F+AEIAPKE RGALTTLNQ MIV+G S +F+IGT
Sbjct  128  EGIVPLDIGRLLTGYGMGVFSFVVPIFVAEIAPKERRGALTTLNQFMIVSGASGSFIIGT  187

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
            +++WR LA+ G+ P  VL LGL  I
Sbjct  188  VLSWRALAIIGLIPTAVLLLGLLFI  212



>ref|XP_010070277.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58937.1| hypothetical protein EUGRSUZ_H01560 [Eucalyptus grandis]
Length=481

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 144/206 (70%), Gaps = 11/206 (5%)
 Frame = +1

Query  7    NGENEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+ EG    +  P      GK++     R WMVY +TFVAVCGS  FG+CAGYSSPTQ 
Sbjct  12   TGDREGIRERLLVPQEKDRAGKDEGIDKGRPWMVYFTTFVAVCGSYEFGTCAGYSSPTQD  71

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            AI ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK      +            
Sbjct  72   AIVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASALCVAGWLAIYF  131

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             +GAL +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLMIV GVSV+F+IG
Sbjct  132  AEGALALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLMIVAGVSVSFIIG  191

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            T++ WR LAL G+ PC VL  GL  I
Sbjct  192  TVLAWRVLALIGLIPCAVLLFGLFFI  217



>ref|XP_010070278.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Eucalyptus 
grandis]
Length=463

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 144/206 (70%), Gaps = 11/206 (5%)
 Frame = +1

Query  7    NGENEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+ EG    +  P      GK++     R WMVY +TFVAVCGS  FG+CAGYSSPTQ 
Sbjct  12   TGDREGIRERLLVPQEKDRAGKDEGIDKGRPWMVYFTTFVAVCGSYEFGTCAGYSSPTQD  71

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            AI ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK      +            
Sbjct  72   AIVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASALCVAGWLAIYF  131

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             +GAL +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLMIV GVSV+F+IG
Sbjct  132  AEGALALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLMIVAGVSVSFIIG  191

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            T++ WR LAL G+ PC VL  GL  I
Sbjct  192  TVLAWRVLALIGLIPCAVLLFGLFFI  217



>emb|CDY13924.1| BnaC09g39020D [Brassica napus]
Length=283

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 146/211 (69%), Gaps = 14/211 (7%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGK---EDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYS  156
            +  GE      G+  PL+ K   +DD +        +MV  STFVAVCGS  FGSC GYS
Sbjct  9    VERGEIVSRVEGLGNPLLKKVADQDDVEESEINESYFMVLFSTFVAVCGSFEFGSCVGYS  68

Query  157  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT--  330
            +PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKG          T  
Sbjct  69   APTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGHISDLTGRKGAMRTSACFCITGW  128

Query  331  ----LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  498
                  K AL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRGALTTLNQLMIV G SV
Sbjct  129  LAVFFSKSALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGALTTLNQLMIVIGSSV  188

Query  499  AFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +F+IG++++W+ LALTG+ PC+VL  GLC I
Sbjct  189  SFLIGSLISWKILALTGLAPCIVLLFGLCFI  219



>ref|XP_007035424.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY06350.1| Major facilitator superfamily protein [Theobroma cacao]
Length=479

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 141/196 (72%), Gaps = 11/196 (6%)
 Frame = +1

Query  37   MAAPLIGKED-----DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSI  201
            +  PLI +E      D     WMV + TFVAVCGS  FGSC GYS+PTQSAI +DLN S+
Sbjct  20   LEKPLIVEEQTVVGSDESGSIWMVLICTFVAVCGSFEFGSCVGYSAPTQSAIREDLNLSL  79

Query  202  AEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIG  363
            AE+S+FGSILT GAM GA+TSG IAD +GRKG          T        KGAL +DIG
Sbjct  80   AEFSMFGSILTIGAMLGAVTSGRIADLIGRKGAMRLSAAFCSTGWLAVYFSKGALSLDIG  139

Query  364  RLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLAL  543
            R +TGYG+GVFSYVVP+FIAEIAPK LRG L TLNQLMIVTG SVAF+IGT++ WR LAL
Sbjct  140  RFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLATLNQLMIVTGSSVAFLIGTIIPWRALAL  199

Query  544  TGIXPCVVLGLGLCII  591
            TG+ PC+ L +GLC I
Sbjct  200  TGLVPCIFLLVGLCFI  215



>ref|XP_010454136.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Camelina 
sativa]
 ref|XP_010454137.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Camelina 
sativa]
Length=482

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 144/206 (70%), Gaps = 11/206 (5%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+       +  P +  +DD K         MV  STFVAVCGS  FGSC GYS+PTQS
Sbjct  11   RGDIANKVEDLGKPFLTDQDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSAPTQS  70

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            +I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKG          T       
Sbjct  71   SIRQDLNLSLAEFSMFGSILTIGAMIGAVMSGKISDFSGRKGAMRTSACFCITGWLAVFF  130

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F+IG
Sbjct  131  SKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVSFLIG  190

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            ++++W+TLALTGI PC+VL +GLC I
Sbjct  191  SLISWKTLALTGIAPCIVLLVGLCFI  216



>ref|XP_010070290.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
Length=481

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 143/206 (69%), Gaps = 11/206 (5%)
 Frame = +1

Query  7    NGENEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+ EG    +  P      GK++ +   R WMVY +TF+AVCGS  FG+CAGYSSPTQ 
Sbjct  12   TGDREGVRERLLVPQEKDRAGKDEGTDKVRPWMVYFTTFIAVCGSYEFGTCAGYSSPTQD  71

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            AI ++L  S AEYS+FGSILTFGAM GAIT GPIADFVGRK      +            
Sbjct  72   AIVEELGLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASALCVAGWLAIYF  131

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             +G L +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLMIV GVSV+F+IG
Sbjct  132  AEGELALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLMIVAGVSVSFIIG  191

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            T++ WR LAL G+ PC VL  GL  I
Sbjct  192  TVLAWRVLALIGLIPCAVLLFGLFFI  217



>ref|XP_002320384.1| sugar transporter family protein [Populus trichocarpa]
 gb|EEE98699.1| sugar transporter family protein [Populus trichocarpa]
Length=436

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 135/174 (78%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MVYLSTFVAV GS   GSC+GYSSPTQ+AI +DL+ SIAEYSLFGSILT GAM GAITSG
Sbjct  1    MVYLSTFVAVAGSFEVGSCSGYSSPTQNAIREDLSLSIAEYSLFGSILTVGAMIGAITSG  60

Query  268  PIADFVGRKGQEN------AEN*TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
            PIAD++GRKG         A         KGAL +DIGRLATGYGMG  S+VVPVFIAEI
Sbjct  61   PIADYIGRKGAMRFSSTSCAAGWLAIYFAKGALALDIGRLATGYGMGALSFVVPVFIAEI  120

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG LT + QLM+ TGVSVAF+IGT++ WR LALTG+ PCV+L +GL +I
Sbjct  121  APKNLRGTLTAVTQLMVATGVSVAFIIGTVLRWRVLALTGLIPCVILHVGLFLI  174



>ref|XP_010070313.1| PREDICTED: sugar transporter ERD6-like 7 [Eucalyptus grandis]
 gb|KCW58972.1| hypothetical protein EUGRSUZ_H01602 [Eucalyptus grandis]
Length=479

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 136/185 (74%), Gaps = 9/185 (5%)
 Frame = +1

Query  64   DDSKTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILT  234
             D  TD+   WMVY STFVAVCGS  FG+CAGYSSPTQ AI ++L+ S AEYS+FGSILT
Sbjct  32   QDEGTDKGHPWMVYFSTFVAVCGSYEFGTCAGYSSPTQDAIVEELSLSTAEYSVFGSILT  91

Query  235  FGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVF  396
            FGAM GAIT GPIADFVGRK      +             +GAL +DIGRLATGYGMGVF
Sbjct  92   FGAMIGAITGGPIADFVGRKWTMRMASAFCVAGWLAIYFAEGALALDIGRLATGYGMGVF  151

Query  397  SYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGL  576
            SYVVP+FIAEI PK LRGALT +NQLMI  GVS++F+IG +++WR LAL G+ PC VL  
Sbjct  152  SYVVPIFIAEITPKNLRGALTAVNQLMICAGVSISFIIGIILSWRVLALIGLIPCAVLLF  211

Query  577  GLCII  591
            GL  I
Sbjct  212  GLLFI  216



>ref|XP_007200994.1| hypothetical protein PRUPE_ppa005144mg [Prunus persica]
 gb|EMJ02193.1| hypothetical protein PRUPE_ppa005144mg [Prunus persica]
Length=475

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 135/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  79   DRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAI  258
            ++WMVYLSTFVAVCGS  FG C GYSSPTQSAI +DL+ ++AEYS+FGSI+TFGAM GAI
Sbjct  36   NQWMVYLSTFVAVCGSYEFGCCIGYSSPTQSAIREDLSLTLAEYSVFGSIVTFGAMIGAI  95

Query  259  TSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFI  420
            T GPI+DF+GRKG                   KGAL +DIGRLATGYGMG FSYVVPVFI
Sbjct  96   TIGPISDFLGRKGALRVSCAFCVAGWLAIYFSKGALSLDIGRLATGYGMGAFSYVVPVFI  155

Query  421  AEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            AEIAPK LRG LT +NQLMI++GVS++F+IG +V+WR LAL G+ PC V   GL  I
Sbjct  156  AEIAPKNLRGRLTAINQLMIISGVSISFIIGVLVSWRALALIGLVPCAVTIFGLFFI  212



>gb|AAM64736.1| sugar transporter-like protein [Arabidopsis thaliana]
Length=482

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 142/206 (69%), Gaps = 11/206 (5%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             GE       +  P +  EDD K         MV  STFVAVCGS  FGSC GYS+PTQS
Sbjct  11   RGEIVNKVEDLGKPFLTHEDDEKESENNESYLMVLFSTFVAVCGSFEFGSCVGYSAPTQS  70

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            +I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKG          T       
Sbjct  71   SIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCITGWLAVFF  130

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F+IG
Sbjct  131  TKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSVSFLIG  190

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            ++++W+TLALT + PC+VL  GLC I
Sbjct  191  SLISWKTLALTVLAPCIVLLFGLCFI  216



>ref|XP_010107672.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC16583.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=448

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 136/194 (70%), Gaps = 12/194 (6%)
 Frame = +1

Query  46   PLIGKEDDS------KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAE  207
            PL+  ED S      K + WMVYLSTFVAVCGS  FG+CAGYSSPTQSAI +DLN S+A+
Sbjct  14   PLMAVEDGSSAHEYSKDNPWMVYLSTFVAVCGSYEFGTCAGYSSPTQSAIREDLNLSLAD  73

Query  208  YSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRL  369
            YSLFGSILTFGAM GAITSG IAD +GRKG          T        K AL +DIGRL
Sbjct  74   YSLFGSILTFGAMIGAITSGTIADLIGRKGAMRVYTAFCVTGWLSIYFAKEALALDIGRL  133

Query  370  ATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTG  549
            ATGYGMG FSYVVPVFIAEIAPK LRG LT   + M   GVSV+F+IG ++TWR LAL  
Sbjct  134  ATGYGMGAFSYVVPVFIAEIAPKNLRGLLTASTEFMNCAGVSVSFIIGNVLTWRALALVA  193

Query  550  IXPCVVLGLGLCII  591
            + PC VL  GL  I
Sbjct  194  LIPCAVLLFGLSFI  207



>ref|XP_008458507.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
 ref|XP_008458508.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
 ref|XP_008458509.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
Length=494

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 146/210 (70%), Gaps = 15/210 (7%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKED---------DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSS  159
            NGEN G  A   + L+   D          S++  WMV + T VAVCGS  FGSC GYS+
Sbjct  12   NGENNGLQALEESLLVSSSDCEGCEKAVKKSESSLWMVLICTLVAVCGSFEFGSCVGYSA  71

Query  160  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT---  330
            PTQS I ++L+ S+ +YS+FGSILT GAM GA+TSGPIADF+GRKG          T   
Sbjct  72   PTQSVIREELHLSLPQYSMFGSILTIGAMVGAVTSGPIADFIGRKGAMRVSATFCITGWL  131

Query  331  ---LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  501
               L  GAL +D GR+ TGYG+GVFSYVVPVFIAEIAPK LRG LTTLNQLMIVTG S++
Sbjct  132  AVYLSTGALSLDSGRVLTGYGIGVFSYVVPVFIAEIAPKNLRGGLTTLNQLMIVTGASIS  191

Query  502  FVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            F++GT++TWR LALTGI PCV L +GL  +
Sbjct  192  FLLGTVITWRNLALTGIIPCVFLIVGLWFV  221



>ref|XP_010420663.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Camelina 
sativa]
Length=482

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 143/206 (69%), Gaps = 11/206 (5%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+       +  P +  +DD K         MV  STFVAVCGS  FGSC GYS+PTQS
Sbjct  11   RGDIANKVEDLGKPFLTDQDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSAPTQS  70

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            +I QDLN S+AE+S+FGSILT GAM GA+ SG ++DF GRKG          T       
Sbjct  71   SIRQDLNLSLAEFSMFGSILTIGAMIGAVMSGKVSDFSGRKGAMRTSACFCITGWVAVFF  130

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F+IG
Sbjct  131  SKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVSFLIG  190

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            ++++W+TLALTG+ PC+VL  GLC I
Sbjct  191  SLISWKTLALTGLAPCIVLLFGLCFI  216



>ref|XP_008234934.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234935.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234936.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234938.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234939.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234940.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=475

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  79   DRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAI  258
            ++WMVYLSTFVAVCGS  FG C GYSSPTQSAI +DL+ ++AEYS+FGSI+TFGAM GAI
Sbjct  36   NQWMVYLSTFVAVCGSYEFGCCIGYSSPTQSAIREDLSLTLAEYSVFGSIVTFGAMIGAI  95

Query  259  TSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFI  420
            T GPI DF+GRKG                   KGAL +DIGRLATGYGMG FSYVVPVFI
Sbjct  96   TIGPITDFLGRKGALRVSCAFCVAGWLAIYFSKGALSLDIGRLATGYGMGAFSYVVPVFI  155

Query  421  AEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            AEIAPK LRG LT +NQLMI++GVS++F+IG +V+WR LAL G+ PC V   GL  I
Sbjct  156  AEIAPKNLRGRLTAINQLMIISGVSISFIIGVLVSWRALALIGLVPCAVTIFGLFFI  212



>ref|XP_010492922.1| PREDICTED: sugar transporter ERD6-like 16 [Camelina sativa]
Length=482

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 144/206 (70%), Gaps = 11/206 (5%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+   +   +  P +   DD K         MV  STFVAVCGS  FGSC GYS+PTQ+
Sbjct  11   RGDIANNVEDLGKPFLTDRDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSAPTQA  70

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            +I QDLN SIAE+S+FGSILT GAM GA+ SG I+DF GRKG          T       
Sbjct  71   SIRQDLNLSIAEFSMFGSILTIGAMIGAVMSGKISDFSGRKGAMRTSACFCITGWLAVFF  130

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F+IG
Sbjct  131  SKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVSFLIG  190

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            ++++W+TLALTG+ PC+VL +GLC I
Sbjct  191  SLISWKTLALTGLAPCIVLLVGLCFI  216



>ref|XP_002315546.2| hypothetical protein POPTR_0010s02740g [Populus trichocarpa]
 gb|EEF01717.2| hypothetical protein POPTR_0010s02740g [Populus trichocarpa]
Length=488

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 146/205 (71%), Gaps = 20/205 (10%)
 Frame = +1

Query  37   MAAPLIGKE------DDSKTDR--------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  174
            +  PLI +E      D+++TD+         MV L TFVAVCGS  FGSC GYS+PTQSA
Sbjct  20   LEKPLIFEEKIVVINDNNETDQDQESTGSIGMVLLCTFVAVCGSFEFGSCVGYSAPTQSA  79

Query  175  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LL  336
            I +DLN SIAEYS+FGSILT GAM GAITSG IADF+GRKG          T        
Sbjct  80   IREDLNLSIAEYSMFGSILTIGAMLGAITSGRIADFIGRKGAMRMSACFCITGWLAVFFS  139

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
            +G   +D+GR+ TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG S AF+IG+
Sbjct  140  RGPFSLDVGRILTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSTAFLIGS  199

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
            ++TWR LALTG+ PC+ L +GLC +
Sbjct  200  VITWRGLALTGLVPCIFLLVGLCFV  224



>ref|XP_004290697.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458634.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458635.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = +1

Query  73   KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAG  252
            K D+WMVYLSTFVAVCGS  FG C GYSSPTQSAI++DL+ + +EYS+FGSILTFGAM G
Sbjct  33   KEDQWMVYLSTFVAVCGSYEFGCCVGYSSPTQSAITEDLSLTTSEYSVFGSILTFGAMIG  92

Query  253  AITSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDIGRLATGYGMGVFSYVVPV  414
            AIT GPI D VGRKG                   +GA  +DIGRLATGYGMG FSYVVPV
Sbjct  93   AITIGPITDLVGRKGALRMSCAFCVVGWLAIYFAEGAWALDIGRLATGYGMGAFSYVVPV  152

Query  415  FIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            F++EIAPK LRG LT LNQLMIV+GVSV+F+IG +V+WR LAL G+ PC V   GL  I
Sbjct  153  FVSEIAPKHLRGRLTALNQLMIVSGVSVSFIIGLVVSWRALALIGLIPCAVTLFGLFFI  211



>ref|XP_010279404.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nelumbo 
nucifera]
Length=462

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 145/210 (69%), Gaps = 18/210 (9%)
 Frame = +1

Query  16   NEGSTAGMAAPLIG-------KEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  159
             +G    +  PLI        KED S  +       MV LSTFVAVCGS  FGSC GYS+
Sbjct  6    EKGEKEELIQPLIEQQNIVACKEDGSHKNENRGTIGMVLLSTFVAVCGSFEFGSCVGYSA  65

Query  160  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT---  330
            PTQSAI  DL+ SI+EYSLFGS+LT GAMAGA+TSG IADF+GRK           T   
Sbjct  66   PTQSAIRNDLHLSISEYSLFGSVLTIGAMAGAVTSGRIADFIGRKEAMRMSATFCITGWL  125

Query  331  ---LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  501
                 KGAL +D GR+ TGYG+GVFSYVVPV+IAEI PK LRG LTT+NQLMIVTG SVA
Sbjct  126  AVYFSKGALPLDTGRVFTGYGIGVFSYVVPVYIAEITPKNLRGGLTTVNQLMIVTGSSVA  185

Query  502  FVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            F+IGT+VTWRTLALTG+ PC+ L LGL  I
Sbjct  186  FLIGTIVTWRTLALTGLIPCIFLLLGLFFI  215



>ref|XP_002871845.1| hypothetical protein ARALYDRAFT_488771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48104.1| hypothetical protein ARALYDRAFT_488771 [Arabidopsis lyrata subsp. 
lyrata]
Length=483

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 141/197 (72%), Gaps = 11/197 (6%)
 Frame = +1

Query  34   GMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            G+  P +  +DD K         MV  STFVAVCGS  FGSC GYS+PTQS+I QDLN S
Sbjct  21   GLGKPFLTHQDDEKESENNESYLMVLFSTFVAVCGSFEFGSCVGYSAPTQSSIRQDLNLS  80

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDI  360
            +AE+S+FGSILT GAM GA+ SG I+DF GRKG          T        KGAL++D+
Sbjct  81   LAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCITGWLAVFFSKGALLLDV  140

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR  TG+G+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F+IG++++W+ LA
Sbjct  141  GRFFTGFGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSVSFLIGSLISWKALA  200

Query  541  LTGIXPCVVLGLGLCII  591
            LTG+ PC+VL  GLC I
Sbjct  201  LTGLAPCIVLFFGLCFI  217



>gb|KGN46180.1| hypothetical protein Csa_6G067380 [Cucumis sativus]
Length=458

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 147/211 (70%), Gaps = 16/211 (8%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDD----------SKTDRWMVYLSTFVAVCGSCAFGSCAGYS  156
            NG++ G  A   + L+    D          S++  WMV++ T VAVCGS  FGSC GYS
Sbjct  11   NGDSNGLQALEESLLVSHSSDCEGCEKAVKRSESSLWMVFICTLVAVCGSFEFGSCVGYS  70

Query  157  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT--  330
            +PTQS I ++L+ S+ +YS+FGSILT GAM GA+TSGPIADF+GRKG          T  
Sbjct  71   APTQSVIREELHLSLPQYSMFGSILTIGAMVGAVTSGPIADFIGRKGAMRVSATFCITGW  130

Query  331  ----LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  498
                L  GAL +D GR+ TGYG+GVFSYVVPVFIAEIAPK LRG LTTLNQLMIVTG S+
Sbjct  131  LAVYLSTGALSLDSGRVLTGYGIGVFSYVVPVFIAEIAPKNLRGGLTTLNQLMIVTGASI  190

Query  499  AFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +F++GT++TWR LALTGI PCV L +GL  +
Sbjct  191  SFLLGTVITWRNLALTGIIPCVFLIVGLWFV  221



>ref|XP_010279395.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 145/210 (69%), Gaps = 18/210 (9%)
 Frame = +1

Query  16   NEGSTAGMAAPLIG-------KEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  159
             +G    +  PLI        KED S  +       MV LSTFVAVCGS  FGSC GYS+
Sbjct  6    EKGEKEELIQPLIEQQNIVACKEDGSHKNENRGTIGMVLLSTFVAVCGSFEFGSCVGYSA  65

Query  160  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT---  330
            PTQSAI  DL+ SI+EYSLFGS+LT GAMAGA+TSG IADF+GRK           T   
Sbjct  66   PTQSAIRNDLHLSISEYSLFGSVLTIGAMAGAVTSGRIADFIGRKEAMRMSATFCITGWL  125

Query  331  ---LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  501
                 KGAL +D GR+ TGYG+GVFSYVVPV+IAEI PK LRG LTT+NQLMIVTG SVA
Sbjct  126  AVYFSKGALPLDTGRVFTGYGIGVFSYVVPVYIAEITPKNLRGGLTTVNQLMIVTGSSVA  185

Query  502  FVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            F+IGT+VTWRTLALTG+ PC+ L LGL  I
Sbjct  186  FLIGTIVTWRTLALTGLIPCIFLLLGLFFI  215



>ref|XP_006287631.1| hypothetical protein CARUB_v10000842mg [Capsella rubella]
 gb|EOA20529.1| hypothetical protein CARUB_v10000842mg [Capsella rubella]
Length=483

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 144/209 (69%), Gaps = 16/209 (8%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSPTQ  168
             G+       +  PL+    D K          MV+ STFVAVCGS  FGSC GYS+PTQ
Sbjct  11   KGDTANKVKDLGKPLLTDRYDEKESEVNDESYLMVFFSTFVAVCGSFEFGSCVGYSAPTQ  70

Query  169  SAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL----  336
            S+I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKG         F ++    
Sbjct  71   SSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTS--ACFCIIGWLA  128

Query  337  ----KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  504
                KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F
Sbjct  129  VFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSVSF  188

Query  505  VIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +IG++++W+TLALTG+ PC+ L  GLC I
Sbjct  189  LIGSLISWKTLALTGLAPCIALLFGLCFI  217



>ref|XP_004145042.1| PREDICTED: sugar transporter ERD6-like 16-like [Cucumis sativus]
Length=497

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 147/211 (70%), Gaps = 16/211 (8%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDD----------SKTDRWMVYLSTFVAVCGSCAFGSCAGYS  156
            NG++ G  A   + L+    D          S++  WMV++ T VAVCGS  FGSC GYS
Sbjct  11   NGDSNGLQALEESLLVSHSSDCEGCEKAVKRSESSLWMVFICTLVAVCGSFEFGSCVGYS  70

Query  157  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT--  330
            +PTQS I ++L+ S+ +YS+FGSILT GAM GA+TSGPIADF+GRKG          T  
Sbjct  71   APTQSVIREELHLSLPQYSMFGSILTIGAMVGAVTSGPIADFIGRKGAMRVSATFCITGW  130

Query  331  ----LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  498
                L  GAL +D GR+ TGYG+GVFSYVVPVFIAEIAPK LRG LTTLNQLMIVTG S+
Sbjct  131  LAVYLSTGALSLDSGRVLTGYGIGVFSYVVPVFIAEIAPKNLRGGLTTLNQLMIVTGASI  190

Query  499  AFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +F++GT++TWR LALTGI PCV L +GL  +
Sbjct  191  SFLLGTVITWRNLALTGIIPCVFLIVGLWFV  221



>gb|KCW58966.1| hypothetical protein EUGRSUZ_H01593 [Eucalyptus grandis]
Length=261

