BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051E05

Length=590
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    113   2e-31   Sesamum indicum [beniseed]
ref|XP_009597333.1|  PREDICTED: calcium-dependent protein kinase-...    112   2e-30   Nicotiana tomentosiformis
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    103   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009776253.1|  PREDICTED: calcium-dependent protein kinase-...    104   2e-28   Nicotiana sylvestris
ref|XP_009776260.1|  PREDICTED: calcium-dependent protein kinase-...    104   2e-28   Nicotiana sylvestris
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2    99.8    4e-28   Prunus mume [ume]
gb|ACY78680.1|  calcium-dependent protein kinase 1                      119   8e-28   Panax ginseng [Asiatic ginseng]
gb|KJB81729.1|  hypothetical protein B456_013G159300                  99.8    2e-27   Gossypium raimondii
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    101   2e-27   Pyrus x bretschneideri [bai li]
gb|KJB81728.1|  hypothetical protein B456_013G159300                  99.8    3e-27   Gossypium raimondii
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg              99.4    6e-27   Erythranthe guttata [common monkey flower]
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    8e-27   
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1     96.3    1e-26   
ref|XP_007020821.1|  Calmodulin-domain protein kinase 9 isoform 2     95.9    2e-26   
gb|KHG28675.1|  Calcium-dependent protein kinase 9                    97.1    7e-26   Gossypium arboreum [tree cotton]
emb|CDP04396.1|  unnamed protein product                                113   1e-25   Coffea canephora [robusta coffee]
gb|KDP39132.1|  hypothetical protein JCGZ_00889                       92.4    2e-25   Jatropha curcas
gb|KJB13681.1|  hypothetical protein B456_002G088800                  95.1    3e-25   Gossypium raimondii
gb|KJB13679.1|  hypothetical protein B456_002G088800                  95.1    3e-25   Gossypium raimondii
gb|KDO62721.1|  hypothetical protein CISIN_1g0096582mg                90.5    5e-25   Citrus sinensis [apfelsine]
ref|XP_006452370.1|  hypothetical protein CICLE_v10007983mg           90.9    5e-25   
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg           90.9    5e-25   Citrus clementina [clementine]
gb|KDO62718.1|  hypothetical protein CISIN_1g0096582mg                90.5    6e-25   Citrus sinensis [apfelsine]
gb|KCW66999.1|  hypothetical protein EUGRSUZ_F007611                  92.0    6e-25   Eucalyptus grandis [rose gum]
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    7e-25   
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    8e-25   
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    8e-25   Eucalyptus grandis [rose gum]
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                   91.7    1e-24   Eucalyptus grandis [rose gum]
ref|XP_006350481.1|  PREDICTED: calcium-dependent protein kinase-...  94.4    1e-24   Solanum tuberosum [potatoes]
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    109   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_002532559.1|  calcium-dependent protein kinase, putative       89.7    2e-24   Ricinus communis
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    109   3e-24   Sesamum indicum [beniseed]
ref|XP_008385882.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  84.7    1e-23   
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    107   2e-23   Populus euphratica
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    106   3e-23   Populus euphratica
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             105   1e-22   Prunus persica
gb|EPS59225.1|  calcium-dependent protein kinase 1                    87.4    1e-22   Genlisea aurea
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...  88.6    2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...  88.2    3e-22   Nicotiana sylvestris
gb|KHG26977.1|  Calcium-dependent protein kinase 9                    83.6    4e-22   Gossypium arboreum [tree cotton]
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...  85.5    4e-22   Sesamum indicum [beniseed]
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      102   6e-22   
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...  81.3    9e-22   Cucumis sativus [cucumbers]
gb|ABD98804.1|  calcium-dependent protein kinase                      80.5    2e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    101   2e-21   Fragaria vesca subsp. vesca
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33   84.3    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...  82.8    3e-21   Cucumis sativus [cucumbers]
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...  84.0    6e-21   Nicotiana tomentosiformis
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                 79.7    8e-21   Citrus sinensis [apfelsine]
gb|KJB81727.1|  hypothetical protein B456_013G159300                  99.8    9e-21   Gossypium raimondii
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg              82.8    1e-20   Erythranthe guttata [common monkey flower]
dbj|BAA13440.1|  calcium dependent protein kinase                     82.8    1e-20   Ipomoea batatas [batate]
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...  78.2    1e-20   
ref|NP_001105542.1|  calcium-dependent protein kinase 2               78.2    1e-20   
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...  78.6    2e-20   Glycine max [soybeans]
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...  78.6    2e-20   Glycine max [soybeans]
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g           83.6    2e-20   Populus trichocarpa [western balsam poplar]
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1           83.6    2e-20   
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...  79.3    2e-20   
ref|XP_002874812.1|  calcium-dependent protein kinase 23              80.5    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9    81.6    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...  82.8    3e-20   Solanum tuberosum [potatoes]
ref|NP_001275371.1|  calcium-dependent protein kinase 2               82.8    3e-20   Solanum tuberosum [potatoes]
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...  78.6    3e-20   
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg           77.0    4e-20   Citrus clementina [clementine]
ref|XP_007020822.1|  Calmodulin-domain protein kinase 9 isoform 3     95.9    4e-20   
ref|NP_188676.1|  calmodulin-domain protein kinase 9                  80.5    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg           80.1    7e-20   Capsella rubella
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    7e-20   Cicer arietinum [garbanzo]
ref|XP_002883243.1|  calmodulin-domain protein kinase 9               79.7    9e-20   Arabidopsis lyrata subsp. lyrata
gb|ACR34538.1|  unknown                                               75.1    1e-19   Zea mays [maize]
ref|XP_010430219.1|  PREDICTED: calcium-dependent protein kinase 19   84.3    1e-19   
ref|XP_002888057.1|  predicted protein                                84.3    1e-19   
ref|XP_006452345.1|  hypothetical protein CICLE_v10007978mg           72.4    1e-19   Citrus clementina [clementine]
ref|NP_001105306.1|  calcium-dependent protein kinase                 75.9    2e-19   Zea mays [maize]
emb|CAD70165.1|  calcium-dependent protein kinase                     72.8    2e-19   Landoltia punctata
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                  77.8    3e-19   Arabis alpina [alpine rockcress]
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    3e-19   Nicotiana tomentosiformis
ref|XP_010439398.1|  PREDICTED: calcium-dependent protein kinase ...  78.2    4e-19   Camelina sativa [gold-of-pleasure]
gb|KHG17079.1|  Calcium-dependent protein kinase 9                    94.7    5e-19   Gossypium arboreum [tree cotton]
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                  74.3    5e-19   Arabis alpina [alpine rockcress]
ref|XP_002891589.1|  calcium-dependent protein kinase 33              75.5    6e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg           77.0    6e-19   Eutrema salsugineum [saltwater cress]
sp|P28582.2|CDPK_DAUCA  RecName: Full=Calcium-dependent protein k...  94.4    6e-19   Daucus carota [carrots]
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2    93.6    1e-18   Cucumis melo [Oriental melon]
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g           92.8    2e-18   Phaseolus vulgaris [French bean]
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g           92.0    4e-18   Populus trichocarpa [western balsam poplar]
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-18   Solanum lycopersicum
ref|NP_175485.1|  calcium-dependent protein kinase 33                 72.4    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828852.1|  hypothetical protein AMTR_s00001p00158780        75.9    6e-18   Amborella trichopoda
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33   72.0    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...  72.0    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...  71.6    9e-18   
gb|AGG35978.1|  calcium-dependent protein kinase 9                    73.2    9e-18   Brassica napus [oilseed rape]
ref|XP_007026067.1|  Calcium-dependent protein kinase 21 isoform 2    90.5    1e-17   