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 131/174 (75%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MVY + FVAVCGS  FG+CAGYSSPTQ AI ++L+ S AEYS+FGSILTFGAM GAIT G
Sbjct  1    MVYFTPFVAVCGSYEFGTCAGYSSPTQDAIVEELSLSTAEYSVFGSILTFGAMIGAITGG  60

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
            PIADFVGRK      +             +GAL +DIGRLATGYGMGVFSYVVP+FIAEI
Sbjct  61   PIADFVGRKWTMRIASALCVAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPIFIAEI  120

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             PK LRGALT +NQLMI+  VSV+F+IGT++ WR LAL G+ PCVVL  GL  I
Sbjct  121  TPKNLRGALTAVNQLMIIARVSVSFIIGTVLAWRVLALIGLIPCVVLLFGLFFI  174



>ref|XP_008386584.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=473

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 138/197 (70%), Gaps = 11/197 (6%)
 Frame = +1

Query  34   GMAAPLIGK-----EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            G+ APL+             + WMVYLSTFVA+CGS  FG CAGYSSPT+SAI +DL+ S
Sbjct  14   GVRAPLMANVAGSAGGSGGGNLWMVYLSTFVAICGSYEFGCCAGYSSPTESAIQEDLSLS  73

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDI  360
            ++EYS+FGSILTFGAM GAIT GPIADF+GRKG                   K A  +DI
Sbjct  74   LSEYSMFGSILTFGAMVGAITIGPIADFLGRKGALRVSCAFCVAGWLAIYFSKAAWSLDI  133

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GRL TGYGMG FSYVVP+F+AEIAPK LRG LT  NQLMIVTGVS +F+IG +V+WRTLA
Sbjct  134  GRLLTGYGMGAFSYVVPIFVAEIAPKNLRGRLTAANQLMIVTGVSASFIIGVLVSWRTLA  193

Query  541  LTGIXPCVVLGLGLCII  591
            L G+ PC V  LGL  I
Sbjct  194  LIGLIPCAVTLLGLFFI  210



>ref|XP_004153836.1| PREDICTED: sugar transporter ERD6-like 16-like [Cucumis sativus]
Length=494

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 147/211 (70%), Gaps = 16/211 (8%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDD----------SKTDRWMVYLSTFVAVCGSCAFGSCAGYS  156
            NG++ G  A   + L+    D          S++  WMV++ T VAVCGS  FGSC GYS
Sbjct  11   NGDSNGLQALEESLLVSHSSDCEGCEKAVKRSESSLWMVFICTLVAVCGSFEFGSCVGYS  70

Query  157  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT--  330
            +PTQS I ++L+ S+ +YS+FGSILT GAM GA+TSGPIADF+GRKG          T  
Sbjct  71   APTQSVIREELHLSLPQYSMFGSILTIGAMVGAVTSGPIADFIGRKGAMRVSATFCITGW  130

Query  331  ----LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  498
                L  GAL +D GR+ TGYG+GVFSYVVPVFIAEIAPK LRG LTTLNQLMIVTG S+
Sbjct  131  LAVYLSTGALSLDSGRVLTGYGIGVFSYVVPVFIAEIAPKNLRGGLTTLNQLMIVTGASI  190

Query  499  AFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +F++GT++TWR LALTGI PCV L +GL  +
Sbjct  191  SFLLGTVITWRNLALTGIIPCVFLIVGLWFV  221



>ref|XP_008368891.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=473

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 138/197 (70%), Gaps = 11/197 (6%)
 Frame = +1

Query  34   GMAAPLIGKEDDSK-----TDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            G+  PL+ + D+S       + WMVYLSTFVAVCG   FG C GYSSPTQSAI +DL+ S
Sbjct  14   GVRVPLMAEGDESAGGSXGXNLWMVYLSTFVAVCGXYEFGCCVGYSSPTQSAIREDLSLS  73

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDI  360
            ++EYS+FGSILT GAM GAIT GPI DF+GRKG                   KGA  +DI
Sbjct  74   LSEYSVFGSILTXGAMIGAITIGPITDFLGRKGALRVSCAFCVAGWLAIYFSKGAWSLDI  133

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GRL TGYGMG FSYVVP+FIAEIAPK LRG LT  NQLMIVTGVSV+F+IG +V+WRTLA
Sbjct  134  GRLLTGYGMGAFSYVVPIFIAEIAPKSLRGRLTAANQLMIVTGVSVSFIIGVVVSWRTLA  193

Query  541  LTGIXPCVVLGLGLCII  591
            L G+ PC V   GL  I
Sbjct  194  LIGLIPCAVTLFGLFFI  210



>ref|XP_006400439.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
 gb|ESQ41892.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
Length=393

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 143/211 (68%), Gaps = 16/211 (8%)
 Frame = +1

Query  7    NGENE---GSTAGMAAPLIGKEDDSKTDR-------WMVYLSTFVAVCGSCAFGSCAGYS  156
             GEN         +  PL+ K  D   ++        MV  STFVAVCGS  FGSC GYS
Sbjct  11   RGENREIVNKVEDLKNPLLKKVADHDGEKSEINESYLMVLFSTFVAVCGSFEFGSCVGYS  70

Query  157  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT--  330
            +PTQS+I  DLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKG          T  
Sbjct  71   APTQSSIRHDLNLSLAEFSMFGSILTIGAMLGAVMSGQISDLTGRKGAMRTSACFCITGW  130

Query  331  ----LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  498
                  KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV
Sbjct  131  LAVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSV  190

Query  499  AFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +F+IG++++W+TLALTG+ PC+VL  GLC I
Sbjct  191  SFMIGSLISWKTLALTGLAPCIVLLFGLCFI  221



>ref|XP_008386585.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=476

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 137/187 (73%), Gaps = 10/187 (5%)
 Frame = +1

Query  55   GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILT  234
            G++  S+ D+WMVYLSTFVAVCGS  FGSC GYSSPTQSAI +DL  ++AE+S+FGSILT
Sbjct  30   GEDGSSRGDQWMVYLSTFVAVCGSFEFGSCVGYSSPTQSAIREDLGLTLAEFSVFGSILT  89

Query  235  FGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMG  390
            FGAM GAIT GPI DF+GRKG         F ++        KG L +DIGRLA+GYGMG
Sbjct  90   FGAMIGAITIGPITDFLGRKGALRVS--CAFCVVGWLAIYFSKGVLSLDIGRLASGYGMG  147

Query  391  VFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVL  570
             FSYVVPVF+AEIAPK LRG LT +NQLMI  G  ++F+ G +V+WR LAL GI PC V 
Sbjct  148  AFSYVVPVFVAEIAPKHLRGRLTAVNQLMICIGGXMSFIFGVVVSWRDLALIGIVPCAVT  207

Query  571  GLGLCII  591
             LGL  I
Sbjct  208  ILGLFFI  214



>ref|XP_004290698.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=464

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 135/186 (73%), Gaps = 7/186 (4%)
 Frame = +1

Query  46   PLIGKEDDSKT-DRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFG  222
            PL+ +E  +    RWMVYLSTFVAVCGS  FG CAG+SSPTQ AI+ DL+ S+AEYS+FG
Sbjct  13   PLLNREGSAHEGHRWMVYLSTFVAVCGSYEFGCCAGFSSPTQDAITDDLSLSLAEYSMFG  72

Query  223  SILTFGAMAGAITSGPIADFVGRKGQENAEN------*TIFTLLKGALVMDIGRLATGYG  384
            SILTFGAM GAIT GPIADF+GRKG     +             +    +DIGRLA GYG
Sbjct  73   SILTFGAMIGAITIGPIADFIGRKGAMRVSSAFCVAGWLAIYFAESIWPLDIGRLANGYG  132

Query  385  MGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCV  564
            MG FSYVVPVFIAEIAPK LRG LT +NQLMI  GVSV+++IG +V+WR LAL G+ PC 
Sbjct  133  MGAFSYVVPVFIAEIAPKNLRGRLTAVNQLMICAGVSVSYIIGVVVSWRALALIGLIPCA  192

Query  565  VLGLGL  582
            V+  GL
Sbjct  193  VIISGL  198



>emb|CDX92578.1| BnaA10g16170D [Brassica napus]
Length=485

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 145/209 (69%), Gaps = 14/209 (7%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGK---EDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSP  162
             GE      G+  PL+ K   +DD +        +MV  STFVAVCGS  FGSC GYS+P
Sbjct  11   RGEIVSRVEGLGHPLLKKVADQDDVEESEINESYFMVLFSTFVAVCGSFEFGSCVGYSAP  70

Query  163  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT----  330
            TQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKG          T    
Sbjct  71   TQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGHISDLTGRKGAMRTSACFCITGWLA  130

Query  331  --LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  504
                K AL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRGALTTLNQLMIV G SV+F
Sbjct  131  VFFSKSALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGALTTLNQLMIVIGSSVSF  190

Query  505  VIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +IG++++W+ LALTG+ PC+VL  GLC I
Sbjct  191  LIGSLISWKILALTGLAPCIVLLFGLCFI  219



>gb|KCW58947.1| hypothetical protein EUGRSUZ_H01571 [Eucalyptus grandis]
Length=484

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 143/209 (68%), Gaps = 14/209 (7%)
 Frame = +1

Query  7    NGENEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+ EG    +  P      GK++ +   R WMVY +TF+AVCGS  FG+CAGYSSPTQ 
Sbjct  12   TGDREGVRERLLVPQEKDRAGKDEGTDKVRPWMVYFTTFIAVCGSYEFGTCAGYSSPTQD  71

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN------*TIFTL  333
            AI ++L  S AEYS+FGSILTFGAM GAIT GPIADFVGRK      +            
Sbjct  72   AIVEELGLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASALCVAGWLAIYF  131

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             +G L +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLMIV GVSV+F+IG
Sbjct  132  AEGELALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLMIVAGVSVSFIIG  191

Query  514  TMVTWRTLAL---TGIXPCVVLGLGLCII  591
            T++ WR LAL    G+ PC VL  GL  I
Sbjct  192  TVLAWRVLALIVYAGLIPCAVLLFGLFFI  220



>ref|XP_009120937.1| PREDICTED: sugar transporter ERD6-like 16 [Brassica rapa]
Length=485

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 145/209 (69%), Gaps = 14/209 (7%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGK---EDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSP  162
             GE      G+  PL+ K   +DD +        +MV  STFVAVCGS  FGSC GYS+P
Sbjct  11   RGEIVSRVEGLGNPLLKKVADQDDVEESEINESYFMVLFSTFVAVCGSFEFGSCVGYSAP  70

Query  163  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT----  330
            TQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKG          T    
Sbjct  71   TQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGHISDLTGRKGAMRTSACFCITGWLA  130

Query  331  --LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  504
                K AL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRGALTTLNQLMIV G SV+F
Sbjct  131  VFFSKSALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGALTTLNQLMIVIGSSVSF  190

Query  505  VIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +IG++++W+ LALTG+ PC+VL  GLC I
Sbjct  191  LIGSLISWKILALTGLAPCIVLLFGLCFI  219



>ref|XP_010420662.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Camelina 
sativa]
Length=483

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 143/207 (69%), Gaps = 12/207 (6%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+       +  P +  +DD K         MV  STFVAVCGS  FGSC GYS+PTQS
Sbjct  11   RGDIANKVEDLGKPFLTDQDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSAPTQS  70

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            +I QDLN S+AE+S+FGSILT GAM GA+ SG ++DF GRKG          T       
Sbjct  71   SIRQDLNLSLAEFSMFGSILTIGAMIGAVMSGKVSDFSGRKGAMRTSACFCITGWVAVFF  130

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+F+IG
Sbjct  131  SKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVSFLIG  190

Query  514  TMVTWRTLALT-GIXPCVVLGLGLCII  591
            ++++W+TLALT G+ PC+VL  GLC I
Sbjct  191  SLISWKTLALTEGLAPCIVLLFGLCFI  217



>gb|KHN45387.1| Sugar transporter ERD6-like 7 [Glycine soja]
Length=437

 Score =   222 bits (566),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 131/174 (75%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MVY +TFVAVCGS  FG+CAGYSSPTQ AI +D + S+AEYSLFGSILTFGAM GAITSG
Sbjct  1    MVYFTTFVAVCGSYEFGACAGYSSPTQDAIRKDFSLSLAEYSLFGSILTFGAMVGAITSG  60

Query  268  PIADFVGRKGQENAEN------*TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
            PIADF+GRKG     +        +    +G + +DIGRL+TGYGMGVFSYVVPVF+AEI
Sbjct  61   PIADFIGRKGAMRVSSAFCVAGWLVIYFAEGPVYLDIGRLSTGYGMGVFSYVVPVFVAEI  120

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APKELRG LTTLNQ MI   VSV+F IG + +WR LA+ G+ P  VL LGL  I
Sbjct  121  APKELRGTLTTLNQFMITAAVSVSFTIGNVFSWRVLAIIGLIPTAVLLLGLFFI  174



>ref|XP_004292610.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=491

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 135/181 (75%), Gaps = 10/181 (6%)
 Frame = +1

Query  73   KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAG  252
            K D+ MVYLSTFVAVCGS  FG C GYSSPTQSAI++DLN S +EYSLFGSILTFGAM G
Sbjct  33   KEDQGMVYLSTFVAVCGSYEFGCCLGYSSPTQSAITEDLNLSTSEYSLFGSILTFGAMIG  92

Query  253  AITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVV  408
            AIT GPI DF+GRKG         F ++        +GA  +DIGRLATGYGMG FSYVV
Sbjct  93   AITIGPITDFIGRKGALRMS--CAFCVVGWLAIYFAEGAWALDIGRLATGYGMGAFSYVV  150

Query  409  PVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCI  588
            P+FI+EIAPK LRG LT L QLMIV+G+SV+F++G +V+WR LAL G+ PC V   GL  
Sbjct  151  PIFISEIAPKNLRGRLTALTQLMIVSGISVSFIVGLVVSWRALALIGLIPCAVTLFGLFF  210

Query  589  I  591
            I
Sbjct  211  I  211



>gb|KEH23691.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=457

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 150/203 (74%), Gaps = 13/203 (6%)
 Frame = +1

Query  22   GSTAGMAAPLIGKEDDS-------KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
            G   G+  PLIG++++            WMVY +TF+AVCGS  FG+CAGYSSPTQ AI 
Sbjct  12   GKQKGIREPLIGEQNNQLVHANKDHHHPWMVYFTTFIAVCGSYEFGACAGYSSPTQEAIR  71

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKG  342
            +DL+ S+AEYSLFGSILTFGAM GAITSGPIADFVGRKG     +        +    +G
Sbjct  72   KDLSLSLAEYSLFGSILTFGAMIGAITSGPIADFVGRKGAMRVSSAFCIAGWLVIYFSEG  131

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
             + +DIGRLATGYGMGVFS+VVPVF+AEIAPKELRGALTTLNQ MIVT VSV+F+IGT++
Sbjct  132  PVPLDIGRLATGYGMGVFSFVVPVFVAEIAPKELRGALTTLNQFMIVTAVSVSFIIGTVL  191

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
            +WR LA+ G+ P  VL LGL  I
Sbjct  192  SWRALAIIGLIPTAVLLLGLFFI  214



>ref|XP_010024483.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Eucalyptus 
grandis]
 gb|KCW60928.1| hypothetical protein EUGRSUZ_H03662 [Eucalyptus grandis]
Length=497

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 135/176 (77%), Gaps = 10/176 (6%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FGSC GYS+PTQSAI +DL  S+AEYS+FGSILT GAM GAITSG
Sbjct  51   MVLLSTSVAVCGSFEFGSCVGYSAPTQSAIREDLGLSLAEYSMFGSILTIGAMLGAITSG  110

Query  268  PIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIA  423
             IADF+GRKG        IF +          GA  +D+GR  TGYG+GVFSYVVP+FIA
Sbjct  111  RIADFIGRKGAMRMS--AIFCIAGWLAVYFSNGASCLDMGRFFTGYGIGVFSYVVPIFIA  168

Query  424  EIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            EIAPK LRG LTTLNQLMIV G SVAF+IGT+VTWRTLALTG+ PC+VL +GL +I
Sbjct  169  EIAPKHLRGGLTTLNQLMIVVGASVAFLIGTIVTWRTLALTGLVPCIVLFVGLFLI  224



>ref|XP_011011018.1| PREDICTED: sugar transporter ERD6-like 16 [Populus euphratica]
Length=488

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 142/205 (69%), Gaps = 20/205 (10%)
 Frame = +1

Query  37   MAAPLIGKE------DDSKTDR--------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  174
            +  PLI +E      DD +TD          MV L TFVAVCGS  FGSC GYS+PTQSA
Sbjct  20   LEKPLILEEKIVVINDDYETDHDQESTGSIGMVLLCTFVAVCGSFEFGSCVGYSAPTQSA  79

Query  175  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LL  336
            I +DL  SIAEYS+FGSILT GAM GAITSG IADF+GRKG          T        
Sbjct  80   IREDLTLSIAEYSMFGSILTIGAMFGAITSGRIADFIGRKGAMRLSACFCITGWLAVFFS  139

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
             G   +D+GR+ TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG S AF+IG+
Sbjct  140  GGPFSLDVGRILTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSTAFLIGS  199

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
            ++TWR LALTG+ PC+ L +GLC +
Sbjct  200  VITWRGLALTGLVPCIFLLVGLCFV  224



>gb|KEH23690.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=477

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 150/203 (74%), Gaps = 13/203 (6%)
 Frame = +1

Query  22   GSTAGMAAPLIGKEDDS-------KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
            G   G+  PLIG++++            WMVY +TF+AVCGS  FG+CAGYSSPTQ AI 
Sbjct  12   GKQKGIREPLIGEQNNQLVHANKDHHHPWMVYFTTFIAVCGSYEFGACAGYSSPTQEAIR  71

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*------TIFTLLKG  342
            +DL+ S+AEYSLFGSILTFGAM GAITSGPIADFVGRKG     +        +    +G
Sbjct  72   KDLSLSLAEYSLFGSILTFGAMIGAITSGPIADFVGRKGAMRVSSAFCIAGWLVIYFSEG  131

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
             + +DIGRLATGYGMGVFS+VVPVF+AEIAPKELRGALTTLNQ MIVT VSV+F+IGT++
Sbjct  132  PVPLDIGRLATGYGMGVFSFVVPVFVAEIAPKELRGALTTLNQFMIVTAVSVSFIIGTVL  191

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
            +WR LA+ G+ P  VL LGL  I
Sbjct  192  SWRALAIIGLIPTAVLLLGLFFI  214



>ref|XP_006400440.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
 gb|ESQ41893.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
Length=487

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 143/211 (68%), Gaps = 16/211 (8%)
 Frame = +1

Query  7    NGENE---GSTAGMAAPLIGKEDDSKTDR-------WMVYLSTFVAVCGSCAFGSCAGYS  156
             GEN         +  PL+ K  D   ++        MV  STFVAVCGS  FGSC GYS
Sbjct  11   RGENREIVNKVEDLKNPLLKKVADHDGEKSEINESYLMVLFSTFVAVCGSFEFGSCVGYS  70

Query  157  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT--  330
            +PTQS+I  DLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKG          T  
Sbjct  71   APTQSSIRHDLNLSLAEFSMFGSILTIGAMLGAVMSGQISDLTGRKGAMRTSACFCITGW  130

Query  331  ----LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  498
                  KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV
Sbjct  131  LAVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSV  190

Query  499  AFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +F+IG++++W+TLALTG+ PC+VL  GLC I
Sbjct  191  SFMIGSLISWKTLALTGLAPCIVLLFGLCFI  221



>ref|XP_008340870.1| PREDICTED: sugar transporter ERD6-like 16 [Malus domestica]
Length=496

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 148/212 (70%), Gaps = 21/212 (10%)
 Frame = +1

Query  19   EGSTAG---MAAPLIGKED--------DSKTDRW----MVYLSTFVAVCGSCAFGSCAGY  153
            EG+  G   +  PL+ K+D        D  +D+     MV +STFVAVCGS  FGSC GY
Sbjct  13   EGNNLGDLDLKQPLVIKKDKIFAHEDGDQGSDKSGSIGMVLVSTFVAVCGSFEFGSCVGY  72

Query  154  SSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT-  330
            S+PTQSAI +DLN S+A++S+FGSILT G M GA+TSG  ADF+GRKG          T 
Sbjct  73   SAPTQSAIREDLNLSLAQFSMFGSILTIGGMLGAVTSGRTADFLGRKGAMRMSASFCITG  132

Query  331  -----LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVS  495
                   KGAL +D+GR  TG+G+GVFSYVVP+FIAEI PK LRG LTTLNQLMIVTG S
Sbjct  133  WLAIYFSKGALSLDVGRFFTGFGIGVFSYVVPIFIAEIXPKNLRGGLTTLNQLMIVTGSS  192

Query  496  VAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            V+FVIGT+++W TLALTGI PC+ L +GLC +
Sbjct  193  VSFVIGTIISWETLALTGIIPCIFLLVGLCFV  224



>ref|XP_010546910.1| PREDICTED: sugar transporter ERD6-like 16 [Tarenaya hassleriana]
Length=494

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 148/213 (69%), Gaps = 16/213 (8%)
 Frame = +1

Query  1    IVNG-ENEGSTAGMAAPLIGKEDDSKTDRW---------MVYLSTFVAVCGSCAFGSCAG  150
            I NG E+      MAA  + ++D+S  +           MV LSTFVAVCGS  FGSC G
Sbjct  14   IANGAEDLEKPLMMAAKKVVEDDESSVEIEEEQRNGSVSMVLLSTFVAVCGSFEFGSCVG  73

Query  151  YSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT  330
            YS+PTQSAI QDL+ S+AE+S+FGS+LT GAM GA+TSG I+DF GRKG          T
Sbjct  74   YSAPTQSAIRQDLHLSLAEFSMFGSVLTIGAMLGAVTSGRISDFSGRKGAMRTSACFCIT  133

Query  331  ------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGV  492
                    K A+++DIGR  TGYG+GVFSY VPV+IAEI+PK LRG LTTLNQLMIV G 
Sbjct  134  GWLAVFFSKEAMLLDIGRFFTGYGIGVFSYAVPVYIAEISPKNLRGGLTTLNQLMIVIGS  193

Query  493  SVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            SV+FVIG ++TW+TLALTG+ PC+VL  GLC +
Sbjct  194  SVSFVIGALITWKTLALTGLVPCLVLLFGLCFV  226



>ref|XP_008386586.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=478

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 135/182 (74%), Gaps = 10/182 (5%)
 Frame = +1

Query  70   SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMA  249
            +K D+WMVYLSTFVAVCGS  FG   GYSSPTQS I +DL  S+AEYS+FGSILTFGAM 
Sbjct  36   AKGDQWMVYLSTFVAVCGSYEFGCGVGYSSPTQSGIMKDLGLSLAEYSMFGSILTFGAMI  95

Query  250  GAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYV  405
            GAIT GPI DF+GRKG        +F +         KGA+ +D+GR+ATGYG G FSY+
Sbjct  96   GAITIGPITDFLGRKGALRMS--CVFCVAGWLAIYFSKGAVSLDVGRVATGYGSGAFSYI  153

Query  406  VPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLC  585
            VPVF+AEIAPK LRG LT +NQLMIV+GVSV+F+IG +V WR LAL GI PC V+  GL 
Sbjct  154  VPVFVAEIAPKNLRGRLTAVNQLMIVSGVSVSFIIGVVVHWRALALIGIVPCAVIIFGLF  213

Query  586  II  591
             I
Sbjct  214  FI  215



>gb|KFK26120.1| hypothetical protein AALP_AA8G206400 [Arabis alpina]
Length=485

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 134/174 (77%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV  STFVAVCGS  FGSC GYS+PTQS+I QDL  S+AE+S+FGSILT GAM GA+ SG
Sbjct  46   MVLFSTFVAVCGSFEFGSCVGYSAPTQSSIRQDLQLSLAEFSMFGSILTIGAMLGAVMSG  105

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I+DF GRKG          T        KGAL++D+GR  TGYG+GVFSYVVPV+IAEI
Sbjct  106  KISDFSGRKGAMRTSACFCITGWLAVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEI  165

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +PK LRG LTTLNQLMIV G SV+F+IG++++W+TLALTG+ PC+VL LGLC I
Sbjct  166  SPKNLRGGLTTLNQLMIVIGSSVSFMIGSLISWKTLALTGLVPCIVLLLGLCFI  219



>ref|XP_008234933.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=475

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 138/199 (69%), Gaps = 13/199 (7%)
 Frame = +1

Query  34   GMAAPLIGKEDDSKT-------DRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            G+ APL+  E++          + WMVYLSTFVAVCGS  FG CAGYSSPTQSAI +DL+
Sbjct  14   GIRAPLMRVENNLADGGSSIGGNPWMVYLSTFVAVCGSYEFGCCAGYSSPTQSAIREDLS  73