ref|XP_007026068.1|  Calcium-dependent protein kinase 21 isoform 3    90.5    1e-17   
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9    72.4    1e-17   Brassica rapa
gb|AAD17800.1|  Ca2+-dependent protein kinase                         90.5    1e-17   Mesembryanthemum crystallinum
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1    90.5    2e-17   
ref|XP_003610425.1|  Calcium-dependent protein kinase                 68.2    2e-17   Medicago truncatula
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g           90.5    2e-17   Phaseolus vulgaris [French bean]
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg           70.9    2e-17   Capsella rubella
ref|XP_011034967.1|  PREDICTED: calcium-dependent protein kinase 29   76.3    2e-17   Populus euphratica
ref|XP_006287505.1|  hypothetical protein CARUB_v10000714mg           77.8    3e-17   
emb|CDX82244.1|  BnaA03g35770D                                        71.6    3e-17   
emb|CDY36037.1|  BnaC03g41610D                                        70.9    5e-17   Brassica napus [oilseed rape]
gb|AAK92828.1|  putative calcium dependent protein kinase             88.6    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192381.1|  calcium-dependent protein kinase 21                 88.6    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855881.1|  hypothetical protein AMTR_s00037p00138680        87.0    7e-17   
ref|XP_010093289.1|  Calcium-dependent protein kinase 15              88.2    9e-17   Morus notabilis
emb|CDP05759.1|  unnamed protein product                              87.8    1e-16   Coffea canephora [robusta coffee]
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                   87.8    1e-16   Eucalyptus grandis [rose gum]
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...  87.8    1e-16   Eucalyptus grandis [rose gum]
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                   87.8    1e-16   Eucalyptus grandis [rose gum]
gb|AFY10519.1|  calcium dependent protein kinase 1                    87.8    1e-16   Dendrobium officinale
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...  87.8    1e-16   Nicotiana sylvestris
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                  87.8    1e-16   Arabis alpina [alpine rockcress]
ref|XP_010266343.1|  PREDICTED: uncharacterized protein LOC104603873  74.3    2e-16   
ref|XP_006391947.1|  hypothetical protein EUTSA_v10023804mg           87.4    2e-16   Eutrema salsugineum [saltwater cress]
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...  87.4    2e-16   Fragaria vesca subsp. vesca
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17   71.2    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2    87.0    2e-16   Phoenix dactylifera
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...  71.2    2e-16   
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg           71.2    2e-16   Capsella rubella
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                  71.2    2e-16   Arabis alpina [alpine rockcress]
ref|XP_010529441.1|  PREDICTED: calcium-dependent protein kinase 21   87.0    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...  71.2    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...  86.7    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...  70.9    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_006365956.1|  PREDICTED: calcium-dependent protein kinase 2    86.7    3e-16   
ref|NP_176386.2|  calcium-dependent protein kinase 19                 86.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAC28510.1|  Similar to gb|AF072908 calcium-dependent protein ...  86.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg           86.7    3e-16   Capsella rubella
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  86.3    4e-16   Prunus mume [ume]
ref|XP_009770081.1|  PREDICTED: calcium-dependent protein kinase ...  86.3    4e-16   Nicotiana sylvestris
emb|CDX70450.1|  BnaC03g05340D                                        71.2    4e-16   
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...  70.9    5e-16   Brassica rapa
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...  85.5    6e-16   Glycine max [soybeans]
gb|AFR11230.1|  calcium dependent protein kinase 1                    85.5    7e-16   Chenopodium album [lamb's-quarters]
ref|XP_008349938.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  85.1    7e-16   
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...  86.3    7e-16   
ref|XP_002874811.1|  calcium-dependent protein kinase 21              85.1    8e-16   
emb|CDY07254.1|  BnaC04g19170D                                        85.1    1e-15   
ref|XP_010092160.1|  Calcium-dependent protein kinase 9               85.1    1e-15   Morus notabilis
gb|KDP36877.1|  hypothetical protein JCGZ_08168                       72.4    1e-15   Jatropha curcas
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...  84.3    1e-15   Oryza brachyantha
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21   84.3    1e-15   Brassica rapa
gb|EAZ40006.1|  hypothetical protein OsJ_24444                        60.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KFK40633.1|  hypothetical protein AALP_AA2G022000                  84.7    2e-15   Arabis alpina [alpine rockcress]
ref|XP_010418170.1|  PREDICTED: calcium-dependent protein kinase ...  84.3    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006301218.1|  hypothetical protein CARUB_v10021616mg           84.3    2e-15   Capsella rubella
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...  84.3    2e-15   
ref|XP_004499307.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  74.3    2e-15   Cicer arietinum [garbanzo]
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21   84.3    2e-15   Camelina sativa [gold-of-pleasure]
gb|ADM14342.1|  calcium-dependent protein kinase 19                   84.3    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...  84.3    2e-15   Camelina sativa [gold-of-pleasure]
ref|NP_001059775.1|  Os07g0515100                                     84.3    2e-15   
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg           67.8    2e-15   Prunus persica
dbj|BAJ99143.1|  predicted protein                                    84.0    2e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like          84.0    2e-15   Malus domestica [apple tree]
gb|ABC59619.1|  calcium-dependent protein kinase                      84.0    2e-15   Triticum aestivum [Canadian hard winter wheat]
gb|ABD98803.1|  calcium-dependent protein kinase                      84.0    2e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg           84.0    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g           67.4    2e-15   
gb|KDO78219.1|  hypothetical protein CISIN_1g009091mg                 83.6    2e-15   Citrus sinensis [apfelsine]
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                   84.0    3e-15   Vitis amurensis
gb|ACB71246.2|  calcium-dependent protein kinase 1                    84.0    3e-15   Hevea brasiliensis [jebe]
ref|XP_006452356.1|  hypothetical protein CICLE_v10010666mg           71.6    3e-15   
gb|KDO37230.1|  hypothetical protein CISIN_1g047606mg                 71.6    3e-15   Citrus sinensis [apfelsine]
gb|KDP43197.1|  hypothetical protein JCGZ_22749                       66.2    3e-15   Jatropha curcas
ref|XP_006475081.1|  PREDICTED: calcium-dependent protein kinase ...  71.2    3e-15   
gb|KJB62816.1|  hypothetical protein B456_009G438300                  83.6    3e-15   Gossypium raimondii
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...  83.6    3e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006452348.1|  hypothetical protein CICLE_v10008325mg           71.2    3e-15   
gb|AIO04122.1|  calcium-dependent protein kinase                      83.6    3e-15   Hevea brasiliensis [jebe]
gb|KHN02836.1|  Calcium-dependent protein kinase 9                    83.6    3e-15   Glycine soja [wild soybean]
ref|XP_002526062.1|  calcium-dependent protein kinase, putative       65.9    4e-15   Ricinus communis
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17   67.0    4e-15   Populus euphratica
emb|CBI23246.3|  unnamed protein product                              83.2    4e-15   Vitis vinifera
ref|XP_003622837.1|  Calcium dependent protein kinase                 67.0    4e-15   
ref|XP_003589572.1|  Calcium-dependent protein kinase                 74.3    4e-15   
gb|KDO78218.1|  hypothetical protein CISIN_1g009091mg                 83.2    4e-15   Citrus sinensis [apfelsine]
gb|AES59823.2|  calcium-dependent kinase                              74.3    4e-15   Medicago truncatula
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                   83.2    4e-15   Vitis amurensis
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                 83.2    4e-15   Citrus sinensis [apfelsine]
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...  83.2    4e-15   Citrus sinensis [apfelsine]
gb|KDO62705.1|  hypothetical protein CISIN_1g040917mg                 70.5    4e-15   Citrus sinensis [apfelsine]
gb|AGG35971.1|  calcium-dependent protein kinase 29                   71.6    4e-15   Brassica napus [oilseed rape]
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like         83.2    4e-15   Cicer arietinum [garbanzo]
ref|XP_006452346.1|  hypothetical protein CICLE_v10010522mg           70.5    5e-15   
emb|CDX73219.1|  BnaC06g36670D                                        71.6    5e-15   
gb|AEY99979.1|  calcium-dependent protein kinase                      83.2    5e-15   Nicotiana tabacum [American tobacco]
ref|NP_001275456.1|  calcium-dependent protein kinase 3               83.2    5e-15   Solanum tuberosum [potatoes]
ref|XP_010533815.1|  PREDICTED: calcium-dependent protein kinase 19   83.2    5e-15   Tarenaya hassleriana [spider flower]
gb|ABB54456.1|  calcium-dependent protein kinase                      82.8    5e-15   Hordeum brevisubulatum
gb|AAC25423.1|  calcium-dependent protein kinase                      82.8    5e-15   Nicotiana tabacum [American tobacco]
ref|XP_006475078.1|  PREDICTED: calcium-dependent protein kinase ...  70.1    5e-15   
ref|XP_004250895.1|  PREDICTED: calcium-dependent protein kinase ...  65.9    5e-15   Solanum lycopersicum
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2    82.8    5e-15   Nicotiana tomentosiformis
emb|CDP20327.1|  unnamed protein product                              66.6    5e-15   Coffea canephora [robusta coffee]
gb|AGG35967.1|  calcium-dependent protein kinase 15                   82.8    7e-15   Brassica napus [oilseed rape]
ref|NP_001275322.1|  calcium-dependent protein kinase                 82.4    7e-15   Solanum tuberosum [potatoes]
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...  82.4    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_006386161.1|  hypothetical protein POPTR_0002s01850g           72.8    7e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010434101.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  82.4    8e-15   Camelina sativa [gold-of-pleasure]
gb|AHN16201.1|  CPK3-2.1                                              71.2    8e-15   Brassica napus [oilseed rape]
ref|XP_009414250.1|  PREDICTED: calcium-dependent protein kinase ...  68.2    8e-15   
emb|CDY54853.1|  BnaC01g15460D                                        71.2    9e-15   Brassica napus [oilseed rape]
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...  82.4    9e-15   Elaeis guineensis
ref|XP_009137281.1|  PREDICTED: calcium-dependent protein kinase ...  69.7    9e-15   Brassica rapa
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2    82.4    9e-15   Vitis vinifera
gb|AGG35973.1|  calcium-dependent protein kinase 3                    69.3    9e-15   Brassica napus [oilseed rape]
emb|CDY44125.1|  BnaA01g13330D                                        69.7    9e-15   Brassica napus [oilseed rape]
ref|XP_002276630.2|  PREDICTED: calcium-dependent protein kinase ...  65.9    9e-15   Vitis vinifera
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...  65.9    1e-14   Eucalyptus grandis [rose gum]
sp|Q9ZSA3.2|CDPKM_ARATH  RecName: Full=Calcium-dependent protein ...  73.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAN62888.1|  hypothetical protein VITISV_025544                   65.5    1e-14   Vitis vinifera
emb|CDP07348.1|  unnamed protein product                              68.9    1e-14   Coffea canephora [robusta coffee]
ref|XP_008387908.1|  PREDICTED: calcium-dependent protein kinase 29   73.9    1e-14   Malus domestica [apple tree]
gb|ABC59620.1|  calcium-dependent protein kinase                      82.0    1e-14   Triticum aestivum [Canadian hard winter wheat]
gb|AIU98504.1|  calcium-dependent protein kinase                      67.8    1e-14   Musa acuminata AAA Group [Cavendish banana]
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...  82.0    1e-14   Cucumis melo [Oriental melon]
gb|KJB69279.1|  hypothetical protein B456_011G014200                  82.0    1e-14   Gossypium raimondii
ref|XP_006473712.1|  PREDICTED: calcium-dependent protein kinase ...  69.7    1e-14   Citrus sinensis [apfelsine]
ref|XP_008786936.1|  PREDICTED: calcium-dependent protein kinase ...  68.2    1e-14   Phoenix dactylifera
ref|XP_006435253.1|  hypothetical protein CICLE_v10000897mg           69.7    1e-14   Citrus clementina [clementine]
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg           82.0    1e-14   Citrus clementina [clementine]
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...  82.0    1e-14   
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...  69.7    1e-14   Citrus sinensis [apfelsine]
gb|ADZ52811.1|  calcium-dependent protein kinase 3                    82.0    1e-14   Solanum tuberosum [potatoes]
emb|CDY24863.1|  BnaA03g59670D                                        82.0    1e-14   Brassica napus [oilseed rape]
emb|CDX82886.1|  BnaC01g13360D                                        82.0    1e-14   
gb|KDO84959.1|  hypothetical protein CISIN_1g010263mg                 68.9    1e-14   Citrus sinensis [apfelsine]
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...  67.0    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX91224.1|  BnaC02g26350D                                        81.3    1e-14   
gb|KHG10851.1|  Calcium-dependent protein kinase 21                   81.6    1e-14   Gossypium arboreum [tree cotton]
gb|KJB31959.1|  hypothetical protein B456_005G216500                  66.6    2e-14   Gossypium raimondii
gb|KJB31957.1|  hypothetical protein B456_005G216500                  67.0    2e-14   Gossypium raimondii
ref|XP_002510594.1|  calcium-dependent protein kinase, putative       68.6    2e-14   Ricinus communis
gb|KJB31960.1|  hypothetical protein B456_005G216500                  66.6    2e-14   Gossypium raimondii
gb|EMS56466.1|  Calcium-dependent protein kinase 34                   65.5    2e-14   Triticum urartu
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...  65.9    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2    81.3    2e-14   Vitis vinifera
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...  81.3    2e-14   Elaeis guineensis
gb|AGG35970.1|  calcium-dependent protein kinase 21                   81.3    2e-14   Brassica napus [oilseed rape]
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...  65.9    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_011459094.1|  PREDICTED: calcium-dependent protein kinase ...  69.7    2e-14   Fragaria vesca subsp. vesca
ref|XP_004291330.1|  PREDICTED: calcium-dependent protein kinase ...  69.3    2e-14   Fragaria vesca subsp. vesca
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29   68.2    2e-14   Solanum lycopersicum
ref|XP_002306955.1|  hypothetical protein POPTR_0005s26640g           68.2    2e-14   Populus trichocarpa [western balsam poplar]
gb|AAQ17506.1|  calcium dependent protein kinase 3                    80.9    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...  80.9    3e-14   Elaeis guineensis
emb|CAA57157.1|  calcium-dependent protein kinase                     80.9    3e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAD28192.2|  calcium-dependent protein kinase                      80.9    3e-14   Solanum tuberosum [potatoes]
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...  80.9    3e-14   Tarenaya hassleriana [spider flower]
gb|EEE58262.1|  hypothetical protein OsJ_09266                        63.9    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048842.1|  Os03g0128700                                     63.9    3e-14   
gb|AIU98507.1|  calcium-dependent protein kinase                      80.5    3e-14   Musa acuminata AAA Group [Cavendish banana]
gb|EEC74439.1|  hypothetical protein OsI_09829                        63.9    3e-14   Oryza sativa Indica Group [Indian rice]
gb|AAN17388.1|  Putative calcium dependent protein kinase             63.9    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...  63.5    3e-14   Populus euphratica
dbj|BAC19839.1|  calcium dependent protein kinase 13                  63.9    3e-14   Oryza sativa [red rice]
ref|XP_002313265.1|  calcium-dependent protein kinase                 63.5    3e-14   Populus trichocarpa [western balsam poplar]
gb|ABF93782.1|  Calcium-dependent protein kinase, isoform 11, put...  63.9    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAC05270.1|  calcium dependent protein kinase                      63.9    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64198.1|  hypothetical protein OsJ_19030                        65.5    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...  63.5    4e-14   Populus euphratica
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006655439.1|  PREDICTED: calcium-dependent protein kinase ...  65.9    4e-14   
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...  68.2    4e-14   
gb|AAT69647.1|  hypothetical protein                                  65.5    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055912.1|  Os05g0491900                                     65.5    4e-14   
dbj|BAK07881.1|  predicted protein                                    65.5    4e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568203.1|  PREDICTED: calcium-dependent protein kinase ...  65.5    5e-14   Brachypodium distachyon [annual false brome]
gb|KDP20751.1|  hypothetical protein JCGZ_21222                       80.1    5e-14   Jatropha curcas
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    5e-14   Phoenix dactylifera
ref|XP_007040388.1|  Calcium-dependent protein kinase 6 isoform 2     65.9    5e-14   
dbj|BAE71239.1|  putative calcium dependent protein kinase            80.1    5e-14   Trifolium pratense [peavine clover]