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN------*TIFTLLKGALVM  354
             S+AEYS+FGSILTFGAM GAIT GPI D +GRKG     +             K A  +
Sbjct  74   LSLAEYSVFGSILTFGAMIGAITIGPITDLLGRKGALRVSSAFCVAGWLAIYFSKEAWSL  133

Query  355  DIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRT  534
            DIGRLA GYGMG FSYVVPVFIAEIAPK LRG LT +NQLMI  GVSV+F++G +V+WR 
Sbjct  134  DIGRLANGYGMGAFSYVVPVFIAEIAPKNLRGRLTAINQLMICCGVSVSFILGVLVSWRA  193

Query  535  LALTGIXPCVVLGLGLCII  591
            LAL G+ PC V   GL  I
Sbjct  194  LALIGLIPCAVNIFGLFFI  212



>ref|XP_010242562.1| PREDICTED: sugar transporter ERD6-like 7 [Nelumbo nucifera]
Length=497

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 146/216 (68%), Gaps = 32/216 (15%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGK---------------EDDSKT----DR---WMVYLSTFVAV  117
            V   N+  +  +A PLIG+               ED+SK     DR   WMV LSTF+AV
Sbjct  10   VGQSNDDRSDEIAEPLIGRQHKTTPPTTEEDQDQEDESKRKSYDDRGSLWMVLLSTFIAV  69

Query  118  CGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKG  297
             GS  FGSC GYS+PTQS I+ DL  S+AEYS+FGSI   GAM GA+TSG +ADF+GRKG
Sbjct  70   AGSFEFGSCVGYSAPTQSEITDDLGLSLAEYSVFGSIGNIGAMVGAVTSGRVADFIGRKG  129

Query  298  QENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGA  453
                   ++F +         KGA+ +DIGR+ TGYGMGVFSYVVPVFIAEIAPK LRGA
Sbjct  130  AMRVS--SVFCIAGWLAVYFSKGAVSLDIGRVCTGYGMGVFSYVVPVFIAEIAPKNLRGA  187

Query  454  LTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPC  561
            L T+NQLMIV GVSV F+IGT+V+WRTLAL GI PC
Sbjct  188  LATMNQLMIVGGVSVTFIIGTLVSWRTLALIGIIPC  223



>ref|XP_004296777.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   221 bits (563),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 135/174 (78%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FGSC GYS+PTQSAI +DL  S+A++S+FGSILT GAM GAITSG
Sbjct  45   MVLLSTGVAVCGSFEFGSCVGYSAPTQSAIREDLYLSLAQFSMFGSILTIGAMLGAITSG  104

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             IADF+GRKG          T        +GAL +DIGR  TGYG+GVFSYVVP+FIAEI
Sbjct  105  RIADFLGRKGAMRMSATFCITGWLAIYFSEGALSLDIGRFLTGYGIGVFSYVVPIFIAEI  164

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG LTTLNQLMIVTG SV+FVIGT+++WRTLA+TGI PC+VL +GL  +
Sbjct  165  APKNLRGGLTTLNQLMIVTGASVSFVIGTIISWRTLAMTGILPCIVLLVGLWFV  218



>ref|XP_010649814.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Vitis vinifera]
Length=474

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 137/183 (75%), Gaps = 6/183 (3%)
 Frame = +1

Query  61   EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  240
            ++ S    WMV LSTFVAVCGS  FGSC GYS+PTQSAI +DL+ S+AEYS+FGSILT G
Sbjct  46   QNGSDGSIWMVLLSTFVAVCGSFEFGSCVGYSAPTQSAIREDLDLSLAEYSMFGSILTIG  105

Query  241  AMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSY  402
            AM GAITSG + D +GRKG          T         GAL++D+GR  TGYG+G+FSY
Sbjct  106  AMLGAITSGLVTDSLGRKGAMRMSASFCITGWLAVYFSMGALLLDMGRFFTGYGIGIFSY  165

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            VVP+FIAEIAPK +RG LTTLNQLMIV G SVAF++GT+ TWRTLALTG+ PC+VL +GL
Sbjct  166  VVPIFIAEIAPKSIRGGLTTLNQLMIVCGSSVAFLLGTVTTWRTLALTGLVPCLVLLIGL  225

Query  583  CII  591
              +
Sbjct  226  FFV  228



>ref|XP_002278197.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Vitis vinifera]
Length=492

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 137/183 (75%), Gaps = 6/183 (3%)
 Frame = +1

Query  61   EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  240
            ++ S    WMV LSTFVAVCGS  FGSC GYS+PTQSAI +DL+ S+AEYS+FGSILT G
Sbjct  46   QNGSDGSIWMVLLSTFVAVCGSFEFGSCVGYSAPTQSAIREDLDLSLAEYSMFGSILTIG  105

Query  241  AMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSY  402
            AM GAITSG + D +GRKG          T         GAL++D+GR  TGYG+G+FSY
Sbjct  106  AMLGAITSGLVTDSLGRKGAMRMSASFCITGWLAVYFSMGALLLDMGRFFTGYGIGIFSY  165

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            VVP+FIAEIAPK +RG LTTLNQLMIV G SVAF++GT+ TWRTLALTG+ PC+VL +GL
Sbjct  166  VVPIFIAEIAPKSIRGGLTTLNQLMIVCGSSVAFLLGTVTTWRTLALTGLVPCLVLLIGL  225

Query  583  CII  591
              +
Sbjct  226  FFV  228



>ref|XP_004134178.1| PREDICTED: sugar transporter ERD6-like 16-like [Cucumis sativus]
 gb|KGN57056.1| hypothetical protein Csa_3G150850 [Cucumis sativus]
Length=482

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 142/190 (75%), Gaps = 13/190 (7%)
 Frame = +1

Query  55   GKEDD---SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGS  225
            G E+D   S+    M+YLSTFVAVCGS  FGSC GYS+P ++AI +DLN S+++YS+FGS
Sbjct  30   GLEEDEVCSRRSNDMLYLSTFVAVCGSFQFGSCVGYSAPAEAAIREDLNLSLSQYSMFGS  89

Query  226  ILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGY  381
            ILT GAM GAI+SG IAD++GRKG         F +L        K  +++DIGRL TGY
Sbjct  90   ILTIGAMFGAISSGRIADYIGRKGAMRMS--ACFCILGWVAIYLSKEPILLDIGRLLTGY  147

Query  382  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPC  561
            G+GVFSYVVP+FIAE+APK LRG LTTLNQL+IV G SVAF++GT+VTWRTLALTG+ PC
Sbjct  148  GIGVFSYVVPIFIAELAPKNLRGGLTTLNQLLIVMGASVAFILGTIVTWRTLALTGLIPC  207

Query  562  VVLGLGLCII  591
              L +GL  +
Sbjct  208  FTLLVGLFFV  217



>ref|XP_006419727.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 ref|XP_006419728.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 gb|ESR32967.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 gb|ESR32968.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
Length=399

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 10/188 (5%)
 Frame = +1

Query  58   KEDDSKTDRW----MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGS  225
             EDD + +      MV LSTFVAVC S  FGSC GYS+PTQSA+  DL+ S+AE+S FGS
Sbjct  38   DEDDDQENNGGSVGMVLLSTFVAVCASFEFGSCVGYSAPTQSAVRDDLHLSLAEFSTFGS  97

Query  226  ILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGM  387
            ILT GAM GAITSG IAD VGRKG          T         G+L++DIGR  TGYG+
Sbjct  98   ILTIGAMLGAITSGRIADIVGRKGAMRISACFCITGWLAVYFSNGSLLLDIGRFFTGYGI  157

Query  388  GVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVV  567
            GVFSYVVP+FIAEIAP+ LRG LTTLNQL+IVTG SVA++IG+++ WR LALTG+ PCV+
Sbjct  158  GVFSYVVPIFIAEIAPRNLRGLLTTLNQLLIVTGSSVAYIIGSIIPWRILALTGLVPCVL  217

Query  568  LGLGLCII  591
            L +GLC +
Sbjct  218  LLVGLCFV  225



>ref|XP_004171627.1| PREDICTED: sugar transporter ERD6-like 16-like [Cucumis sativus]
Length=517

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 142/190 (75%), Gaps = 13/190 (7%)
 Frame = +1

Query  55   GKEDD---SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGS  225
            G E+D   S+    M+YLSTFVAVCGS  FGSC GYS+P ++AI +DLN S+++YS+FGS
Sbjct  30   GLEEDEVCSRRSNDMLYLSTFVAVCGSFQFGSCVGYSAPAEAAIREDLNLSLSQYSMFGS  89

Query  226  ILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGY  381
            ILT GAM GAI+SG IAD++GRKG         F +L        K  +++DIGRL TGY
Sbjct  90   ILTIGAMFGAISSGRIADYIGRKGAMRMS--ACFCILGWVAIYLSKEPILLDIGRLLTGY  147

Query  382  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPC  561
            G+GVFSYVVP+FIAE+APK LRG LTTLNQL+IV G SVAF++GT+VTWRTLALTG+ PC
Sbjct  148  GIGVFSYVVPIFIAELAPKNLRGGLTTLNQLLIVMGASVAFILGTIVTWRTLALTGLIPC  207

Query  562  VVLGLGLCII  591
              L +GL  +
Sbjct  208  FTLLVGLFFV  217



>emb|CAN63855.1| hypothetical protein VITISV_008852 [Vitis vinifera]
Length=561

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 137/183 (75%), Gaps = 6/183 (3%)
 Frame = +1

Query  61   EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  240
            ++ S    WMV LSTFVAVCGS  FGSC GYS+PTQSAI +DL+ S+AEYS+FGSILT G
Sbjct  46   QNGSDGSIWMVLLSTFVAVCGSFEFGSCVGYSAPTQSAIREDLDLSLAEYSMFGSILTIG  105

Query  241  AMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSY  402
            AM GAITSG + D +GRKG          T         GAL++D+GR  TGYG+G+FSY
Sbjct  106  AMLGAITSGLVTDSLGRKGAMRMSASFCITGWLAVYFSMGALLLDMGRFFTGYGIGIFSY  165

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            VVP+FIAEIAPK +RG LTTLNQLMIV G SVAF++GT+ TWRTLALTG+ PC+VL +GL
Sbjct  166  VVPIFIAEIAPKSIRGGLTTLNQLMIVCGSSVAFLLGTVTTWRTLALTGLVPCLVLLIGL  225

Query  583  CII  591
              +
Sbjct  226  FFV  228



>emb|CDO98940.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 141/189 (75%), Gaps = 13/189 (7%)
 Frame = +1

Query  40   AAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  219
            ++P   KE+ S     MV LST VAVCGS  FGSC GYS+PTQSAI +DLN S+AE+S+F
Sbjct  38   SSPEADKENGSIA---MVLLSTCVAVCGSFEFGSCVGYSAPTQSAIREDLNLSLAEFSMF  94

Query  220  GSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLAT  375
            GSILT GAM G ITSG IADFVGRKG        +F ++         GAL++D GR  T
Sbjct  95   GSILTIGAMIGGITSGRIADFVGRKGAMRIS--AVFCVIGWLAVYFSTGALILDFGRFCT  152

Query  376  GYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIX  555
            GYG+G+FSY VPVFIAEIAPK LRG L T+NQLMIV+G SVA+++GT+V+W+TLALTGI 
Sbjct  153  GYGIGIFSYAVPVFIAEIAPKNLRGGLATINQLMIVSGSSVAYLLGTVVSWQTLALTGIL  212

Query  556  PCVVLGLGL  582
            PC+VL +GL
Sbjct  213  PCIVLFVGL  221



>ref|XP_006419729.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 ref|XP_006489198.1| PREDICTED: sugar transporter ERD6-like 16-like [Citrus sinensis]
 gb|ESR32969.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
Length=490

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 137/187 (73%), Gaps = 10/187 (5%)
 Frame = +1

Query  61   EDDSKTDRW----MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSI  228
            EDD + +      MV LSTFVAVC S  FGSC GYS+PTQSA+  DL+ S+AE+S FGSI
Sbjct  39   EDDDQENNGGSVGMVLLSTFVAVCASFEFGSCVGYSAPTQSAVRDDLHLSLAEFSTFGSI  98

Query  229  LTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMG  390
            LT GAM GAITSG IAD VGRKG          T         G+L++DIGR  TGYG+G
Sbjct  99   LTIGAMLGAITSGRIADIVGRKGAMRISACFCITGWLAVYFSNGSLLLDIGRFFTGYGIG  158

Query  391  VFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVL  570
            VFSYVVP+FIAEIAP+ LRG LTTLNQL+IVTG SVA++IG+++ WR LALTG+ PCV+L
Sbjct  159  VFSYVVPIFIAEIAPRNLRGLLTTLNQLLIVTGSSVAYIIGSIIPWRILALTGLVPCVLL  218

Query  571  GLGLCII  591
             +GLC +
Sbjct  219  LVGLCFV  225



>ref|XP_006356995.1| PREDICTED: sugar transporter ERD6-like 16-like [Solanum tuberosum]
 ref|XP_006358532.1| PREDICTED: sugar transporter ERD6-like 16-like [Solanum tuberosum]
Length=472

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  85   WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITS  264
            WMV LST VAVCGS  FGSC GYS+PTQS I  DLN ++A+YS+FGSI+T GAM GAITS
Sbjct  34   WMVLLSTCVAVCGSFEFGSCVGYSAPTQSEIRNDLNLTLAQYSMFGSIITIGAMIGAITS  93

Query  265  GPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFI  420
            G IADF+GRKG        IF +          G LV+D+GR  TGYG+G+FSYVVPV+I
Sbjct  94   GRIADFIGRKGAMRMS--AIFCITGWLAVYFSMGTLVLDMGRFLTGYGIGIFSYVVPVYI  151

Query  421  AEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            AEIAPK LRG LTT+NQLMIV G SVA+++GT++TWR LALTGI PC  L +GL  I
Sbjct  152  AEIAPKNLRGGLTTINQLMIVCGSSVAYLLGTVITWRNLALTGILPCTFLLVGLLFI  208



>emb|CBI26138.3| unnamed protein product [Vitis vinifera]
 gb|ADP37170.1| putative ERD6-like transporter [Vitis vinifera]
Length=438

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 133/174 (76%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LSTFVAVCGS  FGSC GYS+PTQSAI +DL+ S+AEYS+FGSILT GAM GAITSG
Sbjct  1    MVLLSTFVAVCGSFEFGSCVGYSAPTQSAIREDLDLSLAEYSMFGSILTIGAMLGAITSG  60

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             + D +GRKG          T         GAL++D+GR  TGYG+G+FSYVVP+FIAEI
Sbjct  61   LVTDSLGRKGAMRMSASFCITGWLAVYFSMGALLLDMGRFFTGYGIGIFSYVVPIFIAEI  120

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK +RG LTTLNQLMIV G SVAF++GT+ TWRTLALTG+ PC+VL +GL  +
Sbjct  121  APKSIRGGLTTLNQLMIVCGSSVAFLLGTVTTWRTLALTGLVPCLVLLIGLFFV  174



>ref|XP_009352178.1| PREDICTED: sugar transporter ERD6-like 16 [Pyrus x bretschneideri]
Length=496

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 147/212 (69%), Gaps = 21/212 (10%)
 Frame = +1

Query  19   EGSTAG---MAAPLIGKED--------DSKTDRW----MVYLSTFVAVCGSCAFGSCAGY  153
            EG+  G   +  PL+ K+D        D  +D+     MV +STFVAVCGS  FGSC GY
Sbjct  13   EGNNLGDLDLNQPLVIKKDKIFAHEDGDQGSDKSGSIGMVLVSTFVAVCGSFEFGSCVGY  72

Query  154  SSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT-  330
            S+PTQS I +DLN S+A++S+FGSILT G M GA+TSG  ADF+GRKG          T 
Sbjct  73   SAPTQSGIREDLNLSLAQFSMFGSILTIGGMLGAVTSGRTADFLGRKGAMRMSASFCITG  132

Query  331  -----LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVS  495
                   KGAL +D+GR  TG+G+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG S
Sbjct  133  WLAIYFSKGALSLDVGRFFTGFGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSS  192

Query  496  VAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            V+F+IGT+++W TLAL+ I PC+ L +GLC +
Sbjct  193  VSFMIGTIISWETLALSEIIPCIFLLVGLCFV  224



>ref|XP_004229493.1| PREDICTED: sugar transporter ERD6-like 16 [Solanum lycopersicum]
Length=468

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 131/177 (74%), Gaps = 10/177 (6%)
 Frame = +1

Query  85   WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITS  264
            WMV LST VAVCGS  FGSC GYS+PTQS I  DLN ++AEYS+FGSI+T GAM GA+TS
Sbjct  30   WMVLLSTCVAVCGSFEFGSCVGYSAPTQSQIRNDLNLTLAEYSMFGSIITIGAMIGAVTS  89

Query  265  GPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFI  420
            G IADF+GRKG        IF +          G LV+D+GR  TGYG+G+FSYVVPV+I
Sbjct  90   GRIADFIGRKGAMRMS--AIFCITGWLAVYFSMGTLVLDMGRFLTGYGIGIFSYVVPVYI  147

Query  421  AEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            AEIAPK LRG LTT+NQLMIV G S A+++GT++TWR LALTGI PC  L +GL  I
Sbjct  148  AEIAPKNLRGGLTTINQLMIVCGSSAAYLLGTIITWRNLALTGILPCTFLLVGLLFI  204



>ref|XP_009774897.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nicotiana 
sylvestris]
Length=488

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 144/205 (70%), Gaps = 21/205 (10%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
            IV+ E+E         LI KE++S     MV LST VAVCGS  FGSC GYS+PTQS I 
Sbjct  26   IVDSEDE--------ELISKENESIG---MVLLSTCVAVCGSFEFGSCVGYSAPTQSEIR  74

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------  336
             DLN ++A+YS+FGSI+T GAM GAITSG IADF+GRKG        IF +         
Sbjct  75   NDLNLTLAQYSIFGSIITIGAMIGAITSGRIADFIGRKGAMRMS--AIFCITGWLAVYFS  132

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
             G L +D+GR  TG+G+G+FSYVVPVFIAEIAPK+LRG LTT+NQLMIV G SVA+++GT
Sbjct  133  MGTLTLDVGRFLTGFGIGIFSYVVPVFIAEIAPKDLRGGLTTINQLMIVCGASVAYLLGT  192

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
            +++WR LALTGI PC  L +GL  I
Sbjct  193  VISWRNLALTGILPCTFLLVGLFFI  217



>ref|XP_010105671.1| Sugar transporter ERD6-like 16 [Morus notabilis]
 gb|EXC05702.1| Sugar transporter ERD6-like 16 [Morus notabilis]
Length=439

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 127/166 (77%), Gaps = 6/166 (4%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
            D     WMV LSTFVAVCGS  FGSC G+S+PTQSAI +DLN S+A+YS+FGSILT GAM
Sbjct  51   DQNGSIWMVLLSTFVAVCGSFEFGSCVGFSAPTQSAIREDLNLSLAQYSMFGSILTIGAM  110

Query  247  AGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVV  408
             GA+TSG IADF+GRKG          T        KGA  +D+GR  TG+G+G+FSYVV
Sbjct  111  LGAVTSGRIADFIGRKGAMRLSAGFCITGWLAVFFAKGASSLDMGRFFTGFGIGIFSYVV  170

Query  409  PVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALT  546
            P+F+AEIAPK LRG LTTLNQLMIVTG S+AFVIGT+++WR+LALT
Sbjct  171  PIFVAEIAPKNLRGGLTTLNQLMIVTGASLAFVIGTVISWRSLALT  216



>ref|XP_002516838.1| sugar transporter, putative [Ricinus communis]
 gb|EEF45452.1| sugar transporter, putative [Ricinus communis]
Length=516

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 143/201 (71%), Gaps = 18/201 (9%)
 Frame = +1

Query  37   MAAPLIGKE--------DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            +  PLI +E        ++      MV LSTFVAVCGS  FGSC GYS+PTQSAI +DL+
Sbjct  20   LERPLIHEEKAVSFKNDEEENGSMNMVLLSTFVAVCGSFEFGSCVGYSAPTQSAIMEDLS  79

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGAL  348
             + A+YS+FGSILT GAM GA+TSG I+D++GRKG        IF +         +G L
Sbjct  80   LTTAQYSMFGSILTIGAMIGAVTSGRISDYIGRKGAMRMS--AIFCITGWLAVFFSRGYL  137

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
             +D+GRL TGYG+GVFS+VVP+FIAEIAPK LRG LTTLNQLMIVTG S AF+IG++++W
Sbjct  138  SLDMGRLFTGYGIGVFSFVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSTAFLIGSVISW  197

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LALTG+ PC+ L +GL  +
Sbjct  198  RILALTGLVPCIFLLVGLVFV  218



>gb|EYU43869.1| hypothetical protein MIMGU_mgv1a018596mg [Erythranthe guttata]
Length=480

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 134/176 (76%), Gaps = 10/176 (6%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FGSC GYSSPTQSAI +DLN S++++S+FGSI+T GAM GAITSG
Sbjct  43   MVLLSTCVAVCGSFEFGSCVGYSSPTQSAIREDLNLSLSQFSMFGSIITIGAMIGAITSG  102

Query  268  PIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIA  423
             IADF+GRKG        IF ++          A ++DIGR  TGYG+G+FSYVVPVFIA
Sbjct  103  RIADFLGRKGAMRIS--AIFCIIGWLAVYFSTEAWLLDIGRFCTGYGIGIFSYVVPVFIA  160

Query  424  EIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            EIAPK LRG L TLNQLMIV G S A+++GT+VTWRTLALTG+ PC+++ +GL  I
Sbjct  161  EIAPKNLRGGLATLNQLMIVCGASTAYLLGTVVTWRTLALTGLLPCILILVGLFFI  216



>ref|XP_009603614.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nicotiana 
tomentosiformis]
Length=481

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 143/205 (70%), Gaps = 21/205 (10%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
            IV+ E+E         LI KE+ S     MV LST VAVCGS  FGSC GYS+PTQ+ I 
Sbjct  26   IVDSEDE--------ELISKENGSIG---MVLLSTCVAVCGSFEFGSCVGYSAPTQAEIR  74

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------  336
             DLN ++A+YS+FGSI+T GAM GAITSG IADF+GRKG        IF +         
Sbjct  75   NDLNLTLAQYSIFGSIITIGAMIGAITSGRIADFIGRKGAMRMS--AIFCITGWLAVYFS  132

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
             G L +D+GR  TG+G+G+FSYVVPVFIAEIAPK+LRG LTT+NQLMIV G SVA+++GT
Sbjct  133  MGTLTLDVGRFLTGFGIGIFSYVVPVFIAEIAPKDLRGGLTTINQLMIVCGASVAYLLGT  192

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
            +++WR LALTGI PC  L +GL  I
Sbjct  193  VISWRNLALTGILPCTFLLVGLFFI  217



>ref|XP_011090877.1| PREDICTED: sugar transporter ERD6-like 16 [Sesamum indicum]
Length=484

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 142/210 (68%), Gaps = 15/210 (7%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGK-----EDDSKTDR----WMVYLSTFVAVCGSCAFGSCAGYSS  159
            NG + G    +  P I +      D+  T++     MV LST VAVCGS  FGSC GYSS
Sbjct  11   NGLDVGHHHELEKPFIQQPKCVDSDEETTNKNGSIGMVLLSTCVAVCGSFEFGSCVGYSS  70

Query  160  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT---  330
            PTQSAI QDLN SI+++S+FGSI+T GAM GAITSG IADF+GRKG          T   
Sbjct  71   PTQSAIRQDLNLSISQFSMFGSIITIGAMFGAITSGRIADFIGRKGAMRLSAVFCITGWL  130

Query  331  ---LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  501
                   A  +D+GR  TG+G+G+FS+VVPVFIAEIAPK LRG L TLNQLMIV G S+A
Sbjct  131  AVYFSNEAWSLDVGRFCTGFGIGIFSFVVPVFIAEIAPKNLRGGLATLNQLMIVCGSSIA  190

Query  502  FVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            +++GT+VTWR LALTG+ PC +L +GL  I
Sbjct  191  YILGTVVTWRALALTGLLPCFLLLVGLFFI  220



>ref|XP_008438775.1| PREDICTED: sugar transporter ERD6-like 16 isoform X3 [Cucumis 
melo]
Length=465

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 136/183 (74%), Gaps = 10/183 (5%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
             S+    M+YLST VAVCGS  FGSC GYS+P ++AI +DLN S+++YS+FGSILT GAM
Sbjct  42   SSRRCNHMLYLSTSVAVCGSFQFGSCVGYSAPVEAAIREDLNLSLSQYSMFGSILTIGAM  101

Query  247  AGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSY  402
             GAITSG IAD++GRK          F +L        K ++++DIGRL TGYG+GVFSY
Sbjct  102  FGAITSGRIADYIGRKQAMRMS--ACFCILGWIAIFLSKESVLLDIGRLLTGYGIGVFSY  159