ref|NP_001234806.1|  calcium-dependent protein kinase                 80.1    5e-14   
ref|XP_004953480.1|  PREDICTED: calcium-dependent protein kinase ...  63.9    6e-14   
gb|KFK28919.1|  hypothetical protein AALP_AA7G065000                  65.9    6e-14   
gb|KJB63479.1|  hypothetical protein B456_010G001300                  66.6    6e-14   
ref|XP_007017899.1|  Calcium-dependent protein kinase 29              68.6    6e-14   
ref|XP_008678955.1|  PREDICTED: calcium-dependent protein kinase ...  63.5    6e-14   
ref|XP_006827112.1|  hypothetical protein AMTR_s00010p00245350        67.0    6e-14   
ref|XP_006396673.1|  hypothetical protein EUTSA_v10028617mg           79.7    6e-14   
gb|KJB58044.1|  hypothetical protein B456_009G191500                  68.2    6e-14   
ref|XP_010541306.1|  PREDICTED: calcium-dependent protein kinase 3    66.6    7e-14   
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3    67.4    7e-14   
gb|AEY99978.1|  calcium-dependent protein kinase                      66.2    7e-14   
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...  79.7    7e-14   
ref|XP_002518484.1|  calcium-dependent protein kinase, putative       79.7    7e-14   
ref|XP_009113383.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  79.7    8e-14   
ref|XP_007160621.1|  hypothetical protein PHAVU_001G002800g           69.3    8e-14   
gb|KHG11035.1|  Calcium-dependent protein kinase 4                    62.8    9e-14   
ref|XP_009106253.1|  PREDICTED: calcium-dependent protein kinase 29   67.0    9e-14   
ref|XP_002971737.1|  calcium-dependent protein kinase 17              64.7    9e-14   
ref|XP_002991556.1|  calcium dependent protein kinase 34              64.7    9e-14   
gb|ABV22553.1|  calcium-dependent protein kinase                      74.7    1e-13   
ref|XP_003617547.1|  Calcium dependent protein kinase                 79.7    1e-13   
ref|XP_002867697.1|  calcium-dependent protein kinase 6               64.3    1e-13   
emb|CAA65500.1|  protein kinase                                       79.0    1e-13   
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...  65.1    1e-13   
gb|EEC79448.1|  hypothetical protein OsI_20437                        63.9    1e-13   
ref|XP_006413532.1|  hypothetical protein EUTSA_v10024899mg           65.1    1e-13   
gb|ADZ99350.1|  calcium-dependent protein kinase 5                    62.4    1e-13   
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3    64.7    1e-13   
gb|EEE61563.1|  hypothetical protein OsJ_15923                        62.4    1e-13   
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...  64.7    1e-13   
ref|XP_011040815.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    1e-13   
ref|XP_009397608.1|  PREDICTED: calcium-dependent protein kinase ...  60.8    1e-13   
ref|XP_011092924.1|  PREDICTED: calcium-dependent protein kinase ...  62.0    1e-13   
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg           65.1    1e-13   
ref|XP_002454465.1|  hypothetical protein SORBIDRAFT_04g031570        63.5    1e-13   
ref|XP_006647698.1|  PREDICTED: calcium-dependent protein kinase ...  62.8    1e-13   
ref|XP_009334623.1|  PREDICTED: calcium-dependent protein kinase 29   70.5    2e-13   
ref|NP_001047767.1|  Os02g0685900                                     62.4    2e-13   
ref|XP_006283520.1|  hypothetical protein CARUB_v10004572mg           65.1    2e-13   
dbj|BAB16888.1|  OsCDPK7                                              62.0    2e-13   
gb|EAY87105.1|  hypothetical protein OsI_08506                        62.4    2e-13   
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29   64.3    2e-13   
emb|CDX85697.1|  BnaA02g01160D                                        62.4    2e-13   
ref|XP_010529626.1|  PREDICTED: calcium-dependent protein kinase ...  65.1    2e-13   
emb|CDX91168.1|  BnaC02g04290D                                        62.4    2e-13   
ref|XP_006384859.1|  calcium-dependent/calmodulin-independent pro...  61.6    2e-13   
ref|XP_002468587.1|  hypothetical protein SORBIDRAFT_01g048570        61.6    2e-13   
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...  65.5    2e-13   
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...  65.5    2e-13   
ref|XP_008466461.1|  PREDICTED: calcium-dependent protein kinase 29   64.7    2e-13   
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...  62.8    2e-13   
dbj|BAG87126.1|  unnamed protein product                              61.2    2e-13   
ref|XP_010448965.1|  PREDICTED: calcium-dependent protein kinase 15   78.2    2e-13   
ref|XP_010935343.1|  PREDICTED: calcium-dependent protein kinase 26   60.1    2e-13   
ref|XP_010100127.1|  Calcium-dependent protein kinase 29              68.6    3e-13   
ref|XP_003610427.1|  Calcium-dependent protein kinase                 77.8    3e-13   
ref|XP_010536433.1|  PREDICTED: calcium-dependent protein kinase 29   65.5    3e-13   
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g           63.9    3e-13   
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...  64.3    3e-13   
gb|EYU40050.1|  hypothetical protein MIMGU_mgv1a011511mg              63.9    3e-13   
gb|ACJ61504.1|  calcium-dependent protein kinase                      77.8    3e-13   
ref|XP_009135461.1|  PREDICTED: calcium-dependent protein kinase 15   77.4    4e-13   
ref|XP_010906856.1|  PREDICTED: calcium-dependent protein kinase 6    59.7    4e-13   
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    4e-13   
gb|KHN16772.1|  Calcium-dependent protein kinase 3                    62.8    4e-13   
ref|XP_007222396.1|  hypothetical protein PRUPE_ppa004027mg           66.2    4e-13   
ref|XP_011000864.1|  PREDICTED: calcium-dependent protein kinase 26   60.1    4e-13   
ref|XP_008221211.1|  PREDICTED: calcium-dependent protein kinase 29   66.2    4e-13   
gb|AAP03014.1|  seed calcium dependent protein kinase c               77.0    5e-13   
ref|XP_006855638.1|  hypothetical protein AMTR_s00044p00104590        59.3    5e-13   
gb|ADE76782.1|  unknown                                               72.0    5e-13   
gb|AFR11236.1|  calcium dependent protein kinase 6                    60.1    5e-13   
ref|XP_009389198.1|  PREDICTED: calcium-dependent protein kinase ...  60.1    5e-13   
ref|XP_009392207.1|  PREDICTED: calcium-dependent protein kinase ...  60.1    5e-13   
gb|ABE72958.1|  calcium dependent protein kinase 3                    77.0    5e-13   
ref|XP_010028862.1|  PREDICTED: calcium-dependent protein kinase 26   60.1    5e-13   
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3    62.8    5e-13   
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                 77.0    5e-13   
ref|XP_006452350.1|  hypothetical protein CICLE_v10007950mg           65.5    6e-13   
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g           62.4    6e-13   
ref|XP_010940240.1|  PREDICTED: calcium-dependent protein kinase ...  60.1    6e-13   
ref|XP_006596531.1|  PREDICTED: calcium-dependent protein kinase ...  66.6    6e-13   
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...  62.0    6e-13   
gb|AIT39755.1|  calcium-dependent protein kinase 4/5                  59.7    6e-13   
ref|XP_008442973.1|  PREDICTED: calcium-dependent protein kinase ...  61.6    6e-13   
ref|NP_194096.1|  calcium-dependent protein kinase 6                  61.6    6e-13   
gb|AAL38596.1|AF446863_1  AT4g23650/F9D16_120                         61.6    6e-13   
gb|KCW55686.1|  hypothetical protein EUGRSUZ_I01536                   59.7    6e-13   
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3    63.5    7e-13   
ref|XP_010446329.1|  PREDICTED: calcium-dependent protein kinase ...  59.7    7e-13   
emb|CDX70192.1|  BnaA10g25410D                                        61.2    7e-13   
ref|XP_010555170.1|  PREDICTED: calcium-dependent protein kinase ...  58.9    7e-13   
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3    63.5    7e-13   
ref|XP_010555172.1|  PREDICTED: calcium-dependent protein kinase ...  58.9    7e-13   
ref|XP_002298000.1|  calcium-dependent protein kinase 1               63.5    7e-13   
gb|ABC47163.2|  CDPK1                                                 61.2    7e-13   
ref|XP_010555167.1|  PREDICTED: calcium-dependent protein kinase ...  58.9    7e-13   
ref|XP_008812553.1|  PREDICTED: calcium-dependent protein kinase ...  60.1    7e-13   
ref|XP_010555169.1|  PREDICTED: calcium-dependent protein kinase ...  58.9    7e-13   
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                63.2    7e-13   
gb|AET00506.2|  calcium-dependent kinase                              76.6    8e-13   
ref|XP_004985870.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  59.3    8e-13   
ref|XP_007160628.1|  hypothetical protein PHAVU_001G003300g           62.4    8e-13   
ref|XP_010270529.1|  PREDICTED: calcium-dependent protein kinase 26   58.5    8e-13   
ref|XP_004136537.1|  PREDICTED: calcium-dependent protein kinase ...  61.6    8e-13   
gb|KCW68006.1|  hypothetical protein EUGRSUZ_F01695                   67.8    9e-13   
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3    62.4    9e-13   
ref|XP_010690560.1|  PREDICTED: calcium-dependent protein kinase ...  59.3    9e-13   
ref|XP_010061107.1|  PREDICTED: calcium-dependent protein kinase ...  67.8    9e-13   
ref|XP_004249005.1|  PREDICTED: calcium-dependent protein kinase 4    60.8    1e-12   