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            VVP+FIAEIAPK LRG LTTLNQL+IV G SVAF++GT+VTWRTLALTG+ P   L +GL
Sbjct  160  VVPIFIAEIAPKNLRGGLTTLNQLLIVMGASVAFILGTVVTWRTLALTGLIPSFTLLVGL  219

Query  583  CII  591
              +
Sbjct  220  FFV  222



>ref|XP_008438773.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Cucumis 
melo]
Length=496

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 136/183 (74%), Gaps = 10/183 (5%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
             S+    M+YLST VAVCGS  FGSC GYS+P ++AI +DLN S+++YS+FGSILT GAM
Sbjct  42   SSRRCNHMLYLSTSVAVCGSFQFGSCVGYSAPVEAAIREDLNLSLSQYSMFGSILTIGAM  101

Query  247  AGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSY  402
             GAITSG IAD++GRK          F +L        K ++++DIGRL TGYG+GVFSY
Sbjct  102  FGAITSGRIADYIGRKQAMRMS--ACFCILGWIAIFLSKESVLLDIGRLLTGYGIGVFSY  159

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            VVP+FIAEIAPK LRG LTTLNQL+IV G SVAF++GT+VTWRTLALTG+ P   L +GL
Sbjct  160  VVPIFIAEIAPKNLRGGLTTLNQLLIVMGASVAFILGTVVTWRTLALTGLIPSFTLLVGL  219

Query  583  CII  591
              +
Sbjct  220  FFV  222



>gb|KJB72535.1| hypothetical protein B456_011G183500 [Gossypium raimondii]
Length=462

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 135/186 (73%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            K  D     +MV LSTFVAV G+  FG+C GYS+PTQ+AI +DL  S+AE+++FGSILT 
Sbjct  33   KSSDENGSIFMVLLSTFVAVFGAFEFGTCVGYSAPTQAAIREDLGLSLAEFAMFGSILTI  92

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GA+TSG IAD +GRKG        +F +         K  + +D+GR ATGYG+G+
Sbjct  93   GAMFGAVTSGRIADTIGRKGAMRLS--AVFCIAGWLAVYFSKSGVSLDLGRFATGYGIGI  150

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVP+FIAEIAPK LRG LTTLNQL+IV G S AF+IGT+++WR LAL G+ PC+VL 
Sbjct  151  FSYVVPIFIAEIAPKNLRGGLTTLNQLLIVIGQSTAFLIGTVISWRELALAGLLPCIVLF  210

Query  574  LGLCII  591
            +GLC I
Sbjct  211  VGLCFI  216



>gb|KJB72536.1| hypothetical protein B456_011G183500 [Gossypium raimondii]
Length=482

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 135/186 (73%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            K  D     +MV LSTFVAV G+  FG+C GYS+PTQ+AI +DL  S+AE+++FGSILT 
Sbjct  33   KSSDENGSIFMVLLSTFVAVFGAFEFGTCVGYSAPTQAAIREDLGLSLAEFAMFGSILTI  92

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GA+TSG IAD +GRKG        +F +         K  + +D+GR ATGYG+G+
Sbjct  93   GAMFGAVTSGRIADTIGRKGAMRLS--AVFCIAGWLAVYFSKSGVSLDLGRFATGYGIGI  150

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVP+FIAEIAPK LRG LTTLNQL+IV G S AF+IGT+++WR LAL G+ PC+VL 
Sbjct  151  FSYVVPIFIAEIAPKNLRGGLTTLNQLLIVIGQSTAFLIGTVISWRELALAGLLPCIVLF  210

Query  574  LGLCII  591
            +GLC I
Sbjct  211  VGLCFI  216



>gb|KJB72537.1| hypothetical protein B456_011G183500 [Gossypium raimondii]
Length=467

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 135/186 (73%), Gaps = 10/186 (5%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            K  D     +MV LSTFVAV G+  FG+C GYS+PTQ+AI +DL  S+AE+++FGSILT 
Sbjct  33   KSSDENGSIFMVLLSTFVAVFGAFEFGTCVGYSAPTQAAIREDLGLSLAEFAMFGSILTI  92

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GA+TSG IAD +GRKG        +F +         K  + +D+GR ATGYG+G+
Sbjct  93   GAMFGAVTSGRIADTIGRKGAMRLS--AVFCIAGWLAVYFSKSGVSLDLGRFATGYGIGI  150

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
            FSYVVP+FIAEIAPK LRG LTTLNQL+IV G S AF+IGT+++WR LAL G+ PC+VL 
Sbjct  151  FSYVVPIFIAEIAPKNLRGGLTTLNQLLIVIGQSTAFLIGTVISWRELALAGLLPCIVLF  210

Query  574  LGLCII  591
            +GLC I
Sbjct  211  VGLCFI  216



>gb|KEH32265.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=435

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 137/216 (63%), Gaps = 20/216 (9%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGKEDDSKTDRW--------------MVYLSTFVAVCGSCAFGS  141
            V   +E +   +  P I    D+  D                MV LSTFVAVCGS +FG+
Sbjct  9    VESGHENTHRDLQEPFIQHGKDATVDYHDIESNKRAENGSIGMVLLSTFVAVCGSFSFGT  68

Query  142  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*T  321
            C GYSSPTQ+AI  DLN SI+E+S+FGS++T GAM GAITSG I DF+GRKG        
Sbjct  69   CVGYSSPTQAAIRADLNLSISEFSMFGSLVTIGAMLGAITSGRITDFIGRKGAMRLSTGF  128

Query  322  IFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  483
              T        K    +DIGR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  129  CITGWLAVFFSKDPYSLDIGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  188

Query  484  TGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             G SV+F++G++++WR LAL G+ PC+ L +GLC I
Sbjct  189  IGASVSFLLGSVLSWRKLALAGLLPCLSLLIGLCFI  224



>ref|XP_010546662.1| PREDICTED: sugar transporter ERD6-like 8 [Tarenaya hassleriana]
Length=471

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR--WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
             G++     G + PL+G E  S  D   WMVY+STF+AVCGS  FG   GYS+PTQ  I 
Sbjct  4    RGDDVEKINGKSEPLLGPEKGSDGDEVSWMVYVSTFIAVCGSYEFGCGVGYSAPTQFGIM  63

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*T------IFTLLKG  342
            +++  S +E+++FGSI+  GAM GAITSG I+DFVGRKG     +        I  L KG
Sbjct  64   EEIKLSYSEFAVFGSIVNIGAMLGAITSGKISDFVGRKGAMRVSSIIGTVGWLIIYLAKG  123

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
            A+ +D+GR  TGYG G  SYVVPVFIAEIAP++LRGAL TL+QL IV G++  FVIG +V
Sbjct  124  AVPLDLGRFLTGYGCGTLSYVVPVFIAEIAPRKLRGALATLHQLFIVIGLAAMFVIGAVV  183

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
             WR LALTG+ PCVVL  G   I
Sbjct  184  NWRILALTGVIPCVVLFFGTWFI  206



>ref|XP_004508324.1| PREDICTED: sugar transporter ERD6-like 16-like [Cicer arietinum]
Length=488

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 129/175 (74%), Gaps = 8/175 (5%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LSTFVAVCGS +FG+C GYSSPTQ+AI  DLN SI+E+S+FGS++T GAM GAITSG
Sbjct  51   MVLLSTFVAVCGSFSFGTCVGYSSPTQAAIRADLNLSISEFSMFGSLVTIGAMIGAITSG  110

Query  268  PIADFVGRKGQENAEN*-------TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
             I DF+GRKG              TIF   K    +D+GR  TGYG+GV SYVVPV+IAE
Sbjct  111  RITDFIGRKGAMRMSTGFCITGWLTIF-FSKDPYSLDMGRFFTGYGIGVISYVVPVYIAE  169

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IAPK LRG L T NQLMIV G SV+F+IG++++WR LAL GI PC+ L +GLC I
Sbjct  170  IAPKNLRGGLATTNQLMIVIGASVSFLIGSILSWRELALAGIVPCIFLLIGLCFI  224



>ref|XP_007050737.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX94894.1| Major facilitator superfamily protein [Theobroma cacao]
Length=484

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 144/215 (67%), Gaps = 19/215 (9%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDSKTDRW------------MVYLSTFVAVCGSCAFGSC  144
            + NGE+    A M  PL+        DR             +V+LSTFVAV GS  FGSC
Sbjct  7    VENGESS-VKAKMKEPLLQHTSIKDGDRKFHNECNRKGLLKVVFLSTFVAVLGSYEFGSC  65

Query  145  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TI  324
             GYS+P QSAI++DL+ S+AE+S+FGSIL  G+M GAITSG IA+F+GRKG     +   
Sbjct  66   MGYSAPVQSAITKDLDLSVAEFSVFGSILNVGSMIGAITSGRIAEFLGRKGAMRISSAFS  125

Query  325  FT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  486
             T        KGAL +DIGR  +GYG+G+F+YVVP+++AEIAPK+LRG L TLNQLMIV 
Sbjct  126  ITGWIAIYFSKGALSLDIGRFLSGYGIGIFAYVVPIYVAEIAPKDLRGGLATLNQLMIVI  185

Query  487  GVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            G SVAF+ GT++ WR LALTGI PC+V  +GL  I
Sbjct  186  GASVAFLAGTVLKWRLLALTGIIPCLVQLVGLIFI  220



>ref|XP_008223079.1| PREDICTED: sugar transporter ERD6-like 16 [Prunus mume]
Length=490

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 138/203 (68%), Gaps = 16/203 (8%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
            +V  E++GS         GKE  S++   MV LST VAVCGS  FG C GYS+PTQSAI 
Sbjct  29   VVAHEDDGS---------GKEFQSESIS-MVLLSTGVAVCGSFQFGICVGYSAPTQSAIR  78

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKG  342
            +DLN S+AEYS+FGSIL+ GA+ GAITSG IADF+GRKG     +             +G
Sbjct  79   KDLNLSLAEYSMFGSILSIGAVLGAITSGKIADFLGRKGAMRVSSVICIVAWLAIYFSQG  138

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
            AL +D GR  TGYG+  FSYVVPVFIAEIAPK LRG L TLNQ+ IVTG S AF++GT++
Sbjct  139  ALSLDTGRFLTGYGIAAFSYVVPVFIAEIAPKNLRGGLATLNQVFIVTGGSFAFIVGTII  198

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
             WR LAL    PC++L LG+C +
Sbjct  199  NWRALALIATVPCLILLLGVCFV  221



>ref|XP_003609563.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|AES91760.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=490

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 137/216 (63%), Gaps = 20/216 (9%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGKEDDSKTDRW--------------MVYLSTFVAVCGSCAFGS  141
            V   +E +   +  P I    D+  D                MV LSTFVAVCGS +FG+
Sbjct  9    VESGHENTHRDLQEPFIQHGKDATVDYHDIESNKRAENGSIGMVLLSTFVAVCGSFSFGT  68

Query  142  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*T  321
            C GYSSPTQ+AI  DLN SI+E+S+FGS++T GAM GAITSG I DF+GRKG        
Sbjct  69   CVGYSSPTQAAIRADLNLSISEFSMFGSLVTIGAMLGAITSGRITDFIGRKGAMRLSTGF  128

Query  322  IFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  483
              T        K    +DIGR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  129  CITGWLAVFFSKDPYSLDIGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  188

Query  484  TGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             G SV+F++G++++WR LAL G+ PC+ L +GLC I
Sbjct  189  IGASVSFLLGSVLSWRKLALAGLLPCLSLLIGLCFI  224



>ref|XP_007226898.1| hypothetical protein PRUPE_ppa016361mg [Prunus persica]
 gb|EMJ28097.1| hypothetical protein PRUPE_ppa016361mg [Prunus persica]
Length=490

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 137/213 (64%), Gaps = 18/213 (8%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGK------EDDSKTDRW------MVYLSTFVAVCGSCAFGSCAG  150
             GE   +   +  P I +      EDD            MV LST VAVCGS  FG C G
Sbjct  9    RGETSSNQEELEQPFIRRRKVVAHEDDGSGKELQNESIGMVLLSTGVAVCGSFQFGICVG  68

Query  151  YSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*T-IF  327
            YS+PTQSAI +DLN S+AEYS FGSIL+ GA+ GAITSG IADF+GRKG     +   I 
Sbjct  69   YSAPTQSAIRKDLNLSLAEYSTFGSILSIGAVLGAITSGKIADFLGRKGAMRVSSVICII  128

Query  328  TLL-----KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGV  492
              L     +GAL +D GR  TGYG+  FSYVVPVFIAEIAPK LRG L TLNQL IVTG 
Sbjct  129  AWLAIYFSQGALSLDTGRFLTGYGIAAFSYVVPVFIAEIAPKNLRGGLATLNQLFIVTGG  188

Query  493  SVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            S AF++GT++ WR LAL    PC++L LG+C++
Sbjct  189  SFAFIVGTIINWRALALIATVPCLILLLGVCLV  221



>gb|KDP40049.1| hypothetical protein JCGZ_02047 [Jatropha curcas]
Length=490

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 133/184 (72%), Gaps = 6/184 (3%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
             E+++     MV  STFVAVCGS  FGSC GYS+PTQSAI +DLN + ++YS+FGSILT 
Sbjct  43   NEEETTGSIGMVLFSTFVAVCGSFEFGSCVGYSAPTQSAIMEDLNLTASQYSMFGSILTI  102

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFS  399
            GAM GAITSG IAD++GRKG          T        K    +D+GR  TGYG+GVFS
Sbjct  103  GAMLGAITSGRIADYIGRKGAMRMSVGFCITGWVAVFFSKEYFSLDMGRFFTGYGIGVFS  162

Query  400  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLG  579
            +V+P++IAEI+PK LRG LTTLNQLMIVTG S AF++G++++W+ LALTG+ PC+ L +G
Sbjct  163  FVIPIYIAEISPKNLRGGLTTLNQLMIVTGSSTAFLLGSVISWKALALTGLVPCIFLLVG  222

Query  580  LCII  591
            L  I
Sbjct  223  LFFI  226



>gb|KHN33102.1| Sugar transporter ERD6-like 16 [Glycine soja]
Length=487

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 128/174 (74%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV+LST VAVCGS  FG+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG
Sbjct  43   MVFLSTLVAVCGSFTFGTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSG  102

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I DF+GRKG          T        KG+  +D+GR  TGYG+GV SYVVPV+IAEI
Sbjct  103  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDMGRFFTGYGIGVISYVVPVYIAEI  162

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+ PC+ L +GLC I
Sbjct  163  APKNLRGGLATTNQLLIVTGGSVSFLLGSVINWRELALAGLVPCICLLVGLCFI  216



>gb|KEH36719.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=374

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 143/216 (66%), Gaps = 22/216 (10%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDS----KTDRWM-------VYLSTFVAVCGSCAFGSCA  147
            I NGE  G    +  P I +  D+     +D+ M       V LSTFVAVCGS +FG+C 
Sbjct  9    IENGETNGFQY-LQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGTCV  67

Query  148  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIF  327
            GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG + D +GRKG       T F
Sbjct  68   GYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRVTDIIGRKGAMRIS--TGF  125

Query  328  TLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  483
             ++        K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  126  CIIGWLAVFFSKSSYTLDLGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  185

Query  484  TGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             G S++F+IG+++ WR LAL G+ PC+ L +GLC I
Sbjct  186  IGSSMSFLIGSIINWRQLALAGLVPCICLLVGLCFI  221



>ref|XP_003547222.2| PREDICTED: sugar transporter ERD6-like 16-like [Glycine max]
Length=482

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 128/174 (74%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV+LST VAVCGS  FG+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG
Sbjct  43   MVFLSTLVAVCGSFTFGTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSG  102

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I DF+GRKG          T        KG+  +D+GR  TGYG+GV SYVVPV+IAEI
Sbjct  103  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDMGRFFTGYGIGVISYVVPVYIAEI  162

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+ PC+ L +GLC I
Sbjct  163  APKNLRGGLATTNQLLIVTGGSVSFLLGSVINWRELALAGLVPCICLLVGLCFI  216



>ref|XP_010464026.1| PREDICTED: sugar transporter ERD6-like 8 [Camelina sativa]
Length=471

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 134/195 (69%), Gaps = 9/195 (5%)
 Frame = +1

Query  34   GMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIA  204
            G + PL+  E +S       WMVYLSTF+AVCGS  FG+C GYS+PTQ  I ++L+ S +
Sbjct  14   GKSEPLLLPEKESDVSEEASWMVYLSTFIAVCGSFEFGTCVGYSAPTQFGIMEELDLSYS  73

Query  205  EYSLFGSILTFGAMAGAITSGPIADFVGRKGQE------NAEN*TIFTLLKGALVMDIGR  366
            ++S+FGSIL  GA+ GAITSG I+DF+GRKG        +A    I  + KG + +D GR
Sbjct  74   QFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLASVISAIGWLIIYIAKGDVPLDFGR  133

Query  367  LATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALT  546
              TGYG G  SYVVPVFIAEI+P+ LRGAL TLNQL +V G++  F+IG +V WRTLALT
Sbjct  134  FLTGYGCGTLSYVVPVFIAEISPRNLRGALATLNQLFLVIGLASMFLIGAVVNWRTLALT  193

Query  547  GIXPCVVLGLGLCII  591
            G+ PCVVL  G   I
Sbjct  194  GVAPCVVLFFGTWFI  208



>ref|XP_010485917.1| PREDICTED: sugar transporter ERD6-like 8 [Camelina sativa]
Length=471

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 133/195 (68%), Gaps = 9/195 (5%)
 Frame = +1

Query  34   GMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIA  204
            G + PL+  E +S       WMVYLSTF+AVCGS  FG+C GYS+PTQ  I ++L+ S +
Sbjct  14   GKSEPLLLPEKESDVSEEASWMVYLSTFIAVCGSFEFGTCVGYSAPTQFGIMEELDLSYS  73

Query  205  EYSLFGSILTFGAMAGAITSGPIADFVGRKGQE------NAEN*TIFTLLKGALVMDIGR  366
            ++S+FGSIL  GA+ GAITSG I+DF+GRKG        +A    I    KG + +D GR
Sbjct  74   QFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLASVISAIGWLIIYFAKGDVPLDFGR  133

Query  367  LATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALT  546
              TGYG G  SYVVPVFIAEI+P+ LRGAL TLNQL +V G++  F+IG +V WRTLALT
Sbjct  134  FLTGYGCGTLSYVVPVFIAEISPRNLRGALATLNQLFLVIGLASMFLIGAVVNWRTLALT  193

Query  547  GIXPCVVLGLGLCII  591
            G+ PCVVL  G   I
Sbjct  194  GVAPCVVLFFGTWFI  208



>ref|XP_006594464.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X4 [Glycine 
max]
 ref|XP_006594465.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X5 [Glycine 
max]
Length=479

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FG+C GYSSPTQ+AI +DL+ S+AE+S+FGS++T GAM GAITSG
Sbjct  42   MVLLSTLVAVCGSFTFGNCVGYSSPTQAAIREDLSLSLAEFSMFGSLVTIGAMLGAITSG  101

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I DF+GRKG          T        KG+  +D+GR  TGYG+G+ SYVVPV+IAEI
Sbjct  102  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDLGRFFTGYGIGLISYVVPVYIAEI  161

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+ PC+ L +GLC I
Sbjct  162  APKNLRGGLATTNQLLIVTGASVSFLLGSVIHWRKLALAGLVPCICLLIGLCFI  215



>gb|AAF27021.1|AC009177_11 putative sugar transporter [Arabidopsis thaliana]
Length=463

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 134/193 (69%), Gaps = 9/193 (5%)
 Frame = +1

Query  40   AAPLIGKE---DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEY  210
            + PL+  E   D S+   WMVYLST +AVCGS  FG+C GYS+PTQ  I ++LN S +++
Sbjct  8    SEPLLLPENGSDVSEEASWMVYLSTIIAVCGSYEFGTCVGYSAPTQFGIMEELNLSYSQF  67

Query  211  SLFGSILTFGAMAGAITSGPIADFVGRKGQE------NAEN*TIFTLLKGALVMDIGRLA  372
            S+FGSIL  GA+ GAITSG I+DF+GRKG        +A    I  L KG + +D GR  
Sbjct  68   SVFGSILNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWLIIYLAKGDVPLDFGRFL  127

Query  373  TGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGI  552
            TGYG G  S+VVPVFIAEI+P++LRGAL TLNQL IV G++  F+IG +V WRTLALTG+
Sbjct  128  TGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLASMFLIGAVVNWRTLALTGV  187

Query  553  XPCVVLGLGLCII  591
             PCVVL  G   I
Sbjct  188  APCVVLFFGTWFI  200



>ref|XP_003541648.2| PREDICTED: sugar transporter ERD6-like 16-like isoform X1 [Glycine 
max]
Length=500

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FG+C GYSSPTQ+AI +DL+ S+AE+S+FGS++T GAM GAITSG
Sbjct  63   MVLLSTLVAVCGSFTFGNCVGYSSPTQAAIREDLSLSLAEFSMFGSLVTIGAMLGAITSG  122

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I DF+GRKG          T        KG+  +D+GR  TGYG+G+ SYVVPV+IAEI
Sbjct  123  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDLGRFFTGYGIGLISYVVPVYIAEI  182

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+ PC+ L +GLC I
Sbjct  183  APKNLRGGLATTNQLLIVTGASVSFLLGSVIHWRKLALAGLVPCICLLIGLCFI  236



>gb|KJB22569.1| hypothetical protein B456_004G054600 [Gossypium raimondii]
Length=473

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 133/197 (68%), Gaps = 6/197 (3%)
 Frame = +1

Query  19   EGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            E   + M  PL+           +V+L+TFVAV GS  FGSC GYS+P QSAI+++L+ S
Sbjct  4    ENGESSMKEPLLLHHAKKTRSLEVVFLTTFVAVLGSYEFGSCMGYSAPVQSAITKELHLS  63

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDI  360
            IAE+S+FGSIL  GAM GAITSG IADF+GR G     +    T        KGAL++DI
Sbjct  64   IAEFSVFGSILNVGAMIGAITSGRIADFMGRTGAMRISSGFSITGWIAIYFSKGALLLDI  123

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR   GYG+G+F+YVVP+++ EIAPK++RG L  LNQLMIV G S  FV+GT + WR LA
Sbjct  124  GRFLCGYGIGIFAYVVPIYVGEIAPKDVRGGLAALNQLMIVIGASTTFVVGTALEWRILA  183

Query  541  LTGIXPCVVLGLGLCII  591
            LTGI PC++  LGL  I
Sbjct  184  LTGIIPCLIQLLGLNFI  200



>ref|NP_187166.2| sugar transporter ERD6-like 8 [Arabidopsis thaliana]
 sp|Q0WQ63.1|ERDL8_ARATH RecName: Full=Sugar transporter ERD6-like 8 [Arabidopsis thaliana]
 dbj|BAF00736.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEE74191.1| sugar transporter ERD6-like 8 [Arabidopsis thaliana]
Length=470

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 134/193 (69%), Gaps = 9/193 (5%)
 Frame = +1

Query  40   AAPLIGKE---DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEY  210
            + PL+  E   D S+   WMVYLST +AVCGS  FG+C GYS+PTQ  I ++LN S +++
Sbjct  15   SEPLLLPENGSDVSEEASWMVYLSTIIAVCGSYEFGTCVGYSAPTQFGIMEELNLSYSQF  74

Query  211  SLFGSILTFGAMAGAITSGPIADFVGRKGQE------NAEN*TIFTLLKGALVMDIGRLA  372
            S+FGSIL  GA+ GAITSG I+DF+GRKG        +A    I  L KG + +D GR  
Sbjct  75   SVFGSILNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWLIIYLAKGDVPLDFGRFL  134

Query  373  TGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGI  552
            TGYG G  S+VVPVFIAEI+P++LRGAL TLNQL IV G++  F+IG +V WRTLALTG+
Sbjct  135  TGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLASMFLIGAVVNWRTLALTGV  194

Query  553  XPCVVLGLGLCII  591
             PCVVL  G   I
Sbjct  195  APCVVLFFGTWFI  207



>gb|KHN37528.1| Sugar transporter ERD6-like 16 [Glycine soja]
Length=461

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FG+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG
Sbjct  44   MVLLSTLVAVCGSFTFGTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSG  103

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I DF+GRKG          T        KG+  +D GR  TGYG+GV SYVVPV+IAEI
Sbjct  104  RITDFIGRKGAMRISTGFCITGWIAVFFSKGSYSLDFGRFFTGYGIGVISYVVPVYIAEI  163

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+ PC+ L +GLC I
Sbjct  164  APKNLRGGLATTNQLLIVTGGSVSFLLGSVINWRELALAGLVPCICLLVGLCFI  217



>ref|XP_006594462.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X2 [Glycine 
max]
Length=570