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    1e-12   
ref|XP_009408515.1|  PREDICTED: calcium-dependent protein kinase ...  63.2    1e-12   
ref|NP_001169430.1|  uncharacterized LOC100383301                     58.9    1e-12   
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    1e-12   
gb|KJB68586.1|  hypothetical protein B456_010G252400                  76.3    1e-12   
ref|NP_001190949.1|  calcium-dependent protein kinase 26              59.3    1e-12   
ref|NP_001190950.1|  calcium-dependent protein kinase 26              59.3    1e-12   
ref|XP_009390783.1|  PREDICTED: calcium-dependent protein kinase ...  57.8    1e-12   
gb|EYU17566.1|  hypothetical protein MIMGU_mgv1a004597mg              62.4    1e-12   
tpg|DAA43115.1|  TPA: putative calcium-dependent protein kinase f...  58.9    1e-12   
gb|AGA83664.1|  calcium-dependent protein kinase 1                    75.9    1e-12   
ref|XP_006452364.1|  hypothetical protein CICLE_v10010377mg           73.2    1e-12   
gb|KFK42039.1|  hypothetical protein AALP_AA2G204000                  62.0    1e-12   
gb|KHG03175.1|  Calcium-dependent protein kinase 4                    60.1    1e-12   
gb|ABY59018.1|  calcium-dependent protein kinase                      60.5    1e-12   
emb|CDY59100.1|  BnaCnng34240D                                        58.9    1e-12   
ref|XP_006411612.1|  hypothetical protein EUTSA_v10025058mg           58.9    1e-12   
gb|KJB79733.1|  hypothetical protein B456_013G064400                  60.1    1e-12   
gb|KHG03174.1|  Calcium-dependent protein kinase 4                    60.1    1e-12   
ref|XP_009101956.1|  PREDICTED: calcium-dependent protein kinase 26   58.9    1e-12   
ref|XP_010431750.1|  PREDICTED: calcium-dependent protein kinase ...  58.9    1e-12   
ref|XP_010025646.1|  PREDICTED: calcium-dependent protein kinase ...  58.9    1e-12   
ref|XP_002868839.1|  predicted protein                                58.9    1e-12   
ref|XP_002874810.1|  hypothetical protein ARALYDRAFT_490109           67.8    1e-12   
ref|XP_002313574.2|  calcium-dependent/calmodulin-independent pro...  58.5    1e-12   
gb|KJB47167.1|  hypothetical protein B456_008G013700                  59.3    1e-12   
ref|XP_008644440.1|  PREDICTED: calcium-dependent protein kinase ...  61.2    1e-12   
gb|KJB79731.1|  hypothetical protein B456_013G064400                  60.1    1e-12   
ref|XP_002973116.1|  calcium dependent protein kinase 1               59.3    1e-12   
emb|CDP14487.1|  unnamed protein product                              57.8    1e-12   
ref|XP_004976604.1|  PREDICTED: calcium-dependent protein kinase ...  59.7    1e-12   
ref|XP_002976739.1|  calcium dependent protein kinase 1               59.3    1e-12   
gb|ABY59005.1|  calcium-dependent protein kinase                      59.7    1e-12   
ref|XP_002446994.1|  hypothetical protein SORBIDRAFT_06g026530        59.7    1e-12   
dbj|BAJ96062.1|  predicted protein                                    59.3    2e-12   
gb|EPS61686.1|  calcium dependent protein kinase 5                    59.3    2e-12   
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3    62.0    2e-12   
ref|XP_004144896.1|  PREDICTED: calcium-dependent protein kinase ...  59.3    2e-12   
gb|AAL68971.1|  phloem calmodulin-like-domain protein kinase PCPK1    59.3    2e-12   
gb|AAV41876.1|  calcium-dependent protein kinase 2                    59.7    2e-12   
ref|XP_008451211.1|  PREDICTED: calcium-dependent protein kinase ...  59.3    2e-12   
dbj|BAJ93361.1|  predicted protein                                    59.7    2e-12   
ref|XP_008804660.1|  PREDICTED: calcium-dependent protein kinase 26   57.4    2e-12   
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                 61.6    2e-12   
ref|XP_010416511.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    2e-12   
gb|AFV30233.1|  calcium-dependent protein kinase                      59.7    2e-12   
ref|XP_008451214.1|  PREDICTED: calcium-dependent protein kinase ...  59.3    2e-12   
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...  61.6    2e-12   
ref|XP_010471751.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    2e-12   
ref|XP_006390245.1|  hypothetical protein EUTSA_v10018359mg           62.4    2e-12   
ref|XP_010428653.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    2e-12   
dbj|BAJ88672.1|  predicted protein                                    59.7    2e-12   
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...  60.5    2e-12   
gb|AAP55748.1|  calcium-dependent protein kinase 3                    58.2    2e-12   
ref|XP_009144207.1|  PREDICTED: calcium-dependent protein kinase ...  74.3    2e-12   
ref|NP_974150.2|  calcium-dependent protein kinase 29                 62.4    2e-12   
dbj|BAJ89609.1|  predicted protein                                    59.3    2e-12   
ref|XP_006302092.1|  hypothetical protein CARUB_v10020082mg           62.0    2e-12   
ref|XP_010428651.1|  PREDICTED: calcium-dependent protein kinase ...  62.0    2e-12   
gb|KDO40816.1|  hypothetical protein CISIN_1g046082mg                 63.5    2e-12   
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...  75.1    2e-12   
sp|Q8RWL2.2|CDPKT_ARATH  RecName: Full=Calcium-dependent protein ...  62.0    2e-12   
ref|XP_006283444.1|  hypothetical protein CARUB_v10004491mg           57.0    2e-12   
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...  75.1    2e-12   
ref|XP_001782248.1|  predicted protein                                75.1    2e-12   
gb|EYU40484.1|  hypothetical protein MIMGU_mgv1a004107mg              58.2    2e-12   
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like          60.8    2e-12   
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg              65.1    2e-12   
gb|KGN53365.1|  hypothetical protein Csa_4G050200                     60.8    2e-12   
ref|XP_007142577.1|  hypothetical protein PHAVU_008G292500g           57.8    3e-12   
ref|XP_006407522.1|  hypothetical protein EUTSA_v10020268mg           61.6    3e-12   
ref|NP_193925.1|  calcium-dependent protein kinase 15                 75.1    3e-12   
ref|NP_001190794.1|  calcium-dependent protein kinase 15              75.1    3e-12   
gb|AAC49405.1|  calcium dependent protein kinase                      57.8    3e-12   
ref|XP_006283446.1|  hypothetical protein CARUB_v10004493mg           75.1    3e-12   
ref|XP_009144205.1|  PREDICTED: calcium-dependent protein kinase ...  74.3    3e-12   
ref|XP_002884805.1|  calmodulin-domain protein kinase CDPK isoform 2  61.2    3e-12   
gb|AAF26765.1|AC007396_14  T4O12.25                                   61.2    3e-12   
ref|XP_011088723.1|  PREDICTED: calcium-dependent protein kinase ...  57.4    3e-12   
ref|XP_009615238.1|  PREDICTED: calcium-dependent protein kinase 4    57.4    3e-12   
ref|XP_006452352.1|  hypothetical protein CICLE_v100107182mg          70.9    3e-12   
ref|XP_009122558.1|  PREDICTED: calcium-dependent protein kinase 1    60.1    3e-12   
ref|XP_011003085.1|  PREDICTED: calcium-dependent protein kinase ...  61.6    4e-12   
emb|CDX98791.1|  BnaC09g50440D                                        58.9    4e-12   
ref|XP_011003084.1|  PREDICTED: calcium-dependent protein kinase ...  61.2    4e-12   
gb|KHG03431.1|  Calcium-dependent protein kinase 3                    60.8    4e-12   
ref|XP_009790348.1|  PREDICTED: calcium-dependent protein kinase 4    57.0    4e-12   
gb|EPS65220.1|  hypothetical protein M569_09555                       62.4    4e-12   
ref|XP_010645740.1|  PREDICTED: calcium-dependent protein kinase ...  57.8    4e-12   
gb|AAZ32751.1|  calcium dependent kinase 5                            57.0    4e-12   
gb|EMT05629.1|  Calcium-dependent protein kinase 34                   58.5    4e-12   
gb|KEH28424.1|  calcium-dependent kinase                              73.6    4e-12   
ref|XP_002887624.1|  T4O12.25                                         62.0    4e-12   
ref|XP_011088720.1|  PREDICTED: calcium-dependent protein kinase ...  56.6    4e-12   
ref|XP_007199654.1|  hypothetical protein PRUPE_ppa003459mg           58.2    4e-12   
ref|XP_008365078.1|  PREDICTED: calcium-dependent protein kinase ...  58.2    5e-12   
ref|XP_009398351.1|  PREDICTED: calcium-dependent protein kinase ...  60.5    5e-12   
ref|XP_002965108.1|  calcium dependent protein kinase 5               60.1    5e-12   
ref|XP_008377838.1|  PREDICTED: calcium-dependent protein kinase 26   58.2    5e-12   
ref|XP_010548179.1|  PREDICTED: calcium-dependent protein kinase ...  57.0    5e-12   
ref|XP_010515321.1|  PREDICTED: calcium-dependent protein kinase 6    56.6    5e-12   
gb|KJB19075.1|  hypothetical protein B456_003G084000                  60.5    5e-12   
ref|XP_003572014.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    5e-12   
ref|XP_002282994.1|  PREDICTED: calcium-dependent protein kinase ...  57.8    5e-12   
ref|XP_008348947.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  58.2    5e-12   
ref|XP_004290076.1|  PREDICTED: calcium-dependent protein kinase 26   58.2    5e-12   
ref|XP_010467489.1|  PREDICTED: calcium-dependent protein kinase ...  56.6    5e-12   
ref|XP_003544188.1|  PREDICTED: calcium-dependent protein kinase ...  56.6    5e-12   
gb|KHN46862.1|  Calcium-dependent protein kinase 4                    56.6    5e-12   
emb|CDX73914.1|  BnaA03g31330D                                        60.5    5e-12   



>ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=543

 Score =   113 bits (282),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 83/141 (59%), Gaps = 22/141 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGCFSK+K    DVNGYR G    TGYQ   +SHQ         Y +P   Y PQPQ+ 
Sbjct  1    MGGCFSKNKYSSPDVNGYRSGTA-GTGYQ---QSHQD--------YQKPSTQYTPQPQAE  48

Query  301  APVHVPAKpssvpqp----------vrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQF  450
               H    P   PQ              VQ+ E NNILGKPFED+K+ Y++ KELGRGQF
Sbjct  49   PERHHQPPPPRQPQNPAPLRPAPQPQNTVQKLEHNNILGKPFEDVKSKYTISKELGRGQF  108

Query  451  GVTYLCTEISTRRAYACKSIL  513
            GVTYLCT+++T   YACKSIL
Sbjct  109  GVTYLCTDVATGNQYACKSIL  129


 Score = 49.7 bits (117),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSKNDKED+KRE+ IMQHLSGQ
Sbjct  131  RKLVSKNDKEDMKREVHIMQHLSGQ  155



>ref|XP_009597333.1| PREDICTED: calcium-dependent protein kinase-like [Nicotiana tomentosiformis]
Length=539

 Score =   112 bits (280),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 78/131 (60%), Gaps = 7/131 (5%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGCFSK+K  Q D   YR  RG    YQP    H +    + + Y +P     PQ + Y
Sbjct  1    MGGCFSKNKYGQPDGKRYRPRRGANAAYQPY--QHYQHPVYYHRNYQRP-----PQERQY  53

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P H   +   VP         E + ILGKPFEDIKAHY+LG+ELGRGQ+GV Y CTEIS
Sbjct  54   KPPHSQQQVQQVPVKNSQPHFQEQDTILGKPFEDIKAHYTLGQELGRGQYGVIYHCTEIS  113

Query  481  TRRAYACKSIL  513
            T +AYACKSIL
Sbjct  114  TGQAYACKSIL  124


 Score = 47.4 bits (111),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK DKEDIK EIQIMQHLSGQ
Sbjct  126  RKLVSKKDKEDIKNEIQIMQHLSGQ  150



>ref|XP_010278695.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=539

 Score =   103 bits (257),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 72/134 (54%), Gaps = 16/134 (12%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ----PVTESHQKASSTHAQTYTQPERPYNPQ  288
            MG CFSK    Q DVNG+R G  VA   Q    PV  +  K  +   QT   PERP   Q
Sbjct  1    MGHCFSKDNVSQLDVNGHRSGADVARHQQRRQEPVVHTQHKPPAQQ-QTRPLPERP-KTQ  58

Query  289  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  468
            P + APV                       ILGKPFED+K+HY++ KELGRGQFGVTYLC
Sbjct  59   PLAPAPVR----------SSPYSLTHRQETILGKPFEDVKSHYTIRKELGRGQFGVTYLC  108

Query  469  TEISTRRAYACKSI  510
             E ST   YACKSI
Sbjct  109  IENSTGHTYACKSI  122


 Score = 49.3 bits (116),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSKNDK+DI+REIQIMQHL+GQ
Sbjct  125  RKLVSKNDKDDIRREIQIMQHLTGQ  149



>ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana 
sylvestris]
Length=551

 Score =   104 bits (259),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 80/138 (58%), Gaps = 9/138 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQP--ERPYNPQPQ  294
            MGGCFSK+K  Q D   YR  RG    YQP    H +    + Q Y +P  ERPY  + Q
Sbjct  1    MGGCFSKNKYGQPDGKRYRPRRGANAAYQPY--QHYQHPVYYHQNYQRPPQERPYKTRAQ  58

Query  295  SYAPVH-----VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  459
                       V   P    QP    QR E + ILGKPFEDIKAHY+LG+ELGRGQ+GV 
Sbjct  59   QQQQQQQQQQQVHQNPVKNSQPHIQEQRIEQDTILGKPFEDIKAHYTLGQELGRGQYGVI  118

Query  460  YLCTEISTRRAYACKSIL  513
            Y CTEIST + YACKSIL
Sbjct  119  YHCTEISTGQPYACKSIL  136


 Score = 48.1 bits (113),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K DKEDIKREIQIMQHLSGQ
Sbjct  138  RKLVNKKDKEDIKREIQIMQHLSGQ  162



>ref|XP_009776260.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Nicotiana 
sylvestris]
Length=503

 Score =   104 bits (259),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 80/138 (58%), Gaps = 9/138 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQP--ERPYNPQPQ  294
            MGGCFSK+K  Q D   YR  RG    YQP    H +    + Q Y +P  ERPY  + Q
Sbjct  1    MGGCFSKNKYGQPDGKRYRPRRGANAAYQPY--QHYQHPVYYHQNYQRPPQERPYKTRAQ  58

Query  295  SYAPVH-----VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  459
                       V   P    QP    QR E + ILGKPFEDIKAHY+LG+ELGRGQ+GV 
Sbjct  59   QQQQQQQQQQQVHQNPVKNSQPHIQEQRIEQDTILGKPFEDIKAHYTLGQELGRGQYGVI  118

Query  460  YLCTEISTRRAYACKSIL  513
            Y CTEIST + YACKSIL
Sbjct  119  YHCTEISTGQPYACKSIL  136


 Score = 48.1 bits (113),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K DKEDIKREIQIMQHLSGQ
Sbjct  138  RKLVNKKDKEDIKREIQIMQHLSGQ  162



>ref|XP_008226901.1| PREDICTED: calcium-dependent protein kinase 2 [Prunus mume]
Length=545