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FG+C GYSSPTQ+AI +DL+ S+AE+S+FGS++T GAM GAITSG
Sbjct  133  MVLLSTLVAVCGSFTFGNCVGYSSPTQAAIREDLSLSLAEFSMFGSLVTIGAMLGAITSG  192

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I DF+GRKG          T        KG+  +D+GR  TGYG+G+ SYVVPV+IAEI
Sbjct  193  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDLGRFFTGYGIGLISYVVPVYIAEI  252

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+ PC+ L +GLC I
Sbjct  253  APKNLRGGLATTNQLLIVTGASVSFLLGSVIHWRKLALAGLVPCICLLIGLCFI  306



>gb|KEH36718.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=424

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 143/216 (66%), Gaps = 22/216 (10%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDS----KTDRWM-------VYLSTFVAVCGSCAFGSCA  147
            I NGE  G    +  P I +  D+     +D+ M       V LSTFVAVCGS +FG+C 
Sbjct  9    IENGETNGFQY-LQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGTCV  67

Query  148  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIF  327
            GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG + D +GRKG       T F
Sbjct  68   GYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRVTDIIGRKGAMRIS--TGF  125

Query  328  TLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  483
             ++        K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  126  CIIGWLAVFFSKSSYTLDLGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  185

Query  484  TGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             G S++F+IG+++ WR LAL G+ PC+ L +GLC I
Sbjct  186  IGSSMSFLIGSIINWRQLALAGLVPCICLLVGLCFI  221



>ref|XP_006594463.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X3 [Glycine 
max]
Length=564

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FG+C GYSSPTQ+AI +DL+ S+AE+S+FGS++T GAM GAITSG
Sbjct  127  MVLLSTLVAVCGSFTFGNCVGYSSPTQAAIREDLSLSLAEFSMFGSLVTIGAMLGAITSG  186

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I DF+GRKG          T        KG+  +D+GR  TGYG+G+ SYVVPV+IAEI
Sbjct  187  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDLGRFFTGYGIGLISYVVPVYIAEI  246

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+ PC+ L +GLC I
Sbjct  247  APKNLRGGLATTNQLLIVTGASVSFLLGSVIHWRKLALAGLVPCICLLIGLCFI  300



>gb|KEH36720.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=420

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 143/216 (66%), Gaps = 22/216 (10%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDS----KTDRWM-------VYLSTFVAVCGSCAFGSCA  147
            I NGE  G    +  P I +  D+     +D+ M       V LSTFVAVCGS +FG+C 
Sbjct  9    IENGETNGFQY-LQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGTCV  67

Query  148  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIF  327
            GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG + D +GRKG       T F
Sbjct  68   GYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRVTDIIGRKGAMRIS--TGF  125

Query  328  TLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  483
             ++        K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  126  CIIGWLAVFFSKSSYTLDLGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  185

Query  484  TGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             G S++F+IG+++ WR LAL G+ PC+ L +GLC I
Sbjct  186  IGSSMSFLIGSIINWRQLALAGLVPCICLLVGLCFI  221



>ref|XP_010941736.1| PREDICTED: sugar transporter ERD6-like 16 [Elaeis guineensis]
Length=473

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 133/194 (69%), Gaps = 8/194 (4%)
 Frame = +1

Query  34   GMAAPLIGKEDDS--KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAE  207
            G   PL+  E+    K    MV +ST V+VCGS  FG C GYS+PTQS I QDL  S++E
Sbjct  14   GFKEPLMHAEETRSCKESLCMVLVSTAVSVCGSFEFGVCVGYSAPTQSEIRQDLGLSLSE  73

Query  208  YSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRL  369
            YS+FGSI+T GAM GA+TSG I+DF GRKG                   +GA  +D+GR+
Sbjct  74   YSVFGSIVTIGAMIGAVTSGRISDFSGRKGAMRMSAIVCIIGWLGIYFAEGAFSLDLGRI  133

Query  370  ATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTG  549
             TGYG GVFSYVVPVFIAEIAPK+LRG LTT+NQL+I  G+S+ ++IGT+VTWRTL L G
Sbjct  134  LTGYGTGVFSYVVPVFIAEIAPKQLRGGLTTINQLLICGGLSLCYIIGTLVTWRTLVLVG  193

Query  550  IXPCVVLGLGLCII  591
            + PC V+ +GL  I
Sbjct  194  LVPCFVILVGLYFI  207



>ref|XP_003541649.1| PREDICTED: sugar transporter ERD6-like 16-like [Glycine max]
Length=481

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FG+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG
Sbjct  44   MVLLSTLVAVCGSFTFGTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSG  103

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             I DF+GRKG          T        KG+  +D GR  TGYG+GV SYVVPV+IAEI
Sbjct  104  RITDFIGRKGAMRISTGFCITGWIAVFFSKGSYSLDFGRFFTGYGIGVISYVVPVYIAEI  163

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+ PC+ L +GLC I
Sbjct  164  APKNLRGGLATTNQLLIVTGGSVSFLLGSVINWRELALAGLVPCICLLVGLCFI  217



>ref|XP_010242565.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Nelumbo 
nucifera]
Length=458

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 132/193 (68%), Gaps = 32/193 (17%)
 Frame = +1

Query  46   PLI-----GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEY  210
            PLI     G+    K   WMVY STFVAVCGS  FGSC                     Y
Sbjct  23   PLIRNIEHGENKGGKEQVWMVYFSTFVAVCGSFEFGSC---------------------Y  61

Query  211  SLFGSILTFGAMAGAITSGPIADFVGRKG--QENAEN*T----IFTLLKGALVMDIGRLA  372
            S+FGSILTFGAM GAITSGPIADF+GRKG    +A   T         +GAL++DIGRL+
Sbjct  62   SVFGSILTFGAMIGAITSGPIADFIGRKGAMWMSAAFCTGGWLAIYFAEGALLLDIGRLS  121

Query  373  TGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGI  552
            TGYGMGVFSYVVPVFIAE+APK+LRG LTT+NQLMI +GVSVA++IGT++TWR LALTG+
Sbjct  122  TGYGMGVFSYVVPVFIAEMAPKDLRGGLTTVNQLMICSGVSVAYIIGTVLTWRALALTGL  181

Query  553  XPCVVLGLGLCII  591
             PC +L LGL  I
Sbjct  182  IPCFILFLGLFFI  194



>ref|XP_006845806.1| hypothetical protein AMTR_s00019p00256160 [Amborella trichopoda]
 gb|ERN07481.1| hypothetical protein AMTR_s00019p00256160 [Amborella trichopoda]
Length=493

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 132/184 (72%), Gaps = 10/184 (5%)
 Frame = +1

Query  64   DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGA  243
            +D K    +V LSTFVAV GS  FGS  G+SSPTQSAI  DL  S++EYS+FGSILT G+
Sbjct  40   NDGKGSILVVILSTFVAVSGSFEFGSAVGFSSPTQSAIRSDLGLSLSEYSVFGSILTIGS  99

Query  244  MAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFS  399
            M GAI  G +AD+VGRKG        +F++L        + A  +DIGRL+ GYG+GV S
Sbjct  100  MIGAIMCGSLADYVGRKGAMRIA--AVFSILGWIAISFSEAAWTLDIGRLSVGYGIGVLS  157

Query  400  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLG  579
            YVVPV+IAEI PK LRG  TT+NQLMIV G SVAF++GT++TWR L +TGI PC++L LG
Sbjct  158  YVVPVYIAEITPKHLRGGFTTVNQLMIVFGASVAFILGTILTWRVLTVTGIVPCLILLLG  217

Query  580  LCII  591
            L I+
Sbjct  218  LFIV  221



>ref|XP_011090879.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Sesamum 
indicum]
Length=337

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = +1

Query  85   WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITS  264
            +MV LSTFVA+CGS  FG C GYSSPTQS+I  DLN S++E+SLFGSI+T GAM G+ITS
Sbjct  34   FMVLLSTFVAICGSFEFGICVGYSSPTQSSIRHDLNLSLSEFSLFGSIITIGAMFGSITS  93

Query  265  GPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
            G IAD++GRKG                   K A  +D+GR +TGYG+G+ S+VVPVFI E
Sbjct  94   GRIADYLGRKGSMRLAAVICIAGWVAVYFSKAAWSLDVGRFSTGYGIGLSSFVVPVFIGE  153

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IAPK LRG L TLNQL+IV G S  +++GT+VTWRTLALTG+ P +++ +GL  I
Sbjct  154  IAPKHLRGGLATLNQLLIVCGSSFVYIVGTIVTWRTLALTGLIPSILVLVGLFFI  208



>ref|XP_002882396.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58655.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=470

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 133/193 (69%), Gaps = 9/193 (5%)
 Frame = +1

Query  40   AAPLIGKE---DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEY  210
            A PL+  E   D S+   WMVYLST +AVCGS  FG+C GYS+PTQ  I ++LN S +++
Sbjct  15   AGPLLLPENGSDVSEETSWMVYLSTIIAVCGSYEFGTCVGYSAPTQFGIMEELNLSYSQF  74

Query  211  SLFGSILTFGAMAGAITSGPIADFVGRKGQE------NAEN*TIFTLLKGALVMDIGRLA  372
            S+FGSIL  GA+ GAITSG I+DF+GRKG        +A    I    KG + +D GR  
Sbjct  75   SVFGSILNVGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWLIIYFAKGDVPLDFGRFL  134

Query  373  TGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGI  552
            TG+G G  S+VVPVFIAEI+P++LRGAL TLNQL IV G++  F+IG +V WRTLALTG+
Sbjct  135  TGFGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLASMFLIGAVVNWRTLALTGV  194

Query  553  XPCVVLGLGLCII  591
             PCVVL  G   I
Sbjct  195  APCVVLFFGTWFI  207



>ref|XP_003594043.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|AES64294.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=485

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 143/216 (66%), Gaps = 22/216 (10%)
 Frame = +1

Query  1    IVNGENEGSTAGMAAPLIGKEDDS----KTDRWM-------VYLSTFVAVCGSCAFGSCA  147
            I NGE  G    +  P I +  D+     +D+ M       V LSTFVAVCGS +FG+C 
Sbjct  9    IENGETNGFQY-LQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGTCV  67

Query  148  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIF  327
            GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG + D +GRKG       T F
Sbjct  68   GYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRVTDIIGRKGAMRIS--TGF  125

Query  328  TLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  483
             ++        K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  126  CIIGWLAVFFSKSSYTLDLGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  185

Query  484  TGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             G S++F+IG+++ WR LAL G+ PC+ L +GLC I
Sbjct  186  IGSSMSFLIGSIINWRQLALAGLVPCICLLVGLCFI  221



>ref|XP_007147846.1| hypothetical protein PHAVU_006G159600g [Phaseolus vulgaris]
 gb|ESW19840.1| hypothetical protein PHAVU_006G159600g [Phaseolus vulgaris]
Length=523

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 130/176 (74%), Gaps = 10/176 (6%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAVCGS  FG+C GYS+PTQ+AI +DLN S+AE+S+FGS++T GAM GA+TSG
Sbjct  86   MVLLSTLVAVCGSFTFGTCVGYSAPTQAAIREDLNLSLAEFSMFGSLVTIGAMLGAMTSG  145

Query  268  PIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIA  423
             I DF GRKG       T F +         K +  +D+GR +TGYG+G+ SYVVP++IA
Sbjct  146  RITDFFGRKGAMRIS--TGFCIAGWLAVFFSKSSCFLDLGRFSTGYGIGIISYVVPIYIA  203

Query  424  EIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            EIAPK LRG L T+NQL+IVTG+SV+F IG+++ WR LAL G+ PC+ L +GLC I
Sbjct  204  EIAPKNLRGGLATINQLLIVTGISVSFFIGSVINWRQLALAGLVPCICLVVGLCFI  259



>ref|XP_010242561.1| PREDICTED: sugar transporter ERD6-like 8 isoform X2 [Nelumbo 
nucifera]
Length=429

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 135/205 (66%), Gaps = 14/205 (7%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
              G+   M+ PL+G + +            MV L+T VAVCGS  FGSC GYS+PTQ  I
Sbjct  8    EHGNDVFMSQPLMGTQSEETESHVKHKGLRMVLLTTSVAVCGSFEFGSCVGYSAPTQFGI  67

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TI-------FTLL  336
             +D+  S+ EYS+FGSIL  GA+ GA+TSG +ADF+GRKG     + TI         L 
Sbjct  68   MKDIGLSLTEYSVFGSILNIGAVIGAMTSGHVADFIGRKGAMRMSS-TICILGWLWIYLS  126

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
            +GA+ +DIGR   GYG+G+ SYVVPVFIAEI PK LRGAL T NQL+IV G+SV+F +G 
Sbjct  127  RGAVSLDIGRFLMGYGIGILSYVVPVFIAEITPKNLRGALATANQLLIVIGISVSFTLGA  186

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
             +TWR LAL GI PC++L +GL  I
Sbjct  187  FLTWRALALIGIVPCILLIVGLQFI  211



>ref|XP_006299027.1| hypothetical protein CARUB_v10015164mg [Capsella rubella]
 gb|EOA31925.1| hypothetical protein CARUB_v10015164mg [Capsella rubella]
Length=473

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 138/204 (68%), Gaps = 11/204 (5%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDDS-----KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
            ++   T G + PL+  E +S     +   WMVYLSTF+AVCGS  FG+C GYS+PTQ  I
Sbjct  7    DDMEKTNGKSEPLLLPEKESNDVSEEEASWMVYLSTFIAVCGSYEFGTCVGYSAPTQFGI  66

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQE------NAEN*TIFTLLK  339
             ++L+ S +++S+FGSIL  GA+ GAITSG I+D++GRKG        +A    I    K
Sbjct  67   MEELSLSYSQFSVFGSILNVGAVIGAITSGKISDYIGRKGAMRLSSVISAIGWLIIYFAK  126

Query  340  GALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTM  519
            G + +D GR  TGYG G  S+VVPVFIAEI+P++LRGAL TLNQL +V G++  F+IG +
Sbjct  127  GDVSLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFLVIGLASMFLIGAV  186

Query  520  VTWRTLALTGIXPCVVLGLGLCII  591
            V WRTLALTG+ PCV+L  G   I
Sbjct  187  VNWRTLALTGVAPCVILFCGTWFI  210



>ref|XP_004486078.1| PREDICTED: sugar transporter ERD6-like 16-like [Cicer arietinum]
Length=486

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 129/176 (73%), Gaps = 10/176 (6%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LSTFVAVCGS +FG+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GA+TSG
Sbjct  49   MVLLSTFVAVCGSFSFGTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAVTSG  108

Query  268  PIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIA  423
             + DF+GRKG       T F ++        K +  +D+GR  TGYG+GV SYVVPV+IA
Sbjct  109  RVTDFIGRKGAMRVS--TGFCIIGWLAVFFSKDSYSLDLGRFCTGYGIGVISYVVPVYIA  166

Query  424  EIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            EIAPK LRG L T NQLMIV G S++F++G+++ WR LAL G+ PC+ L LGL  I
Sbjct  167  EIAPKNLRGGLATTNQLMIVIGSSMSFLVGSVINWRELALAGLVPCICLLLGLFFI  222



>ref|XP_010242560.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Nelumbo 
nucifera]
Length=447

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 138/209 (66%), Gaps = 15/209 (7%)
 Frame = +1

Query  7    NGENE-GSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSPT  165
            N E E G+   M+ PL+G + +            MV L+T VAVCGS  FGSC GYS+PT
Sbjct  4    NREVEHGNDVFMSQPLMGTQSEETESHVKHKGLRMVLLTTSVAVCGSFEFGSCVGYSAPT  63

Query  166  QSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TI-------  324
            Q  I +D+  S+ EYS+FGSIL  GA+ GA+TSG +ADF+GRKG     + TI       
Sbjct  64   QFGIMKDIGLSLTEYSVFGSILNIGAVIGAMTSGHVADFIGRKGAMRMSS-TICILGWLW  122

Query  325  FTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  504
              L +GA+ +DIGR   GYG+G+ SYVVPVFIAEI PK LRGAL T NQL+IV G+SV+F
Sbjct  123  IYLSRGAVSLDIGRFLMGYGIGILSYVVPVFIAEITPKNLRGALATANQLLIVIGISVSF  182

Query  505  VIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             +G  +TWR LAL GI PC++L +GL  I
Sbjct  183  TLGAFLTWRALALIGIVPCILLIVGLQFI  211



>gb|KDO44994.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=321

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  271  IADFVGRKGQENAEN*T------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  432
            IAD++GR+G     +        I    K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWVIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  433  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G  PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>gb|ADP37168.1| putative ERD6-like transporter [Vitis vinifera]
Length=473

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 132/202 (65%), Gaps = 11/202 (5%)
 Frame = +1

Query  19   EGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQ  183
            E     +  PLIG++ + +        W+V LST VAVCGS  FGSC GYS+P +  I  
Sbjct  8    EKGNDTITKPLIGQKKEVQIQSNNGGLWVVLLSTLVAVCGSFEFGSCVGYSAPAEYGIMD  67

Query  184  DLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TI----FT--LLKGA  345
            DL  S +EYS FGSILT GAM GAITSG IADF+GRKG     +       FT  L  G+
Sbjct  68   DLGISYSEYSFFGSILTIGAMIGAITSGQIADFIGRKGAMGMSSMICIAGWFTVYLSFGS  127

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
              +  GR   GYG+GV SYVVPVFIAEI PK LRGAL T NQL IVTG+ +A+VIG +VT
Sbjct  128  FSLYSGRFLLGYGIGVLSYVVPVFIAEITPKNLRGALATANQLFIVTGLFIAYVIGAIVT  187

Query  526  WRTLALTGIXPCVVLGLGLCII  591
            WR LALTGI PC+VL +GL  I
Sbjct  188  WRILALTGIVPCMVLLVGLFFI  209



>ref|XP_010660047.1| PREDICTED: sugar transporter ERD6-like 8 [Vitis vinifera]
Length=471

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 131/196 (67%), Gaps = 11/196 (6%)
 Frame = +1

Query  37   MAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSI  201
            +  PLIG++ + +        W+V LST VAVCGS  FGSC GYS+P +  I  DL  S 
Sbjct  14   ITKPLIGQKKEVQIQSNNGGLWVVLLSTLVAVCGSFEFGSCVGYSAPAEYGIMDDLGISY  73

Query  202  AEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TI----FT--LLKGALVMDIG  363
            +EYS FGSILT GAM GAITSG IADF+GRKG     +       FT  L  G+  +  G
Sbjct  74   SEYSFFGSILTIGAMIGAITSGQIADFIGRKGAMGMSSMICIAGWFTVYLSFGSFSLYSG  133

Query  364  RLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLAL  543
            R   GYG+GV SYVVPVFIAEI PK LRGAL T NQL IVTG+ +A+VIG +VTWR LAL
Sbjct  134  RFLLGYGIGVLSYVVPVFIAEITPKNLRGALATANQLFIVTGLFIAYVIGAIVTWRILAL  193

Query  544  TGIXPCVVLGLGLCII  591
            TGI PC+VL +GL  I
Sbjct  194  TGIVPCMVLLVGLFFI  209



>ref|XP_010024484.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Eucalyptus 
grandis]
Length=440

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 120/156 (77%), Gaps = 10/156 (6%)
 Frame = +1

Query  148  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIF  327
            GYS+PTQSAI +DL  S+AEYS+FGSILT GAM GAITSG IADF+GRKG        IF
Sbjct  14   GYSAPTQSAIREDLGLSLAEYSMFGSILTIGAMLGAITSGRIADFIGRKGAMRMS--AIF  71

Query  328  TLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  483
             +          GA  +D+GR  TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIV
Sbjct  72   CIAGWLAVYFSNGASCLDMGRFFTGYGIGVFSYVVPIFIAEIAPKHLRGGLTTLNQLMIV  131

Query  484  TGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             G SVAF+IGT+VTWRTLALTG+ PC+VL +GL +I
Sbjct  132  VGASVAFLIGTIVTWRTLALTGLVPCIVLFVGLFLI  167



>ref|XP_009419855.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 125/176 (71%), Gaps = 10/176 (6%)
 Frame = +1

Query  46   PLIGKEDDSKTDR----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYS  213
            PL+  + +S  D     WMV LST V VCGS  FGSC GYS+PTQS I++D+  S++EYS
Sbjct  24   PLLIHQKESSADSQGSIWMVLLSTAVVVCGSFEFGSCVGYSAPTQSGITKDIGLSLSEYS  83

Query  214  LFGSILTFGAMAGAITSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDIGRLAT  375
            +FGSILT GAM GA+TSG +ADF+GRKG                   KGA+++  GR+++
Sbjct  84   VFGSILTIGAMIGAVTSGHLADFIGRKGAMRVSAVICIIGWLAIYFAKGAVLLYFGRISS  143

Query  376  GYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLAL  543
            GYG+GV SYVVPVFIAEIAPK LRG L TLNQL+I  G SVAFVIGT+VTWRTL L
Sbjct  144  GYGIGVLSYVVPVFIAEIAPKNLRGGLATLNQLLICGGHSVAFVIGTLVTWRTLVL  199



>ref|XP_009419854.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 125/176 (71%), Gaps = 10/176 (6%)
 Frame = +1

Query  46   PLIGKEDDSKTDR----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYS  213
            PL+  + +S  D     WMV LST V VCGS  FGSC GYS+PTQS I++D+  S++EYS
Sbjct  24   PLLIHQKESSADSQGSIWMVLLSTAVVVCGSFEFGSCVGYSAPTQSGITKDIGLSLSEYS  83

Query  214  LFGSILTFGAMAGAITSGPIADFVGRKGQENAE------N*TIFTLLKGALVMDIGRLAT  375
            +FGSILT GAM GA+TSG +ADF+GRKG                   KGA+++  GR+++
Sbjct  84   VFGSILTIGAMIGAVTSGHLADFIGRKGAMRVSAVICIIGWLAIYFAKGAVLLYFGRISS  143

Query  376  GYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLAL  543
            GYG+GV SYVVPVFIAEIAPK LRG L TLNQL+I  G SVAFVIGT+VTWRTL L
Sbjct  144  GYGIGVLSYVVPVFIAEIAPKNLRGGLATLNQLLICGGHSVAFVIGTLVTWRTLVL  199



>ref|XP_011090878.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Sesamum 
indicum]
Length=485

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LSTFVA+CGS  FG C GYSSPTQS+I  DLN S++E+SLFGSI+T GAM G+ITSG
Sbjct  35   MVLLSTFVAICGSFEFGICVGYSSPTQSSIRHDLNLSLSEFSLFGSIITIGAMFGSITSG  94

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             IAD++GRKG                   K A  +D+GR +TGYG+G+ S+VVPVFI EI
Sbjct  95   RIADYLGRKGSMRLAAVICIAGWVAVYFSKAAWSLDVGRFSTGYGIGLSSFVVPVFIGEI  154

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            APK LRG L TLNQL+IV G S  +++GT+VTWRTLALTG+ P +++ +GL  I
Sbjct  155  APKHLRGGLATLNQLLIVCGSSFVYIVGTIVTWRTLALTGLIPSILVLVGLFFI  208



>ref|XP_006433199.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
 gb|ESR46439.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
Length=361

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  271  IADFVGRKGQENAEN*T------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  432
            IAD++GR+G     +        I    K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWAIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  433  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G  PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_010666329.1| PREDICTED: sugar transporter ERD6-like 16 [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 13/186 (7%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
            ++D S T   MV  ST VAVCGS  FG+C GYS+PTQSAI  DLN S+A+YS FGSILT 
Sbjct  45   RDDSSIT---MVLFSTCVAVCGSFIFGTCVGYSAPTQSAIRADLNLSLAQYSTFGSILTI  101

Query  238  GAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGV  393
            GAM GA++SG IADF GRK          F ++         GA  ++IGRL +GYG+GV
Sbjct  102  GAMVGAVSSGRIADFSGRKQAMRMS--ACFCIMGWLAIYFATGARSLEIGRLFSGYGIGV  159

Query  394  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLG  573
             SYVVP+FIAEI+PK LRG LTTLNQLMIVTG SV+F++G+++ WR  ALTG+ PC+ L 
Sbjct  160  LSYVVPIFIAEISPKGLRGGLTTLNQLMIVTGSSVSFLVGSIICWRAFALTGLVPCITLL  219

Query  574  LGLCII  591
             GL ++
Sbjct  220  SGLFLV  225



>emb|CDY30026.1| BnaC01g39820D [Brassica napus]
Length=472

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 131/195 (67%), Gaps = 11/195 (6%)
 Frame = +1

Query  40   AAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIA  204
            + PL+  E+ S         WMV LSTF+AVCGS  FG+C GYS+PTQ  I ++LN S +
Sbjct  15   SEPLLLPENGSDVSEEEGASWMVCLSTFIAVCGSYEFGTCVGYSAPTQFGIMEELNLSYS  74

Query  205  EYSLFGSILTFGAMAGAITSGPIADFVGRKGQE------NAEN*TIFTLLKGALVMDIGR  366
            ++S+FGSIL  GA+ GAITSG I+DF+GRKG        +A    I    KG + +D GR
Sbjct  75   QFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWMIIYFSKGDIPLDFGR  134

Query  367  LATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALT  546
              TGYG G  SYVVPVFIAEI+P++LRGAL TLNQL +V G++  F+IG +V WR LALT
Sbjct  135  FLTGYGCGTLSYVVPVFIAEISPRKLRGALATLNQLFLVIGLASMFLIGAVVNWRALALT  194

Query  547  GIXPCVVLGLGLCII  591
            G+ PCV+L  G   I
Sbjct  195  GVVPCVILFFGTWFI  209



>ref|XP_009124970.1| PREDICTED: sugar transporter ERD6-like 8 [Brassica rapa]
 emb|CDY21102.1| BnaA01g33330D [Brassica napus]
Length=472

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 131/195 (67%), Gaps = 11/195 (6%)
 Frame = +1

Query  40   AAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIA  204
            + PL+  E+ S         WMV LSTF+AVCGS  FG+C GYS+PTQ  I ++LN S +
Sbjct  15   SEPLLLPENGSDVSEEEGASWMVCLSTFIAVCGSYEFGTCVGYSAPTQFGIMEELNLSYS  74

Query  205  EYSLFGSILTFGAMAGAITSGPIADFVGRKGQE------NAEN*TIFTLLKGALVMDIGR  366
            ++S+FGSIL  GA+ GAITSG I+DF+GRKG        +A    I    KG + +D GR
Sbjct  75   QFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWMIIYFSKGDIPLDFGR  134

Query  367  LATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALT  546
              TGYG G  SYVVPVFIAEI+P++LRGAL TLNQL +V G++  F+IG ++ WR LALT
Sbjct  135  FLTGYGCGTLSYVVPVFIAEISPRKLRGALATLNQLFLVIGLASMFLIGAVINWRALALT  194

Query  547  GIXPCVVLGLGLCII  591
            G+ PCV+L  G   I
Sbjct  195  GVVPCVILFFGTWFI  209



>ref|XP_004164629.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 16-like 
[Cucumis sativus]
Length=441

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 127/171 (74%), Gaps = 9/171 (5%)
 Frame = +1

Query  97   LSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIA  276
            +++ V++C  C F    GYS+PTQS I ++L+ S+ +YS+FGSILT GAM GA+TSGPIA
Sbjct  1    MNSLVSLC--CTF-DXVGYSAPTQSVIREELHLSLPQYSMFGSILTIGAMVGAVTSGPIA  57

Query  277  DFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPK  438
            DF+GRKG          T      L  GAL +D GR+ TGYG+GVFSYVVPVFIAEIAPK
Sbjct  58   DFIGRKGAMRVSATFCITGWLAVYLSTGALSLDSGRVLTGYGIGVFSYVVPVFIAEIAPK  117

Query  439  ELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             LRG LTTLNQLMIVTG S++F++GT++TWR LALTGI PCV L +GL  +
Sbjct  118  NLRGGLTTLNQLMIVTGASISFLLGTVITWRNLALTGIIPCVFLIVGLWFV  168



>ref|XP_006845808.1| hypothetical protein AMTR_s00019p00256320 [Amborella trichopoda]
 gb|ERN07483.1| hypothetical protein AMTR_s00019p00256320 [Amborella trichopoda]
Length=494

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 140/211 (66%), Gaps = 22/211 (10%)
 Frame = +1

Query  19   EGSTAGMAAPLI--GKEDDSKTDR----------WMVYLSTFVAVCGSCAFGSCAGYSSP  162
            +G  + +  PLI  GKE    TD           WMV LSTFVAV GS  FG   G+SSP
Sbjct  11   QGLQSDLKQPLISKGKEVILSTDSSSNGKDGGSIWMVLLSTFVAVAGSFEFGCAVGFSSP  70

Query  163  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--  336
            TQS+I  +L  ++AEYS+FGSILT G+M GA+ SG +AD +GRKG         F ++  
Sbjct  71   TQSSIRHELGLTLAEYSVFGSILTIGSMVGAVMSGRVADSIGRKGAMRISGG--FCMIGW  128

Query  337  ------KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  498
                  KG+  +DIGRLA GYG+GVFSYVVPV+IAEI PK LRG  TT+NQLMI TGVS 
Sbjct  129  LAIYYSKGSWSLDIGRLAVGYGIGVFSYVVPVYIAEITPKSLRGGFTTVNQLMICTGVSF  188

Query  499  AFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            A+++GT++TWR L LTG+ P +++ +GL ++
Sbjct  189  AYILGTVLTWRVLTLTGLIPMLIMLVGLFVV  219



>ref|XP_009603503.1| PREDICTED: sugar transporter ERD6-like 8 [Nicotiana tomentosiformis]
Length=229

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 134/205 (65%), Gaps = 17/205 (8%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKT----DRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  174
            NG+ E        PLI K D  +T    +  MVYLST VAVCGS AFG+C GYSSPTQ +
Sbjct  10   NGDTE-------KPLIVKHDADQTAHKEELVMVYLSTAVAVCGSYAFGTCVGYSSPTQFS  62

Query  175  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TI------FTLL  336
            I  +LN S ++YS+FGSILT GAM GAIT+G IAD +GRKG     +           L 
Sbjct  63   IMDELNLSYSQYSVFGSILTIGAMLGAITAGRIADLLGRKGAMRLSSVICSAGWLAIYLA  122

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
            K  +V+ +GR+ +GY +G+ SYVVP+F+ EI+P +LRGAL++ NQL IV G+S  +VIG 
Sbjct  123  KEPMVLYLGRVLSGYSIGIISYVVPMFVGEISPNKLRGALSSTNQLSIVIGLSAVYVIGA  182

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
             V WR LAL G+ PC +L LGL  I
Sbjct  183  FVGWRILALLGVVPCGLLFLGLFFI  207



>gb|KDO44991.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=456

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  271  IADFVGRKGQENAEN*T------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  432
            IAD++GR+G     +        I    K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWVIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  433  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G  PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_006471873.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X2 [Citrus 
sinensis]
Length=456

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  271  IADFVGRKGQENAEN*T------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  432
            IAD++GR+G     +        I    K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWAIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  433  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G  PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>gb|KDO44992.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=474

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  271  IADFVGRKGQENAEN*T------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  432
            IAD++GR+G     +        I    K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWVIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  433  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G  PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_006433198.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
 ref|XP_006471872.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X1 [Citrus 
sinensis]
 gb|ESR46438.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
Length=474

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  271  IADFVGRKGQENAEN*T------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  432
            IAD++GR+G     +        I    K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWAIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  433  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G  PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>emb|CBI34326.3| unnamed protein product [Vitis vinifera]
Length=874

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 132/202 (65%), Gaps = 11/202 (5%)
 Frame = +1

Query  19   EGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQ  183
            E     +  PLIG++ + +        W+V LST VAVCGS  FGSC GYS+P +  I  
Sbjct  411  EKGNDTITKPLIGQKKEVQIQSNNGGLWVVLLSTLVAVCGSFEFGSCVGYSAPAEYGIMD  470

Query  184  DLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TI----FT--LLKGA  345
            DL  S +EYS FGSILT GAM GAITSG IADF+GRKG     +       FT  L  G+
Sbjct  471  DLGISYSEYSFFGSILTIGAMIGAITSGQIADFIGRKGAMGMSSMICIAGWFTVYLSFGS  530

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
              +  GR   GYG+GV SYVVPVFIAEI PK LRGAL T NQL IVTG+ +A+VIG +VT
Sbjct  531  FSLYSGRFLLGYGIGVLSYVVPVFIAEITPKNLRGALATANQLFIVTGLFIAYVIGAIVT  590

Query  526  WRTLALTGIXPCVVLGLGLCII  591
            WR LALTGI PC+VL +GL  I
Sbjct  591  WRILALTGIVPCMVLLVGLFFI  612



>ref|XP_008795112.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Phoenix 
dactylifera]
Length=483

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 130/197 (66%), Gaps = 15/197 (8%)
 Frame = +1

Query  46   PLIGKEDDSKTDRW---------MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            PLI  ++  K +           +V  ST VAVCGS  FGSC GYS+PTQS I  D+  +
Sbjct  21   PLIQHKEVPKCEESCNENQGCIGVVLFSTAVAVCGSFEFGSCVGYSAPTQSGIINDIGLT  80

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDI  360
            +++YS+FGSILT GAM GAITSG IAD +GRKG                   + AL++  
Sbjct  81   LSQYSVFGSILTIGAMIGAITSGRIADLIGRKGAMRTSALICIIGWLAIYFAEDALMLYF  140

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR ++GYG+GV SYVVPVFIAEIAPK LRG LTTLNQL+I +G SVAF++GT VTWRTL 
Sbjct  141  GRFSSGYGIGVLSYVVPVFIAEIAPKNLRGGLTTLNQLLICSGGSVAFIVGTFVTWRTLV  200

Query  541  LTGIXPCVVLGLGLCII  591
            L G+ PCVVL  GL  I
Sbjct  201  LIGLIPCVVLLAGLFFI  217



>ref|XP_010912096.1| PREDICTED: sugar transporter ERD6-like 16 [Elaeis guineensis]
Length=483

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 128/197 (65%), Gaps = 15/197 (8%)
 Frame = +1

Query  46   PLIGKEDDSKTDRW---------MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFS  198
            PLI  + + K             +V  ST VAVCGS  FG+C GYS+PTQS I  D+  +
Sbjct  21   PLIQHKKEPKCQESCNENQGCIGVVLFSTAVAVCGSFEFGTCVGYSAPTQSGIINDIGLT  80

Query  199  IAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDI  360
            +++YS+FGSILT GAM GAITSG IAD +GRKG                   K AL++  
Sbjct  81   LSQYSVFGSILTIGAMIGAITSGRIADLIGRKGAMRTSALICMVGWLAIYFAKDALMLYF  140

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR ++GYG+GV SYVVPVFIAEIAPK LRG LTTLNQL+I  G +VAF++GT VTWRTL 
Sbjct  141  GRFSSGYGIGVLSYVVPVFIAEIAPKNLRGGLTTLNQLLICAGSAVAFIVGTFVTWRTLV  200

Query  541  LTGIXPCVVLGLGLCII  591
            L G+ PC+VL  GL  I
Sbjct  201  LIGLIPCLVLLAGLFFI  217



>gb|KJB82599.1| hypothetical protein B456_013G203800 [Gossypium raimondii]
Length=410

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 129/203 (64%), Gaps = 11/203 (5%)
 Frame = +1

Query  16   NEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
             +GS+  +  P   K++  +        +MV L TFVAV GSC FGS  GYSSPTQ  I 
Sbjct  8    EKGSSGSLYQPFFHKDEKQQNSHDNGNLFMVILCTFVAVMGSCEFGSSIGYSSPTQQGIM  67

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*T------IFTLLKG  342
            ++L  S  EYS+FGSILT GAM G+I+ G  AD +GRKG     +        I  L  G
Sbjct  68   EELGMSSEEYSMFGSILTIGAMVGSISCGRAADLIGRKGTMKMSSIISIAGWLIIYLSLG  127

Query  343  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  522
             L +D+GR  TGYG+GV SYVVPVFIAEI P  LRGAL T++Q+ I TG+ VA+ +G  V
Sbjct  128  PLSLDVGRFLTGYGIGVNSYVVPVFIAEITPTHLRGALLTVHQVAIATGLLVAYAVGAFV  187

Query  523  TWRTLALTGIXPCVVLGLGLCII  591
            +WRTLALTG+ PC V+ LGL  I
Sbjct  188  SWRTLALTGMIPCAVMILGLYFI  210



>ref|XP_010070279.1| PREDICTED: sugar transporter ERD6-like 7 isoform X3 [Eucalyptus 
grandis]
Length=459

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 131/200 (66%), Gaps = 21/200 (11%)
 Frame = +1

Query  7    NGENEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+ EG    +  P      GK++     R WMVY +TFVAVCGS  FG+CAGYSSPTQ 
Sbjct  12   TGDREGIRERLLVPQEKDRAGKDEGIDKGRPWMVYFTTFVAVCGSYEFGTCAGYSSPTQD  71

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLLKGALV  351
            AI ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK          +T+   + +
Sbjct  72   AIVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRK----------WTMRIASAL  121

Query  352  MDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWR  531
               G LA      ++   VP+FIAEI PK LRGALT +NQLMIV GVSV+F+IGT++ WR
Sbjct  122  CVAGWLA------IYFAEVPIFIAEITPKNLRGALTAVNQLMIVAGVSVSFIIGTVLAWR  175

Query  532  TLALTGIXPCVVLGLGLCII  591
             LAL G+ PC VL  GL  I
Sbjct  176  VLALIGLIPCAVLLFGLFFI  195



>ref|XP_010649823.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Vitis vinifera]
 emb|CBI26145.3| unnamed protein product [Vitis vinifera]
 gb|ADP37171.1| putative ERD6-like transporter [Vitis vinifera]
Length=488

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 134/194 (69%), Gaps = 18/194 (9%)
 Frame = +1

Query  58   KEDDSKTDR--------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYS  213
            +EDD  T R         +V+LST VAV GS  FG C  YSSPTQ+AI +DLN S+AEYS
Sbjct  28   EEDDDLTPRNTSQNGSLGVVWLSTTVAVWGSFQFGCCVHYSSPTQTAIRKDLNLSLAEYS  87

Query  214  LFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRL  369
            +F SIL  GAM G ITSG I++F+GRKG        IF ++        +G L++DIGR+
Sbjct  88   VFASILAIGAMIGGITSGHISNFIGRKGTMRVA--AIFCIIGWLAIGFAEGVLLLDIGRM  145

Query  370  ATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTG  549
             TGYG+GVFSYVVPVFIAEIAPK+LRG  T+ N+LMI  G S+ +++GT++TWR LAL G
Sbjct  146  CTGYGIGVFSYVVPVFIAEIAPKDLRGGFTSSNELMIQVGGSITYLLGTVLTWRMLALVG  205

Query  550  IXPCVVLGLGLCII  591
            + P ++L LG+  +
Sbjct  206  LIPSLMLILGMFFV  219



>ref|XP_010660044.1| PREDICTED: sugar transporter ERD6-like 8 isoform X3 [Vitis vinifera]
 ref|XP_010660045.1| PREDICTED: sugar transporter ERD6-like 8 isoform X3 [Vitis vinifera]
 gb|ADP37167.1| putative ERD6-like transporter [Vitis vinifera]
Length=474

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 133/207 (64%), Gaps = 15/207 (7%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDDSKTD-------RWMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
            E E   A +  PLI +E   +           MV LS FVAVCGS  FGSCAGYS+P Q 
Sbjct  6    EVEKGNANITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSFEFGSCAGYSAPAQY  65

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFT  330
             I  +L  S ++YS+FGSIL+ GAM GAI+SG IAD +GRKG     +        T++ 
Sbjct  66   GIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGRKGAMRMSSMVCIAGWITVY-  124

Query  331  LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVI  510
            L  G++ +D GR   GYG+G+ SYV+PVFIAEI PK  RG L T NQL IVTG+ +AFV+
Sbjct  125  LSFGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQLFIVTGLFIAFVV  184

Query  511  GTMVTWRTLALTGIXPCVVLGLGLCII  591
            G  VTWRTLALTGI PC+VL +GL  I
Sbjct  185  GAFVTWRTLALTGILPCMVLLVGLFFI  211



>gb|KDP26380.1| hypothetical protein JCGZ_17538 [Jatropha curcas]
Length=519

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 128/185 (69%), Gaps = 8/185 (4%)
 Frame = +1

Query  58   KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  237
             E+++     MV LS FVAVCGS   G C GYSSPTQSAI +DLN S ++YS+FGSIL  
Sbjct  58   NEEETTGSIGMVLLSVFVAVCGSIEMGCCVGYSSPTQSAIMKDLNLSTSQYSVFGSILPI  117

Query  238  GAMAGAITSGPIADFVGRKGQEN-------AEN*TIFTLLKGALVMDIGRLATGYGMGVF  396
            GAM GA TSG IAD +GRKG          A    +F   +    +D+GR  TGYG+GVF
Sbjct  118  GAMFGAFTSGRIADHIGRKGAMRMSAGFCIAGWLAVF-FSEQNFSLDMGRFVTGYGIGVF  176

Query  397  SYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGL  576
            S+VVPVFIAEI+PK LRG LT LNQL+ +TG S AF++G++++WR LALTG+ PC+ L +
Sbjct  177  SFVVPVFIAEISPKNLRGGLTALNQLLNITGASTAFLLGSVISWRALALTGLVPCIFLLI  236

Query  577  GLCII  591
            GL  +
Sbjct  237  GLFFV  241



>ref|XP_006838267.1| hypothetical protein AMTR_s00103p00071860 [Amborella trichopoda]
 gb|ERN00836.1| hypothetical protein AMTR_s00103p00071860 [Amborella trichopoda]
Length=481

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = +1

Query  67   DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  246
            D +    MV LSTFVAVCGS  FG   G+SSPTQSAI  +L  S+ EYS+F SILT GAM
Sbjct  35   DKEGSVLMVLLSTFVAVCGSFQFGCALGFSSPTQSAIRNELGLSLYEYSVFASILTIGAM  94

Query  247  AGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSY  402
             GA+  G +AD+ GRKG        IF L         K A ++D+GRL+ GYG+GVFSY
Sbjct  95   VGALMCGSLADYTGRKGAMRIA--AIFCLTGWVATGVSKDAWILDLGRLSVGYGIGVFSY  152

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            VVPV+IAE+APK+LRG L T+NQLM+  G+S  +++GT++TWRTL LTGI P ++L LGL
Sbjct  153  VVPVYIAEVAPKDLRGGLGTMNQLMVGFGISTVYLLGTILTWRTLTLTGIIPSLMLQLGL  212

Query  583  CII  591
             +I
Sbjct  213  ILI  215



>ref|XP_010660043.1| PREDICTED: sugar transporter ERD6-like 8 isoform X2 [Vitis vinifera]
Length=492

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 133/207 (64%), Gaps = 15/207 (7%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDDSKTD-------RWMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
            E E   A +  PLI +E   +           MV LS FVAVCGS  FGSCAGYS+P Q 
Sbjct  29   EVEKGNANITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSFEFGSCAGYSAPAQY  88

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFT  330
             I  +L  S ++YS+FGSIL+ GAM GAI+SG IAD +GRKG     +        T++ 
Sbjct  89   GIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGRKGAMRMSSMVCIAGWITVY-  147

Query  331  LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVI  510
            L  G++ +D GR   GYG+G+ SYV+PVFIAEI PK  RG L T NQL IVTG+ +AFV+
Sbjct  148  LSFGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQLFIVTGLFIAFVV  207

Query  511  GTMVTWRTLALTGIXPCVVLGLGLCII  591
            G  VTWRTLALTGI PC+VL +GL  I
Sbjct  208  GAFVTWRTLALTGILPCMVLLVGLFFI  234



>ref|XP_010660042.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Vitis vinifera]
Length=497

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 133/207 (64%), Gaps = 15/207 (7%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDDSKTD-------RWMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
            E E   A +  PLI +E   +           MV LS FVAVCGS  FGSCAGYS+P Q 
Sbjct  29   EVEKGNANITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSFEFGSCAGYSAPAQY  88

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFT  330
             I  +L  S ++YS+FGSIL+ GAM GAI+SG IAD +GRKG     +        T++ 
Sbjct  89   GIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGRKGAMRMSSMVCIAGWITVY-  147

Query  331  LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVI  510
            L  G++ +D GR   GYG+G+ SYV+PVFIAEI PK  RG L T NQL IVTG+ +AFV+
Sbjct  148  LSFGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQLFIVTGLFIAFVV  207

Query  511  GTMVTWRTLALTGIXPCVVLGLGLCII  591
            G  VTWRTLALTGI PC+VL +GL  I
Sbjct  208  GAFVTWRTLALTGILPCMVLLVGLFFI  234



>ref|XP_011023524.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Populus 
euphratica]
Length=381

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSILT GAM GAI SG
Sbjct  36   MVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSILTIGAMIGAIMSG  95

Query  268  PIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             IAD++GR+G              + T  K +  +D+GRL  GYGMG+ SYV+PV+IAEI
Sbjct  96   RIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGLLSYVIPVYIAEI  155

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             PK LRG  TT++QLMI  GVS+ ++IG  V+WR LAL G  PC+V  +GL  I
Sbjct  156  TPKNLRGGFTTVHQLMICCGVSITYLIGAFVSWRILALIGTIPCIVQIVGLFFI  209



>ref|XP_002512323.1| sugar transporter, putative [Ricinus communis]
 gb|EEF49775.1| sugar transporter, putative [Ricinus communis]
Length=488

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 124/176 (70%), Gaps = 10/176 (6%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            +V +ST +AV GS  FGS  GYSSPTQS I QDL+ S+AEYSLFGSILT GAM GAI SG
Sbjct  47   VVVMSTLIAVSGSYVFGSAVGYSSPTQSGIMQDLDLSVAEYSLFGSILTIGAMIGAIMSG  106

Query  268  PIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIA  423
             IAD++GR+G        IF ++        K +L +D+GRL  GYGMG+ SYVVPV+IA
Sbjct  107  RIADYIGRRGTMGFSE--IFCIIGWLAIAFSKVSLWLDVGRLLVGYGMGLLSYVVPVYIA  164

Query  424  EIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            EI PK LRG  TT++Q MI  GVSV ++IG  ++WRTLAL G  PC++  LGL +I
Sbjct  165  EITPKNLRGGFTTVHQFMICCGVSVTYLIGAFISWRTLALIGTIPCLIQLLGLFLI  220



>ref|XP_010070295.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
Length=233

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 116/169 (69%), Gaps = 11/169 (7%)
 Frame = +1

Query  10   GENEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  174
            G+ EG    +  P      GK++ +   R WMVY + FVAVCGS  FG+CAGYSSPTQ A
Sbjct  13   GDREGVRERLLVPQEKDRAGKDEGTDKGRPWMVYFTPFVAVCGSYEFGTCAGYSSPTQDA  72

Query  175  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------LL  336
            I ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK      +             
Sbjct  73   IVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASALCVAGWLAIYFA  132

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  483
            +GAL +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQ  I+
Sbjct  133  EGALALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQAKIL  181



>ref|XP_006375782.1| hypothetical protein POPTR_0013s02850g [Populus trichocarpa]
 gb|ERP53579.1| hypothetical protein POPTR_0013s02850g [Populus trichocarpa]
Length=409

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSILT GAM GAI SG
Sbjct  36   MVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSILTIGAMIGAIMSG  95

Query  268  PIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             IAD++GR+G              + T  K +  +D+GRL  GYGMG+ SYV+P++IAEI
Sbjct  96   RIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGLLSYVIPIYIAEI  155

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             PK LRG  TT++QLMI  GVS+ ++IG  ++WR+LAL G  PC+V  +GL  I
Sbjct  156  TPKNLRGGFTTVHQLMICCGVSITYLIGAFMSWRSLALIGTIPCIVQIVGLFFI  209



>emb|CBI34327.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 133/207 (64%), Gaps = 15/207 (7%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDDSKTD-------RWMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
            E E   A +  PLI +E   +           MV LS FVAVCGS  FGSCAGYS+P Q 
Sbjct  134  EVEKGNANITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSFEFGSCAGYSAPAQY  193

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*-------TIFT  330
             I  +L  S ++YS+FGSIL+ GAM GAI+SG IAD +GRKG     +        T++ 
Sbjct  194  GIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGRKGAMRMSSMVCIAGWITVY-  252

Query  331  LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVI  510
            L  G++ +D GR   GYG+G+ SYV+PVFIAEI PK  RG L T NQL IVTG+ +AFV+
Sbjct  253  LSFGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQLFIVTGLFIAFVV  312

Query  511  GTMVTWRTLALTGIXPCVVLGLGLCII  591
            G  VTWRTLALTGI PC+VL +GL  I
Sbjct  313  GAFVTWRTLALTGILPCMVLLVGLFFI  339



>ref|XP_011023522.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Populus 
euphratica]
Length=477

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSILT GAM GAI SG
Sbjct  36   MVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSILTIGAMIGAIMSG  95

Query  268  PIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             IAD++GR+G              + T  K +  +D+GRL  GYGMG+ SYV+PV+IAEI
Sbjct  96   RIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGLLSYVIPVYIAEI  155

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             PK LRG  TT++QLMI  GVS+ ++IG  V+WR LAL G  PC+V  +GL  I
Sbjct  156  TPKNLRGGFTTVHQLMICCGVSITYLIGAFVSWRILALIGTIPCIVQIVGLFFI  209



>ref|XP_002512320.1| sugar transporter, putative [Ricinus communis]
 gb|EEF49772.1| sugar transporter, putative [Ricinus communis]
Length=455