 Score = 99.8 bits (247),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 72/140 (51%), Gaps = 22/140 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTE--SHQKASSTHAQTYTQPER-------  273
            MG C SKSK  +   NGYR G G    YQ   E  + Q  +S     +  PE+       
Sbjct  1    MGKCLSKSKDSEPQYNGYRSGGGAGAHYQKPHEPVAPQPKASAQQAHHQLPEKRGSAAAH  60

Query  274  -PYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQF  450
                P  + Y PV  P                 P+ ILGKP+ED+K HY++GKELGRGQF
Sbjct  61   QELQPAWKPYVPVKSP------------KPVYRPDTILGKPYEDVKQHYTIGKELGRGQF  108

Query  451  GVTYLCTEISTRRAYACKSI  510
            GVTYLCTE ST   YACKSI
Sbjct  109  GVTYLCTENSTGNKYACKSI  128


 Score = 51.6 bits (122),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKEDIKREIQIMQHLSGQ
Sbjct  131  RKLVTKNDKEDIKREIQIMQHLSGQ  155



>gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng]
Length=549

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 84/151 (56%), Gaps = 39/151 (26%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVT-ESHQKASSTHAQTYTQPERP-------  276
            MGGC SK +  Q DVNGYR GR   TGYQ V+ + ++K S+ +  T  Q           
Sbjct  1    MGGCASKKQDYQADVNGYRSGRNGGTGYQTVSGQGYEKPSTQYNPTQPQRPHQTQPQPQP  60

Query  277  ------------YNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYS  420
                        +NP P+   PVH P                EPN ILGK FEDI+AHY+
Sbjct  61   KQPAPAPLKPAAHNPSPR---PVHKP----------------EPNTILGKKFEDIRAHYT  101

Query  421  LGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            LGKELGRGQFGVTYLCTEIS+   YACKSIL
Sbjct  102  LGKELGRGQFGVTYLCTEISSGHFYACKSIL  132


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSKNDKED+
Sbjct  87   TILGKKFEDIRAHYTLGKELGRGQFG-VTYLCTEISSGHFYACKSILKRKLVSKNDKEDM  145

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHLSGQ
Sbjct  146  KREIQIMQHLSGQ  158



>gb|KJB81729.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=444

 Score = 99.8 bits (247),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 76/136 (56%), Gaps = 22/136 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGC +K+K      NGYR G   AT            ++ H Q Y  P RP   QPQ Y
Sbjct  1    MGGCLTKNKDPMPQHNGYRSG---AT----------TTAAVHQQRYQDPVRPAPIQPQVY  47

Query  301  APVHVPAKpssvpqpvrpvqrpEP------NNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
               H+P KP +       V  P P      + ILGKPFEDI+ HY++GKELG+GQFGVTY
Sbjct  48   ---HIPQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQFGVTY  104

Query  463  LCTEISTRRAYACKSI  510
             CTE ST + YACK+I
Sbjct  105  HCTENSTGKQYACKTI  120


 Score = 49.3 bits (116),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV KNDKED+KREIQIMQHLSGQ
Sbjct  123  RKLVRKNDKEDMKREIQIMQHLSGQ  147



>ref|XP_009360996.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=544

 Score =   101 bits (251),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 75/133 (56%), Gaps = 9/133 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGY---RQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG C SKSK  +   NGY     G G    +Q    SH+ A++ H Q   +   P N +P
Sbjct  1    MGKCLSKSKDSERQRNGYISVGGGEGGGGVHQQKPHSHE-AAAVHQQRPEKRGLPVNQEP  59

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            Q      VPA+                N ILGKPFED++ HY++GKELGRGQFGVTYLCT
Sbjct  60   QPAWKPTVPARTPKPAAQRPA-----DNTILGKPFEDVRVHYTIGKELGRGQFGVTYLCT  114

Query  472  EISTRRAYACKSI  510
            EIST + YACKSI
Sbjct  115  EISTGKKYACKSI  127


 Score = 47.8 bits (112),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKEDIKREIQIMQ LSGQ
Sbjct  130  RKLVTKNDKEDIKREIQIMQDLSGQ  154



>gb|KJB81728.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=480

 Score = 99.8 bits (247),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 76/136 (56%), Gaps = 22/136 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGC +K+K      NGYR G   AT            ++ H Q Y  P RP   QPQ Y
Sbjct  1    MGGCLTKNKDPMPQHNGYRSG---AT----------TTAAVHQQRYQDPVRPAPIQPQVY  47

Query  301  APVHVPAKpssvpqpvrpvqrpEP------NNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
               H+P KP +       V  P P      + ILGKPFEDI+ HY++GKELG+GQFGVTY
Sbjct  48   ---HIPQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQFGVTY  104

Query  463  LCTEISTRRAYACKSI  510
             CTE ST + YACK+I
Sbjct  105  HCTENSTGKQYACKTI  120


 Score = 49.3 bits (116),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV KNDKED+KREIQIMQHLSGQ
Sbjct  123  RKLVRKNDKEDMKREIQIMQHLSGQ  147



>gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata]
Length=539

 Score = 99.4 bits (246),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 73/131 (56%), Gaps = 7/131 (5%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGCFSK K    D NGYR      T Y        +   T           YNP P   
Sbjct  1    MGGCFSKGKYSSPDANGYRSAN---TAYNQQNYEKPQPQYTPQPPTQPERHHYNPPPPPP  57

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                    P   PQP  PVQ+ EPNNILGKPFED+K+HY++GKELGRGQFGVTY C EIS
Sbjct  58   PK----TSPPPQPQPQHPVQKLEPNNILGKPFEDVKSHYTVGKELGRGQFGVTYSCIEIS  113

Query  481  TRRAYACKSIL  513
            T   YACKSIL
Sbjct  114  TGHHYACKSIL  124


 Score = 48.5 bits (114),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSKNDK+D+KRE+ IMQHLSGQ
Sbjct  126  RKLVSKNDKDDMKREVHIMQHLSGQ  150



>ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=680

 Score = 97.1 bits (240),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 20/131 (15%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  297
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  478  STRRAYACKSI  510
            ST R +ACKSI
Sbjct  102  STGRQFACKSI  112


 Score = 50.4 bits (119),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDK+DIKREIQIMQHLSGQ
Sbjct  115  RKLVTKNDKDDIKREIQIMQHLSGQ  139



>ref|XP_007020820.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
 gb|EOY12345.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
Length=536

 Score = 96.3 bits (238),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 73/136 (54%), Gaps = 22/136 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGC +KSK  +   NGYR G                  + H Q Y +P RP   QPQ +
Sbjct  1    MGGCLTKSKEPKPKHNGYRSGATTTV-------------AVHQQRYQEPVRPAPVQPQFH  47

Query  301  APVHVPAK------pssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
               H+P K         V     P   P  + ILGKP+EDI+  Y++GKELG+GQFGVTY
Sbjct  48   ---HIPEKPGAQTPWKPVAPAPSPKPAPRVDTILGKPYEDIRMRYTIGKELGKGQFGVTY  104

Query  463  LCTEISTRRAYACKSI  510
            LCTE ST + YACK+I
Sbjct  105  LCTENSTGKQYACKTI  120


 Score = 50.4 bits (119),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKED+KREIQIMQHLSGQ
Sbjct  123  RKLVTKNDKEDMKREIQIMQHLSGQ  147



>ref|XP_007020821.1| Calmodulin-domain protein kinase 9 isoform 2 [Theobroma cacao]
 gb|EOY12346.1| Calmodulin-domain protein kinase 9 isoform 2 [Theobroma cacao]
Length=390

 Score = 95.9 bits (237),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 73/136 (54%), Gaps = 22/136 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGC +KSK  +   NGYR G                  + H Q Y +P RP   QPQ +
Sbjct  1    MGGCLTKSKEPKPKHNGYRSGATTTV-------------AVHQQRYQEPVRPAPVQPQFH  47

Query  301  APVHVPAK------pssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
               H+P K         V     P   P  + ILGKP+EDI+  Y++GKELG+GQFGVTY
Sbjct  48   ---HIPEKPGAQTPWKPVAPAPSPKPAPRVDTILGKPYEDIRMRYTIGKELGKGQFGVTY  104

Query  463  LCTEISTRRAYACKSI  510
            LCTE ST + YACK+I
Sbjct  105  LCTENSTGKQYACKTI  120


 Score = 50.4 bits (119),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKED+KREIQIMQHLSGQ
Sbjct  123  RKLVTKNDKEDMKREIQIMQHLSGQ  147