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 120/183 (66%), Gaps = 17/183 (9%)
 Frame = +1

Query  52   IGKEDDSKT---DRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFG  222
            IG++ +S+    D  MV  ST +A+CGS  FG C GYS+PTQ  I  DL+ S +EYS+FG
Sbjct  25   IGRKQESEKNGGDLGMVLFSTAIAICGSFVFGCCVGYSAPTQFGIMNDLSLSYSEYSVFG  84

Query  223  SILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLLKGALVMDIGRLATGYGMGVFSY  402
            SIL  GAM GAITSG IAD VGRKG              G L +D GR  TGYG+GV SY
Sbjct  85   SILNIGAMIGAITSGRIADSVGRKG--------------GPLFLDFGRFLTGYGIGVISY  130

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGL  582
            VVPVFIAEI PKELRG L T NQ  IV G+ V + IG +V WR LA+TG  PC+++ +GL
Sbjct  131  VVPVFIAEITPKELRGTLATANQFFIVVGIMVIYSIGALVNWRILAITGTIPCLIVIIGL  190

Query  583  CII  591
              I
Sbjct  191  FFI  193



>ref|XP_006375783.1| hypothetical protein POPTR_0013s02850g [Populus trichocarpa]
 gb|ERP53580.1| hypothetical protein POPTR_0013s02850g [Populus trichocarpa]
Length=447

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSILT GAM GAI SG
Sbjct  36   MVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSILTIGAMIGAIMSG  95

Query  268  PIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             IAD++GR+G              + T  K +  +D+GRL  GYGMG+ SYV+P++IAEI
Sbjct  96   RIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGLLSYVIPIYIAEI  155

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             PK LRG  TT++QLMI  GVS+ ++IG  ++WR+LAL G  PC+V  +GL  I
Sbjct  156  TPKNLRGGFTTVHQLMICCGVSITYLIGAFMSWRSLALIGTIPCIVQIVGLFFI  209



>ref|XP_002319570.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE95493.2| sugar transporter family protein [Populus trichocarpa]
Length=477

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSILT GAM GAI SG
Sbjct  36   MVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSILTIGAMIGAIMSG  95

Query  268  PIADFVGRKGQENAEN*------TIFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
             IAD++GR+G              + T  K +  +D+GRL  GYGMG+ SYV+P++IAEI
Sbjct  96   RIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGLLSYVIPIYIAEI  155

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
             PK LRG  TT++QLMI  GVS+ ++IG  ++WR+LAL G  PC+V  +GL  I
Sbjct  156  TPKNLRGGFTTVHQLMICCGVSITYLIGAFMSWRSLALIGTIPCIVQIVGLFFI  209



>ref|XP_010649825.1| PREDICTED: sugar transporter ERD6-like 16 isoform X3 [Vitis vinifera]
Length=461

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 134/198 (68%), Gaps = 22/198 (11%)
 Frame = +1

Query  58   KEDDSKTDR--------WMVYLSTFVAVCGSCAFGSC----AGYSSPTQSAISQDLNFSI  201
            +EDD  T R         +V+LST VAV GS  FG C      YSSPTQ+AI +DLN S+
Sbjct  28   EEDDDLTPRNTSQNGSLGVVWLSTTVAVWGSFQFGCCLNLQVHYSSPTQTAIRKDLNLSL  87

Query  202  AEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMD  357
            AEYS+F SIL  GAM G ITSG I++F+GRKG        IF ++        +G L++D
Sbjct  88   AEYSVFASILAIGAMIGGITSGHISNFIGRKGTMRVA--AIFCIIGWLAIGFAEGVLLLD  145

Query  358  IGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTL  537
            IGR+ TGYG+GVFSYVVPVFIAEIAPK+LRG  T+ N+LMI  G S+ +++GT++TWR L
Sbjct  146  IGRMCTGYGIGVFSYVVPVFIAEIAPKDLRGGFTSSNELMIQVGGSITYLLGTVLTWRML  205

Query  538  ALTGIXPCVVLGLGLCII  591
            AL G+ P ++L LG+  +
Sbjct  206  ALVGLIPSLMLILGMFFV  223



>ref|XP_010244606.1| PREDICTED: sugar transporter ERD6-like 16 [Nelumbo nucifera]
Length=392

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 117/173 (68%), Gaps = 23/173 (13%)
 Frame = +1

Query  61   EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  240
            +  + +DRW+                   GY +PTQSAI  DL+ S+AEYSLFGSILT G
Sbjct  58   QRKTSSDRWL-----------------QVGYLAPTQSAIRDDLDLSLAEYSLFGSILTIG  100

Query  241  AMAGAITSGPIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSY  402
             MAGAI SG I DF+GRKG          T        KGAL +D+GR+ TGYG+GVFSY
Sbjct  101  GMAGAIMSGRIVDFIGRKGAMRMSAAFCITGWLAVYFSKGALSLDVGRIFTGYGIGVFSY  160

Query  403  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPC  561
            VVPV+IAEIAPK+LRG LTT+NQLMIVTG SVAF+IGT+V+WRTL + G+ PC
Sbjct  161  VVPVYIAEIAPKDLRGGLTTVNQLMIVTGSSVAFLIGTVVSWRTLVIDGLIPC  213



>ref|XP_010649824.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Vitis vinifera]
Length=472

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 134/198 (68%), Gaps = 22/198 (11%)
 Frame = +1

Query  58   KEDDSKTDR--------WMVYLSTFVAVCGSCAFGSC----AGYSSPTQSAISQDLNFSI  201
            +EDD  T R         +V+LST VAV GS  FG C      YSSPTQ+AI +DLN S+
Sbjct  28   EEDDDLTPRNTSQNGSLGVVWLSTTVAVWGSFQFGCCLNLQVHYSSPTQTAIRKDLNLSL  87

Query  202  AEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMD  357
            AEYS+F SIL  GAM G ITSG I++F+GRKG        IF ++        +G L++D
Sbjct  88   AEYSVFASILAIGAMIGGITSGHISNFIGRKGTMRVA--AIFCIIGWLAIGFAEGVLLLD  145

Query  358  IGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTL  537
            IGR+ TGYG+GVFSYVVPVFIAEIAPK+LRG  T+ N+LMI  G S+ +++GT++TWR L
Sbjct  146  IGRMCTGYGIGVFSYVVPVFIAEIAPKDLRGGFTSSNELMIQVGGSITYLLGTVLTWRML  205

Query  538  ALTGIXPCVVLGLGLCII  591
            AL G+ P ++L LG+  +
Sbjct  206  ALVGLIPSLMLILGMFFV  223



>ref|XP_007030767.1| Sugar transporter, putative [Theobroma cacao]
 gb|EOY11269.1| Sugar transporter, putative [Theobroma cacao]
Length=471

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 130/202 (64%), Gaps = 11/202 (5%)
 Frame = +1

Query  19   EGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQ  183
            E  +A +  P   KE++ +        +MV LSTFVAV GS  FGS  G+SSPTQ A  +
Sbjct  8    ENGSASLLQPFTQKEENQQNSHGNGSLFMVLLSTFVAVMGSFEFGSSIGFSSPTQQATME  67

Query  184  DLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*T------IFTLLKGA  345
            +L  S +E+S+FGSILT GAM GAITSG  AD +GR       +        I  L  G 
Sbjct  68   ELEMSPSEFSVFGSILTIGAMVGAITSGRAADLIGRIETMRMSSIICITGWLIIYLALGT  127

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
            L ++ GR  TG+G+GV SYVVP+FIAEI P  LRGAL TL+Q+ + TG+ VA+ +G +VT
Sbjct  128  LSLNFGRFLTGFGIGVNSYVVPIFIAEITPTHLRGALLTLHQVSLATGLLVAYAVGALVT  187

Query  526  WRTLALTGIXPCVVLGLGLCII  591
            WRTLALTG+ PC V+ +GLC I
Sbjct  188  WRTLALTGMIPCAVMIIGLCFI  209



>gb|KJB45167.1| hypothetical protein B456_007G293200 [Gossypium raimondii]
Length=487

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 130/205 (63%), Gaps = 14/205 (7%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDD----SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
              E    G+     G+E D    + +   MV LST VAVCGS  FG+  GYSSP Q+ I+
Sbjct  17   HKEKPRDGVVHGFSGEEQDGIKTTSSATTMVVLSTSVAVCGSYVFGTAIGYSSPAQTGIT  76

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------  336
             DL+ S+AEYS FGSILT GAM GA+ SG +AD++GRK         IF ++        
Sbjct  77   DDLDLSVAEYSFFGSILTIGAMIGAVMSGRLADYIGRKRTMGFSE--IFCIIGWLLILFS  134

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
            K AL +D GR+  GYGMG+ SYVVPV+IAE+ PK++RG  T+++QLMI  GVS+ ++IG 
Sbjct  135  KSALWLDFGRMLVGYGMGLLSYVVPVYIAEVTPKDIRGGFTSVHQLMICCGVSITYLIGA  194

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
              TWRTLAL G  PC++  LGL  I
Sbjct  195  FATWRTLALIGTIPCLIQLLGLFFI  219



>dbj|BAH01094.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52442.1| hypothetical protein OsJ_34588 [Oryza sativa Japonica Group]
Length=462

 Score =   184 bits (466),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 122/175 (70%), Gaps = 8/175 (5%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV  ST VAV GS  FG   GYS+PTQS I +DL  S++EYS+FGSI+T GAM GA+ SG
Sbjct  23   MVIASTGVAVLGSFVFGVSIGYSAPTQSKIREDLQLSLSEYSVFGSIITIGAMIGAVASG  82

Query  268  PIADFVGRKGQENAEN*T-------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
             +AD  GRKG               IF   +GA+ +D GR  TG+G+GVFSYVVPVFIAE
Sbjct  83   HLADISGRKGAMRTSALVCIVGWLAIF-FAQGAVSLDFGRFCTGFGVGVFSYVVPVFIAE  141

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IAPK LRG LTTLNQL++ TG+SV +++GTMVTWR L + G+ P ++L +GL  I
Sbjct  142  IAPKALRGGLTTLNQLLVCTGLSVTYIVGTMVTWRMLVIAGLVPSIILIVGLSFI  196



>ref|XP_003575758.2| PREDICTED: sugar transporter ERD6-like 16 [Brachypodium distachyon]
Length=440

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 124/175 (71%), Gaps = 8/175 (5%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV+ ST VAV GS A+G   GYS+PTQ+ I QDL  +++EYS+FGS++T GAM GA+ SG
Sbjct  1    MVFASTGVAVLGSFAYGVAIGYSAPTQAEIRQDLQLTLSEYSVFGSVITIGAMIGAVASG  60

Query  268  PIADFVGRKGQENAEN*T-------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
             IAD  GRKG   A           IF   + A  +D GR  TG+G+GVFSYVVPVFIAE
Sbjct  61   QIADVAGRKGAMRASALVCIVGWLAIF-FAQSAASLDFGRFCTGFGVGVFSYVVPVFIAE  119

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IAPK LRG LTTLNQL++ TG+SV +++GT+V+WR L + G+ PC++L +GL  I
Sbjct  120  IAPKALRGGLTTLNQLLVCTGLSVTYIVGTVVSWRMLVIAGLVPCMILIVGLFFI  174



>gb|KDP23561.1| hypothetical protein JCGZ_23394 [Jatropha curcas]
Length=485

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 119/175 (68%), Gaps = 10/175 (6%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V ++T +AV GS  FGS  GYSSPTQS I  DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  45   VVVTTLIAVSGSYVFGSAIGYSSPTQSGIMDDLGLSVAEYSLFGSILTIGAMVGAIMSGR  104

Query  271  IADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
            IAD++GR+G        IF ++        K +  +D+GR+  GYGMG+ SYVVPVFIAE
Sbjct  105  IADYIGRRGIMGFSE--IFCIIGWLAIAFSKASWWLDVGRMLVGYGMGLLSYVVPVFIAE  162

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            I PK LRG  TT++QLMI  GVSV ++IG  V+WR LAL G  PC+V  LGL  I
Sbjct  163  ITPKNLRGGFTTVHQLMICCGVSVTYLIGAFVSWRILALVGTIPCLVQLLGLFFI  217



>ref|XP_002894602.1| hypothetical protein ARALYDRAFT_474748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70861.1| hypothetical protein ARALYDRAFT_474748 [Arabidopsis lyrata subsp. 
lyrata]
Length=470

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 135/206 (66%), Gaps = 12/206 (6%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGKE--DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
            + GE + +       LI KE  D S T    + L+TFVAV GS  FGS  GYSSP QS +
Sbjct  1    MKGEIDEANLAPETSLIEKENQDSSATTTTTLLLTTFVAVSGSFVFGSAIGYSSPVQSDL  60

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL-------  336
            ++DLN S+AEYSLFGSILT GAM GA  SG IAD +GR+         +F +L       
Sbjct  61   TKDLNLSVAEYSLFGSILTIGAMIGAAMSGRIADLIGRRATMGFSE--MFCILGWLTIYL  118

Query  337  -KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             K A+ +D+GR   GYGMGV S+VVPV+IAEI PK+LRG  TT++QLMI  GVSVA+++G
Sbjct  119  SKVAVWLDVGRFLVGYGMGVLSFVVPVYIAEITPKDLRGGFTTVHQLMICLGVSVAYLLG  178

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            + + WR LAL G+ PCV+  +GL II
Sbjct  179  SFIGWRILALIGLVPCVIQMMGLFII  204



>ref|XP_004248997.1| PREDICTED: sugar transporter ERD6-like 8 [Solanum lycopersicum]
Length=520

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 130/199 (65%), Gaps = 9/199 (5%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            EN+    G    LI K  +   + +MVY ST VAVCGS AFG+C GYSSPTQ +I  +L+
Sbjct  62   ENKMEENGHKEHLIVKHRE---ELFMVYFSTVVAVCGSYAFGTCVGYSSPTQFSIMDELS  118

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TI------FTLLKGALVM  354
             S ++YS+FGSILT GAM GAIT G IADF+GRKG     +           L K  +V+
Sbjct  119  LSFSQYSIFGSILTTGAMLGAITGGRIADFLGRKGAMRLSSVICGAGWLAIYLAKEPMVL  178

Query  355  DIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRT  534
             +GR   GY +G+ SYVVP+F+ EI+P +LRGAL++ NQL IV G+S A+V+G  V WR 
Sbjct  179  YLGRFLAGYSIGIISYVVPMFVGEISPNKLRGALSSTNQLSIVIGLSTAYVMGAFVGWRI  238

Query  535  LALTGIXPCVVLGLGLCII  591
            LAL G+ PC +L LGL  I
Sbjct  239  LALLGVIPCGLLFLGLFFI  257



>ref|XP_002278654.3| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Vitis vinifera]
 gb|ADP37172.1| putative ERD6-like transporter [Vitis vinifera]
Length=488

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 133/197 (68%), Gaps = 18/197 (9%)
 Frame = +1

Query  49   LIGKEDD--------SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIA  204
            +I +EDD         K    + +LST +AV GS  FG C  Y+SPTQ+AI +DLN S+A
Sbjct  25   IISEEDDDLKPENPSQKGSPGVEWLSTAIAVWGSFQFGCCVHYTSPTQTAIRKDLNLSLA  84

Query  205  EYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDI  360
            EYS+F S+L  GAM G +TSG I+D +GRKG         F ++        +G L++D+
Sbjct  85   EYSVFASVLAIGAMIGGLTSGHISDLIGRKGTMRVA--AAFCIVGWLAIGFTEGVLLLDL  142

Query  361  GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA  540
            GR+ TGYG+G+FSYVVPVFIAEIAPK+LRG  T+LN+LMI  G S+ +++GT++TWR LA
Sbjct  143  GRMCTGYGIGIFSYVVPVFIAEIAPKDLRGGFTSLNELMIQVGGSITYLLGTVLTWRMLA  202

Query  541  LTGIXPCVVLGLGLCII  591
            L G+ P ++L LG+  +
Sbjct  203  LVGLIPSLMLILGMFFV  219



>ref|XP_006663074.1| PREDICTED: sugar transporter ERD6-like 16-like [Oryza brachyantha]
Length=463

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 121/175 (69%), Gaps = 8/175 (5%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV  ST VAV GS  FG   GYS+PTQS I +DL  S++EYS+FGSI+T GAM GA+ SG
Sbjct  23   MVIASTGVAVLGSFVFGVSIGYSAPTQSKIREDLQLSLSEYSVFGSIITIGAMIGAVASG  82

Query  268  PIADFVGRKGQENAEN*T-------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
             +AD  GRKG   A           IF   + A+ +D GR  TG+G+GVFSYVVPVFIAE
Sbjct  83   HLADVTGRKGAMRASALACIVGWLAIF-FAQSAVSLDFGRFCTGFGVGVFSYVVPVFIAE  141

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IAPK LRG LTTLNQL++ TG+SV +++GTMVTWR L + G+ P + L +GL  I
Sbjct  142  IAPKALRGGLTTLNQLLVCTGLSVTYIVGTMVTWRMLVIAGLVPSIALIIGLFFI  196



>ref|XP_010070291.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Eucalyptus 
grandis]
Length=459

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 124/206 (60%), Gaps = 33/206 (16%)
 Frame = +1

Query  7    NGENEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQS  171
             G+ EG    +  P      GK++ +   R WMVY +TF+AVCGS  FG+CAGYSSPTQ 
Sbjct  12   TGDREGVRERLLVPQEKDRAGKDEGTDKVRPWMVYFTTFIAVCGSYEFGTCAGYSSPTQD  71

Query  172  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT------L  333
            AI ++L  S AEYS+FGSILTFGAM GAIT GPIADFVGRK      +            
Sbjct  72   AIVEELGLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASALCVAGWLAIYF  131

Query  334  LKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             +G L +DIGRLATGYGMGVFSYV                      LMIV GVSV+F+IG
Sbjct  132  AEGELALDIGRLATGYGMGVFSYV----------------------LMIVAGVSVSFIIG  169

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            T++ WR LAL G+ PC VL  GL  I
Sbjct  170  TVLAWRVLALIGLIPCAVLLFGLFFI  195



>gb|KCW58929.1| hypothetical protein EUGRSUZ_H015511, partial [Eucalyptus grandis]
Length=277

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 115/180 (64%), Gaps = 12/180 (7%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MVY +TFVAVCGS  FG+CAGYSSPTQ AI ++L  S AEYS+FGSILTFG M GAIT G
Sbjct  1    MVYFTTFVAVCGSHEFGTCAGYSSPTQDAIVEELGLSTAEYSVFGSILTFGVMIGAITGG  60

Query  268  PIADFVGRKGQENAEN*TIFT------LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  429
            PIADFVGRK      +             +GAL +DIGRLATGYGMGVFSYVVP+FIAEI
Sbjct  61   PIADFVGRKWTMRIASALCVAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPIFIAEI  120

Query  430  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA------LTGIXPCVVLGLGLCII  591
             PK LRGALT + Q  I+   S   +       + LA      L  + PC VL  GL  I
Sbjct  121  TPKNLRGALTAVKQAKILYEHSWLELQAWSYWQKALACSKFCPLASLIPCAVLLFGLFFI  180



>gb|KHG12383.1| hypothetical protein F383_10647 [Gossypium arboreum]
Length=476

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 119/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  88   MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  267
            MV LSTFVAVCGS  FG+  GYSSP Q+ I+ DL  S+AEYS FGSILT GAM GA+ SG
Sbjct  46   MVVLSTFVAVCGSYVFGTAIGYSSPAQTGITDDLGLSVAEYSFFGSILTIGAMIGAVMSG  105

Query  268  PIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIA  423
             IAD++GRK         IF ++        K A  +D GR+  G GMG+ SYVVPV+IA
Sbjct  106  RIADYIGRKCTMGFSE--IFCIIGWLLILFSKAAFWLDFGRMLVGCGMGLLSYVVPVYIA  163

Query  424  EIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            E+ PK++RG  T+++QLMI  GVS+ ++IG   TWRTLAL G  PC++  LGL  I
Sbjct  164  EVTPKDIRGGFTSVHQLMICCGVSITYLIGAFATWRTLALIGTIPCLMQLLGLFFI  219



>gb|KHG12382.1| hypothetical protein F383_10647 [Gossypium arboreum]
Length=493

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 128/205 (62%), Gaps = 14/205 (7%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDD----SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  180
              E    G+     G+E D    + +   MV LSTFVAVCGS  FG+  GYSSP Q+ I+
Sbjct  17   HKEKPRDGVVHGFSGEELDGIKTTSSATTMVVLSTFVAVCGSYVFGTAIGYSSPAQTGIT  76

Query  181  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------  336
             DL  S+AEYS FGSILT GAM GA+ SG IAD++GRK         IF ++        
Sbjct  77   DDLGLSVAEYSFFGSILTIGAMIGAVMSGRIADYIGRKCTMGFSE--IFCIIGWLLILFS  134

Query  337  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  516
            K A  +D GR+  G GMG+ SYVVPV+IAE+ PK++RG  T+++QLMI  GVS+ ++IG 
Sbjct  135  KAAFWLDFGRMLVGCGMGLLSYVVPVYIAEVTPKDIRGGFTSVHQLMICCGVSITYLIGA  194

Query  517  MVTWRTLALTGIXPCVVLGLGLCII  591
              TWRTLAL G  PC++  LGL  I
Sbjct  195  FATWRTLALIGTIPCLMQLLGLFFI  219



>gb|ADE75821.1| unknown [Picea sitchensis]
Length=501

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 120/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V LSTFV V GS  FG   G+SSP QSA+ +DL  ++++YS FGS+LT GAM GAI SG 
Sbjct  48   VVLSTFVVVLGSLEFGYSVGFSSPVQSAMMEDLGLTMSQYSTFGSLLTIGAMVGAILSGR  107

Query  271  IADFVGRKGQENAEN*T------IFTLLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  432
            IADF+GRKG     + +      I +LLK A ++DIGRL  GYG+G+ SY +PV+IAEI 
Sbjct  108  IADFLGRKGALRVSSASYVIGWLIISLLKDAWLLDIGRLFIGYGVGLTSYTIPVYIAEIT  167

Query  433  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            PK LRG LTT NQL I  G+ +A+++G +V WR LA+ GI PC +L LGL  I
Sbjct  168  PKNLRGGLTTTNQLSITIGILIAYLLGMLVRWRLLAIIGIIPCFLLVLGLFFI  220



>ref|XP_003557831.1| PREDICTED: sugar transporter ERD6-like 16 [Brachypodium distachyon]
Length=502

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 118/175 (67%), Gaps = 6/175 (3%)
 Frame = +1

Query  85   WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITS  264
            WMV LST VAVCGS  FG+C GYS+PTQS I  ++  SI+E+++FGS+LT GAM GA+TS
Sbjct  63   WMVLLSTAVAVCGSFEFGTCVGYSAPTQSGIVDEVGLSISEFAIFGSVLTIGAMIGAVTS  122

Query  265  GPIADFVGRK-GQENAEN*TIFTLL-----KGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
            G +ADFVGRK     +    IF  L     KGA ++  GR   GY  GV SYVVPVFIAE
Sbjct  123  GRLADFVGRKMTMRISATICIFGWLSIYFAKGATMLYFGRTLLGYSTGVLSYVVPVFIAE  182

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IAPK LRG L T NQL+I +G S  ++ G +V WR L L GI PCV+L  GL  I
Sbjct  183  IAPKNLRGGLATSNQLLICSGSSATYITGALVAWRNLVLVGILPCVLLLAGLFFI  237



>gb|AAC64898.1| Similar to Beta integral membrane protein homolog gb|U43629 from 
A. thaliana [Arabidopsis thaliana]
Length=483

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 134/206 (65%), Gaps = 12/206 (6%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGKE--DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
            + GE + +       LI KE  D S T    + L+TFVAV GS  FGS  GYSSP QS +
Sbjct  64   MRGEIDEANLAPETSLINKENQDSSATITTTLLLTTFVAVSGSFVFGSAIGYSSPVQSDL  123

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL-------  336
            +++LN S+AEYSLFGSILT GAM GA  SG IAD +GR+         +F +L       
Sbjct  124  TKELNLSVAEYSLFGSILTIGAMIGAAMSGRIADMIGRRATMGFSE--MFCILGWLAIYL  181

Query  337  -KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             K A+ +D+GR   GYGMGVFS+VVPV+IAEI PK LRG  TT++QL+I  GVSV +++G
Sbjct  182  SKVAIWLDVGRFLVGYGMGVFSFVVPVYIAEITPKGLRGGFTTVHQLLICLGVSVTYLLG  241

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            + + WR LAL G+ PCVV  +GL +I
Sbjct  242  SFIGWRILALIGMIPCVVQMMGLFVI  267



>ref|NP_850964.1| sugar transporter ERD6-like 5 [Arabidopsis thaliana]
 sp|Q3ECP7.2|ERDL5_ARATH RecName: Full=Sugar transporter ERD6-like 5 [Arabidopsis thaliana]
 gb|AEE33139.1| sugar transporter ERD6-like 5 [Arabidopsis thaliana]
Length=470

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 134/206 (65%), Gaps = 12/206 (6%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGKE--DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
            + GE + +       LI KE  D S T    + L+TFVAV GS  FGS  GYSSP QS +
Sbjct  1    MRGEIDEANLAPETSLINKENQDSSATITTTLLLTTFVAVSGSFVFGSAIGYSSPVQSDL  60

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL-------  336
            +++LN S+AEYSLFGSILT GAM GA  SG IAD +GR+         +F +L       
Sbjct  61   TKELNLSVAEYSLFGSILTIGAMIGAAMSGRIADMIGRRATMGFSE--MFCILGWLAIYL  118

Query  337  -KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             K A+ +D+GR   GYGMGVFS+VVPV+IAEI PK LRG  TT++QL+I  GVSV +++G
Sbjct  119  SKVAIWLDVGRFLVGYGMGVFSFVVPVYIAEITPKGLRGGFTTVHQLLICLGVSVTYLLG  178

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            + + WR LAL G+ PCVV  +GL +I
Sbjct  179  SFIGWRILALIGMIPCVVQMMGLFVI  204



>ref|XP_010684724.1| PREDICTED: sugar transporter ERD6-like 16 isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=398

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 129/201 (64%), Gaps = 20/201 (10%)
 Frame = +1

Query  43   APLIGKEDDS-------KTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            AP I K D         K D     +V LS+F+ V GS AFG+C G+++P Q AI +DL+
Sbjct  10   APYITKSDAKDPLLQLRKVDEGSFKIVVLSSFIIVTGSYAFGTCIGFTAPVQEAILRDLD  69

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGAL  348
             SIA++S FGSIL+ GA  GAITSG ++D+ GRK         + TL+        KG+ 
Sbjct  70   LSIAQFSFFGSILSVGATIGAITSGHVSDYFGRKRAMRIS--CLITLIGWSAIYFSKGST  127

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
             +D+GRL TG G+GVFSYVVPV+I+EIAP  +RG L  LNQLMIV G+S   ++G + TW
Sbjct  128  SLDVGRLLTGLGIGVFSYVVPVYISEIAPTSIRGGLIALNQLMIVLGISCTMLLGIVATW  187

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LAL GI PCVV+  GL II
Sbjct  188  RQLALHGILPCVVMLFGLLII  208



>ref|XP_010684723.1| PREDICTED: sugar transporter ERD6-like 16 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=435

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 129/201 (64%), Gaps = 20/201 (10%)
 Frame = +1

Query  43   APLIGKEDDS-------KTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            AP I K D         K D     +V LS+F+ V GS AFG+C G+++P Q AI +DL+
Sbjct  10   APYITKSDAKDPLLQLRKVDEGSFKIVVLSSFIIVTGSYAFGTCIGFTAPVQEAILRDLD  69

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGAL  348
             SIA++S FGSIL+ GA  GAITSG ++D+ GRK         + TL+        KG+ 
Sbjct  70   LSIAQFSFFGSILSVGATIGAITSGHVSDYFGRKRAMRIS--CLITLIGWSAIYFSKGST  127

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
             +D+GRL TG G+GVFSYVVPV+I+EIAP  +RG L  LNQLMIV G+S   ++G + TW
Sbjct  128  SLDVGRLLTGLGIGVFSYVVPVYISEIAPTSIRGGLIALNQLMIVLGISCTMLLGIVATW  187

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LAL GI PCVV+  GL II
Sbjct  188  RQLALHGILPCVVMLFGLLII  208



>ref|XP_003580968.1| PREDICTED: sugar transporter ERD6-like 5 [Brachypodium distachyon]
Length=475

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 10/190 (5%)
 Frame = +1

Query  46   PLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGS  225
            PL+  E+   +  W+V  ST +AVCGS  FG   GYSSP+Q  I +DL+ S+AEYS+FGS
Sbjct  11   PLLAAENHRASSIWVVVASTAIAVCGSFVFGISVGYSSPSQEGIMRDLHLSLAEYSVFGS  70

Query  226  ILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGY  381
            ILT GAM GAI SG IAD VGR+      +  +F ++        K  L +D+GRL+ G 
Sbjct  71   ILTIGAMLGAILSGTIADRVGRRFAMAISD--VFCIIGYLFIIFSKNVLWLDLGRLSIGC  128

Query  382  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPC  561
            G+G+ SYVVPV+I+EI PK LRG     NQL+I  G S+A+ +GT +TWRTLA+ G+ PC
Sbjct  129  GIGLLSYVVPVYISEITPKNLRGRFAAGNQLLICCGASLAYALGTFMTWRTLAIVGVTPC  188

Query  562  VVLGLGLCII  591
            ++  +GL +I
Sbjct  189  ILQLIGLLVI  198



>gb|KFK35614.1| hypothetical protein AALP_AA4G014000 [Arabis alpina]
Length=469

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 120/185 (65%), Gaps = 10/185 (5%)
 Frame = +1

Query  61   EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  240
              DS      + ++T VAV GS  FGS  GYSSP Q  ++ DL  S+AEYSLFGSILT G
Sbjct  21   NQDSSAKTITLLITTLVAVSGSFVFGSAIGYSSPVQLDLTNDLKLSVAEYSLFGSILTIG  80

Query  241  AMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVF  396
            AM GA  SG IAD VGR+         +F +L        K A  +D+GRL  GYGMGV 
Sbjct  81   AMIGASMSGRIADLVGRRATMGFSE--MFCILGWLTIYLSKVAFWLDVGRLLVGYGMGVL  138

Query  397  SYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGL  576
            S+VVPV+IAEI PK+LRG  TT++QLMI  GVSV +++G+ V WR LAL G+ PCVV  +
Sbjct  139  SFVVPVYIAEITPKDLRGGFTTVHQLMICLGVSVTYLLGSFVGWRVLALIGMVPCVVQMM  198

Query  577  GLCII  591
            GL II
Sbjct  199  GLFII  203



>ref|XP_002465229.1| hypothetical protein SORBIDRAFT_01g034610 [Sorghum bicolor]
 gb|EER92227.1| hypothetical protein SORBIDRAFT_01g034610 [Sorghum bicolor]
Length=484

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 130/202 (64%), Gaps = 7/202 (3%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQ  183
            + G  E + A       G+ D + + R MV LST VAVCGS  FG+C GYS+PTQS I  
Sbjct  40   IRGSPEEAAASDCGSEEGRPDAAGSLR-MVLLSTAVAVCGSFEFGTCVGYSAPTQSGIVD  98

Query  184  DLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRK-GQENAEN*TIF-----TLLKGA  345
            ++  SI+E+++FGSILT GAM GA+TSG +ADF+GRK     +    IF      L K A
Sbjct  99   EVGLSISEFAIFGSILTVGAMVGAVTSGRLADFLGRKMTMRISATICIFGWLSIHLAKSA  158

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
            +++  GR+  G+  GV SYVVPVFIAEIAPK LRG L T NQL+I +G S  ++IG +V 
Sbjct  159  IMLYFGRILLGFSTGVLSYVVPVFIAEIAPKNLRGGLATSNQLLICSGSSATYIIGALVA  218

Query  526  WRTLALTGIXPCVVLGLGLCII  591
            WR L L G+ PCV+L  GL  I
Sbjct  219  WRNLVLVGLLPCVLLLAGLYFI  240



>ref|XP_009414205.1| PREDICTED: sugar transporter ERD6-like 16 [Musa acuminata subsp. 
malaccensis]
Length=481

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 125/190 (66%), Gaps = 15/190 (8%)
 Frame = +1

Query  7    NGENEGSTAGMAAPLIGKEDDSKTDR---------WMVYLSTFVAVCGSCAFGSCAGYSS  159
            NG +    + +  PLI + + +K +          WMV LST VAVCGS  FGSC GYS+
Sbjct  6    NGIHVTHESEVRKPLIQQRELAKAEESSSDGQGSLWMVLLSTGVAVCGSFEFGSCIGYSA  65

Query  160  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFT---  330
            PTQ+ I++D+  S+++YS+F SILT G M GA+TSG ++D+ GRKG              
Sbjct  66   PTQAGITKDIGLSLSQYSIFASILTTGGMVGAVTSGHLSDYFGRKGAMRISAVVCIIGWL  125

Query  331  ---LLKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  501
                 K   ++ +GRL TGYG+GV SYVVPVFIAEIAPK LRG LT+LNQL++V G SVA
Sbjct  126  AIYFAKETFLLCLGRLFTGYGIGVLSYVVPVFIAEIAPKNLRGGLTSLNQLLLVGGNSVA  185

Query  502  FVIGTMVTWR  531
            F+IGT+V+WR
Sbjct  186  FIIGTLVSWR  195



>ref|XP_006301882.1| hypothetical protein CARUB_v10022354mg [Capsella rubella]
 gb|EOA34780.1| hypothetical protein CARUB_v10022354mg [Capsella rubella]
Length=464

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 117/169 (69%), Gaps = 10/169 (6%)
 Frame = +1

Query  109  VAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVG  288
            VAV GS  FGS  GYSSP QS +++DLN S+AEYSLFGSILT GAM GA  SG IAD +G
Sbjct  36   VAVSGSFVFGSAIGYSSPVQSDLTKDLNLSVAEYSLFGSILTIGAMIGAAMSGRIADLIG  95

Query  289  RKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKEL  444
            R+         +F +L        K A+ +D+GR   GYGMGV S+VVPV+IAEI PKEL
Sbjct  96   RRATMGFSE--MFCILGWLAIYLSKVAIWLDVGRFLVGYGMGVLSFVVPVYIAEITPKEL  153

Query  445  RGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            RG  TT++QLMI  GVSV +++G+ + WR LAL G+ PCV+  +GL I+
Sbjct  154  RGGFTTVHQLMICLGVSVTYLLGSFIGWRILALIGMVPCVIQMMGLFIV  202



>ref|XP_010684721.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=473

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 129/201 (64%), Gaps = 20/201 (10%)
 Frame = +1

Query  43   APLIGKEDDS-------KTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            AP I K D         K D     +V LS+F+ V GS AFG+C G+++P Q AI +DL+
Sbjct  10   APYITKSDAKDPLLQLRKVDEGSFKIVVLSSFIIVTGSYAFGTCIGFTAPVQEAILRDLD  69

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGAL  348
             SIA++S FGSIL+ GA  GAITSG ++D+ GRK         + TL+        KG+ 
Sbjct  70   LSIAQFSFFGSILSVGATIGAITSGHVSDYFGRKRAMRIS--CLITLIGWSAIYFSKGST  127

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
             +D+GRL TG G+GVFSYVVPV+I+EIAP  +RG L  LNQLMIV G+S   ++G + TW
Sbjct  128  SLDVGRLLTGLGIGVFSYVVPVYISEIAPTSIRGGLIALNQLMIVLGISCTMLLGIVATW  187

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LAL GI PCVV+  GL II
Sbjct  188  RQLALHGILPCVVMLFGLLII  208



>ref|XP_008674205.1| PREDICTED: LOC100281158 isoform X2 [Zea mays]
Length=416

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 130/202 (64%), Gaps = 9/202 (4%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDDSKTD---RWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQ  183
            +++GS    +    G  D  +TD     MV +ST VAVCGS  FG+C GYS+PTQS I +
Sbjct  44   DDQGSKIRDSPEAEGASDCGRTDGGSLRMVLVSTAVAVCGSFEFGTCVGYSAPTQSGIVE  103

Query  184  DLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRK-GQENAEN*TIF-----TLLKGA  345
            ++  SI+E+++FGS+LT GAM GA+TSG +ADF+GRK     +    IF      L K A
Sbjct  104  EVGLSISEFAIFGSVLTVGAMVGAVTSGRLADFLGRKMTMRISATICIFGWLSIHLAKSA  163

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
            +++  GR   G+  GV SYVVPVFIAEIAPK LRG L T NQL+I +G S  ++IG +V 
Sbjct  164  IMLYFGRTLLGFSTGVLSYVVPVFIAEIAPKNLRGGLATSNQLLICSGSSATYIIGALVA  223

Query  526  WRTLALTGIXPCVVLGLGLCII  591
            WR L L G+ PCV+L  GL  I
Sbjct  224  WRNLVLVGLVPCVLLLAGLFFI  245



>ref|XP_010684722.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=469

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 129/201 (64%), Gaps = 20/201 (10%)
 Frame = +1

Query  43   APLIGKEDDS-------KTDR---WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  192
            AP I K D         K D     +V LS+F+ V GS AFG+C G+++P Q AI +DL+
Sbjct  10   APYITKSDAKDPLLQLRKVDEGSFKIVVLSSFIIVTGSYAFGTCIGFTAPVQEAILRDLD  69

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGAL  348
             SIA++S FGSIL+ GA  GAITSG ++D+ GRK         + TL+        KG+ 
Sbjct  70   LSIAQFSFFGSILSVGATIGAITSGHVSDYFGRKRAMRIS--CLITLIGWSAIYFSKGST  127

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
             +D+GRL TG G+GVFSYVVPV+I+EIAP  +RG L  LNQLMIV G+S   ++G + TW
Sbjct  128  SLDVGRLLTGLGIGVFSYVVPVYISEIAPTSIRGGLIALNQLMIVLGISCTMLLGIVATW  187

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LAL GI PCVV+  GL II
Sbjct  188  RQLALHGILPCVVMLFGLLII  208



>ref|XP_010470371.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Camelina 
sativa]
Length=455

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 132/206 (64%), Gaps = 12/206 (6%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGKEDD--SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
            + GE + +       LI KE+   S T    +  +T VAV GS  FGS  GYSSP QS +
Sbjct  1    MRGEIDEADLAPETSLIKKENQEPSATTTTTLLFTTLVAVSGSFVFGSAIGYSSPVQSDL  60

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL-------  336
            ++DLN S+AEYS+FGSILT GAM GA  SG IAD +GR+         +F +L       
Sbjct  61   TKDLNLSVAEYSIFGSILTIGAMIGAAMSGRIADLIGRRATMGFSE--MFCILGWLAIYL  118

Query  337  -KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             K A+ +D+GR   GYGMGV S+V+PV+IAEI PKELRG  TT++QLMI  GVSV +++G
Sbjct  119  SKVAVWLDVGRFLVGYGMGVLSFVIPVYIAEITPKELRGGFTTVHQLMICLGVSVTYLLG  178

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            + + WR LAL GI PCVV  +GL I+
Sbjct  179  SFIGWRILALIGIIPCVVQMIGLFIV  204



>ref|XP_010470369.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Camelina 
sativa]
Length=470

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 132/206 (64%), Gaps = 12/206 (6%)
 Frame = +1

Query  4    VNGENEGSTAGMAAPLIGKEDD--SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  177
            + GE + +       LI KE+   S T    +  +T VAV GS  FGS  GYSSP QS +
Sbjct  1    MRGEIDEADLAPETSLIKKENQEPSATTTTTLLFTTLVAVSGSFVFGSAIGYSSPVQSDL  60

Query  178  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL-------  336
            ++DLN S+AEYS+FGSILT GAM GA  SG IAD +GR+         +F +L       
Sbjct  61   TKDLNLSVAEYSIFGSILTIGAMIGAAMSGRIADLIGRRATMGFSE--MFCILGWLAIYL  118

Query  337  -KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  513
             K A+ +D+GR   GYGMGV S+V+PV+IAEI PKELRG  TT++QLMI  GVSV +++G
Sbjct  119  SKVAVWLDVGRFLVGYGMGVLSFVIPVYIAEITPKELRGGFTTVHQLMICLGVSVTYLLG  178

Query  514  TMVTWRTLALTGIXPCVVLGLGLCII  591
            + + WR LAL GI PCVV  +GL I+
Sbjct  179  SFIGWRILALIGIIPCVVQMIGLFIV  204



>ref|XP_007030780.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY11282.1| Major facilitator superfamily protein [Theobroma cacao]
Length=486

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 119/175 (68%), Gaps = 10/175 (6%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V LSTFVAVCGS  FG+  GYSSP Q+ I  DL  S+A+YSLFGSILT GAM GA+ SG 
Sbjct  46   VVLSTFVAVCGSYVFGTAIGYSSPAQTGIVDDLGLSVAQYSLFGSILTIGAMIGAVMSGR  105

Query  271  IADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
            IAD++GRK         +F ++        K A  +D+GRL  GYGMG+ S+VVPV+IAE
Sbjct  106  IADYIGRKCTMGFSE--VFCIVGWLAILFSKAAWWLDLGRLLVGYGMGLLSFVVPVYIAE  163

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            + PK +RG  T+++QLMI  GVS+ ++IG   +WRTLAL G  PC++  LGL  I
Sbjct  164  VTPKNIRGGFTSVHQLMICCGVSITYLIGAFASWRTLALIGTIPCLMQLLGLFFI  218



>ref|XP_006651406.1| PREDICTED: sugar transporter ERD6-like 16-like [Oryza brachyantha]
Length=458

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 119/175 (68%), Gaps = 6/175 (3%)
 Frame = +1

Query  85   WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITS  264
            WM+ L+T VAVCGS  FG+C GYS+PTQS I  ++  SI++++LFGS+LT GAM GA+TS
Sbjct  18   WMLMLATAVAVCGSFEFGTCVGYSAPTQSGIVDEVGLSISQFALFGSVLTIGAMIGAVTS  77

Query  265  GPIADFVGRKGQENAEN*T-IF-----TLLKGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
            G +ADF+GRK          IF      L KGA ++  GR+  G+  GV SYVVPVFIAE
Sbjct  78   GRLADFLGRKMTMRISAIICIFGWLSVHLAKGANMLYFGRILLGFSTGVLSYVVPVFIAE  137

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            IAPK LRG L T NQL+I +G S  ++IG +V WR L L GI PCV+L  GL  I
Sbjct  138  IAPKNLRGGLATSNQLLICSGSSATYIIGALVAWRNLVLVGIAPCVLLLTGLFFI  192



>emb|CBI26146.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 133/201 (66%), Gaps = 22/201 (11%)
 Frame = +1

Query  49   LIGKEDD--------SKTDRWMVYLSTFVAVCGSCAFGSC----AGYSSPTQSAISQDLN  192
            +I +EDD         K    + +LST +AV GS  FG C      Y+SPTQ+AI +DLN
Sbjct  25   IISEEDDDLKPENPSQKGSPGVEWLSTAIAVWGSFQFGCCLNLQVHYTSPTQTAIRKDLN  84

Query  193  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL--------KGAL  348
             S+AEYS+F S+L  GAM G +TSG I+D +GRKG         F ++        +G L
Sbjct  85   LSLAEYSVFASVLAIGAMIGGLTSGHISDLIGRKGTMRVA--AAFCIVGWLAIGFTEGVL  142

Query  349  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  528
            ++D+GR+ TGYG+G+FSYVVPVFIAEIAPK+LRG  T+LN+LMI  G S+ +++GT++TW
Sbjct  143  LLDLGRMCTGYGIGIFSYVVPVFIAEIAPKDLRGGFTSLNELMIQVGGSITYLLGTVLTW  202

Query  529  RTLALTGIXPCVVLGLGLCII  591
            R LAL G+ P ++L LG+  +
Sbjct  203  RMLALVGLIPSLMLILGMFFV  223



>gb|ADW40547.1| vacuolar monosaccharide symporter 1 [Saccharum hybrid cultivar 
Q117]
Length=505

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 125/185 (68%), Gaps = 7/185 (4%)
 Frame = +1

Query  55   GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILT  234
            G+ D + + R MV LST VAVCGS  FG+C GYS+PTQS I  ++  SI+E+++FGSILT
Sbjct  57   GRPDAAGSLR-MVLLSTAVAVCGSFEFGTCVGYSAPTQSGIVDEVGLSISEFAIFGSILT  115

Query  235  FGAMAGAITSGPIADFVGRK-GQENAEN*TIF-----TLLKGALVMDIGRLATGYGMGVF  396
             GAM GA+TSG +ADF+GRK     +    IF      L K A+++  GR+  G+  GV 
Sbjct  116  IGAMVGAVTSGRLADFLGRKMTMRISAIICIFGWLSIHLAKSAIMLYFGRILLGFSTGVL  175

Query  397  SYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGL  576
            SYVVPVFIAEIAPK LRG L T NQL+I +G S  ++IG +V WR L L G+ PCV+L  
Sbjct  176  SYVVPVFIAEIAPKNLRGGLATSNQLLICSGSSATYIIGALVAWRNLVLVGLLPCVLLLA  235

Query  577  GLCII  591
            GL  I
Sbjct  236  GLFFI  240



>ref|XP_006361887.1| PREDICTED: sugar transporter ERD6-like 5-like [Solanum tuberosum]
Length=465

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 117/175 (67%), Gaps = 10/175 (6%)
 Frame = +1

Query  91   VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  270
            V  ST VAV GS  FGS  G+SSP Q+ I +DL+ S+AEYS+FGSI T GAM GA+ SG 
Sbjct  32   VVFSTLVAVSGSFVFGSAVGFSSPAQNGIIKDLDLSVAEYSVFGSIWTIGAMIGAVMSGK  91

Query  271  IADFVGRKGQENAEN*TIFTLL--------KGALVMDIGRLATGYGMGVFSYVVPVFIAE  426
            +AD   R+G        +F LL        K AL +DIGRL  GYG+G+ SYVVPV+IAE
Sbjct  92   LADLFARRGAMGFSE--LFCLLGWLAIIFGKNALWLDIGRLLMGYGVGIISYVVPVYIAE  149

Query  427  IAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            I PK LRGA TT+NQLMI  GVS+ +V+G ++ WR LA+ G  PC++  LGL  I
Sbjct  150  ITPKNLRGAFTTVNQLMICCGVSLMYVVGVIINWRLLAVIGAIPCIIQLLGLFFI  204



>gb|AHG94614.1| sugar transporter ERD6-like protein [Camellia sinensis]
Length=479

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 134/210 (64%), Gaps = 19/210 (9%)
 Frame = +1

Query  13   ENEGSTAGMAA-PLIGKEDDSK--------TDRWMVYLSTFVAVCGSCAFGSCAGYSSPT  165
            E EG   G  + PL+ +E+           +   ++  STFVAVCGS  FGS  G+SSPT
Sbjct  4    EREGMVGGQTSIPLLNRENPDHGASSSSSSSTTPVLLFSTFVAVCGSYVFGSAVGFSSPT  63

Query  166  QSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGQENAEN*TIFTLL---  336
            QS I +DL  S+AEYS+FGSI+T GAM GA+ SG +AD  GR+G     +  IF ++   
Sbjct  64   QSEIMEDLGLSLAEYSVFGSIMTVGAMLGAVMSGKLADLFGRRGTLGFSD--IFCIIGWL  121

Query  337  -----KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  501
                 + A  +D+GRL+ GYG+G+ SYVVPV+IAEI P+++RG  TT +Q +   GVS+ 
Sbjct  122  AMALSERAWCLDLGRLSLGYGIGLLSYVVPVYIAEITPRDIRGTFTTAHQFLDSCGVSIM  181

Query  502  FVIGTMVTWRTLALTGIXPCVVLGLGLCII  591
            ++IGT++TWR LA  GI PC++  +GL  I
Sbjct  182  YLIGTIITWRILAAIGIIPCLIQFVGLFFI  211



>tpg|DAA45486.1| TPA: solute carrier family 2, facilitated glucose transporter 
member 8 [Zea mays]
Length=501

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 130/202 (64%), Gaps = 9/202 (4%)
 Frame = +1

Query  13   ENEGSTAGMAAPLIGKEDDSKTD---RWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQ  183
            +++GS    +    G  D  +TD     MV +ST VAVCGS  FG+C GYS+PTQS I +
Sbjct  44   DDQGSKIRDSPEAEGASDCGRTDGGSLRMVLVSTAVAVCGSFEFGTCVGYSAPTQSGIVE  103

Query  184  DLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRK-GQENAEN*TIF-----TLLKGA  345
            ++  SI+E+++FGS+LT GAM GA+TSG +ADF+GRK     +    IF      L K A
Sbjct  104  EVGLSISEFAIFGSVLTVGAMVGAVTSGRLADFLGRKMTMRISATICIFGWLSIHLAKSA  163

Query  346  LVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVT  525
            +++  GR   G+  GV SYVVPVFIAEIAPK LRG L T NQL+I +G S  ++IG +V 
Sbjct  164  IMLYFGRTLLGFSTGVLSYVVPVFIAEIAPKNLRGGLATSNQLLICSGSSATYIIGALVA  223

Query  526  WRTLALTGIXPCVVLGLGLCII  591
            WR L L G+ PCV+L  GL  I
Sbjct  224  WRNLVLVGLVPCVLLLAGLFFI  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160