>gb|KHG28675.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=537

 Score = 97.1 bits (240),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 75/137 (55%), Gaps = 23/137 (17%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C +KSK  +   NGY  G        P T      ++ H Q Y +P RP   QPQ +
Sbjct  1    MGTCLTKSKDSKPTHNGYGSG--------PTT-----TAAVHQQRYQEPVRPAPVQPQFH  47

Query  301  APVHVPAKpssvpqpvrpvqrpEP-------NNILGKPFEDIKAHYSLGKELGRGQFGVT  459
               H+P KP +          P P       + ILGKPFEDI+ HY++GKELG+GQFGVT
Sbjct  48   ---HIPEKPGTQTPWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQFGVT  104

Query  460  YLCTEISTRRAYACKSI  510
            YLC E ST + YACK+I
Sbjct  105  YLCIENSTGKQYACKTI  121


 Score = 47.0 bits (110),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV++NDKED++REIQIMQHLSGQ
Sbjct  124  KKLVTRNDKEDMRREIQIMQHLSGQ  148



>emb|CDP04396.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 87/137 (64%), Gaps = 10/137 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYR-----QGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNP  285
            MGGCFSK K  Q  +NG+R           T YQ   +++QK +  +     Q ER Y P
Sbjct  1    MGGCFSKKKYPQSSINGHRSGGGAAAAATTTAYQQSYQTNQKQAVQYTPQPHQAERFYQP  60

Query  286  QPQSYAPVHVPAKpssvpqpvrp-vqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
            QP    P  VPAKPS+ P       QR EPN ILGKPF+D++AHY+LG+ELG+GQFGVTY
Sbjct  61   QP----PSSVPAKPSAQPPQRPRPAQRQEPNTILGKPFDDVRAHYTLGRELGKGQFGVTY  116

Query  463  LCTEISTRRAYACKSIL  513
            LCTE +T + YACKSIL
Sbjct  117  LCTENATGQKYACKSIL  133


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 58/131 (44%), Gaps = 21/131 (16%)
 Frame = +2

Query  218  KAIKRHPQP-----MPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITY  382
            +A++  PQP       +P P    P   S  P  +    Q   Q PN           T 
Sbjct  43   QAVQYTPQPHQAERFYQPQPPSSVPAKPSAQPPQRPRPAQR--QEPN-----------TI  89

Query  383  WGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKR  556
             G     +R    LG+  G    G +T +      G   A +    RKLVSKNDKED+KR
Sbjct  90   LGKPFDDVRAHYTLGRELGKGQFG-VTYLCTENATGQKYACKSILKRKLVSKNDKEDMKR  148

Query  557  EIQIMQHLSGQ  589
            EIQIMQHLSGQ
Sbjct  149  EIQIMQHLSGQ  159



>gb|KDP39132.1| hypothetical protein JCGZ_00889 [Jatropha curcas]
Length=535

 Score = 92.4 bits (228),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 14/131 (11%)
 Frame = +1

Query  121  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MG CFSK K + Q   NG  +            + HQKA          P +P    P  
Sbjct  1    MGHCFSKDKKAHQQHYNGADR-----------MQHHQKAQEPVTYQSKSPVQPTYQLPSQ  49

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
              P+HVP KP++     +PVQ  +P+ IL KPFED++ HY++GKELGRGQFGVTYLCTE 
Sbjct  50   QPPIHVPRKPAAPAPSPKPVQ--KPDTILEKPFEDLRLHYTIGKELGRGQFGVTYLCTEN  107

Query  478  STRRAYACKSI  510
            ST R YACKSI
Sbjct  108  STGRRYACKSI  118


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKED+KREIQIMQHLSGQ
Sbjct  121  RKLVTKNDKEDMKREIQIMQHLSGQ  145



>gb|KJB13681.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=481

 Score = 95.1 bits (235),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 74/137 (54%), Gaps = 23/137 (17%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C +KSK  +   NGY  G        P T      ++ H Q Y +P RP   Q Q +
Sbjct  1    MGSCLTKSKDSKPKHNGYGSG--------PTT-----TAAVHQQRYQEPVRPAPVQSQFH  47

Query  301  APVHVPAKpssvpqpvrpvqrpEP-------NNILGKPFEDIKAHYSLGKELGRGQFGVT  459
               H+P KP +          P P       + ILGKPFEDI+ HY++GKELG+GQFGVT
Sbjct  48   ---HIPEKPGTQTSWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQFGVT  104

Query  460  YLCTEISTRRAYACKSI  510
            YLC E ST + YACK+I
Sbjct  105  YLCIENSTGKQYACKTI  121


 Score = 47.0 bits (110),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV++NDKED++REIQIMQHLSGQ
Sbjct  124  KKLVTRNDKEDMRREIQIMQHLSGQ  148



>gb|KJB13679.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13680.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13682.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=537

 Score = 95.1 bits (235),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 74/137 (54%), Gaps = 23/137 (17%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C +KSK  +   NGY  G        P T      ++ H Q Y +P RP   Q Q +
Sbjct  1    MGSCLTKSKDSKPKHNGYGSG--------PTT-----TAAVHQQRYQEPVRPAPVQSQFH  47

Query  301  APVHVPAKpssvpqpvrpvqrpEP-------NNILGKPFEDIKAHYSLGKELGRGQFGVT  459
               H+P KP +          P P       + ILGKPFEDI+ HY++GKELG+GQFGVT
Sbjct  48   ---HIPEKPGTQTSWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQFGVT  104

Query  460  YLCTEISTRRAYACKSI  510
            YLC E ST + YACK+I
Sbjct  105  YLCIENSTGKQYACKTI  121


 Score = 47.0 bits (110),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV++NDKED++REIQIMQHLSGQ
Sbjct  124  KKLVTRNDKEDMRREIQIMQHLSGQ  148



>gb|KDO62721.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=207

 Score = 90.5 bits (223),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 20/131 (15%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  297
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  478  STRRAYACKSI  510
            ST R +ACKSI
Sbjct  102  STGRQFACKSI  112


 Score = 50.8 bits (120),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDK+DIKREIQIMQHLSGQ
Sbjct  115  RKLVTKNDKDDIKREIQIMQHLSGQ  139



>ref|XP_006452370.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65610.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=472

 Score = 90.9 bits (224),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 20/131 (15%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  297
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  478  STRRAYACKSI  510
            ST R +ACKSI
Sbjct  102  STGRQFACKSI  112


 Score = 50.4 bits (119),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDK+DIKREIQIMQHLSGQ
Sbjct  115  RKLVTKNDKDDIKREIQIMQHLSGQ  139



>ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=529

 Score = 90.9 bits (224),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 20/131 (15%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  297
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  478  STRRAYACKSI  510
            ST R +ACKSI
Sbjct  102  STGRQFACKSI  112


 Score = 50.4 bits (119),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDK+DIKREIQIMQHLSGQ
Sbjct  115  RKLVTKNDKDDIKREIQIMQHLSGQ  139



>gb|KDO62718.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62719.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62720.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=235

 Score = 90.5 bits (223),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 20/131 (15%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  297
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  478  STRRAYACKSI  510
            ST R +ACKSI
Sbjct  102  STGRQFACKSI  112


 Score = 50.8 bits (120),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDK+DIKREIQIMQHLSGQ
Sbjct  115  RKLVTKNDKDDIKREIQIMQHLSGQ  139



>gb|KCW66999.1| hypothetical protein EUGRSUZ_F007611, partial [Eucalyptus grandis]
Length=346

 Score = 92.0 bits (227),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 72/131 (55%), Gaps = 6/131 (5%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  478  STRRAYACKSI  510
            ST R YACKSI
Sbjct  116  STGRQYACKSI  126


 Score = 48.9 bits (115),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKED+KREI IMQHLSGQ
Sbjct  129  RKLVTKNDKEDMKREIHIMQHLSGQ  153



>ref|XP_010060348.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X2 
[Eucalyptus grandis]
Length=550

 Score = 92.0 bits (227),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 72/131 (55%), Gaps = 6/131 (5%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  478  STRRAYACKSI  510
            ST R YACKSI
Sbjct  116  STGRQYACKSI  126


 Score = 48.9 bits (115),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKED+KREI IMQHLSGQ
Sbjct  129  RKLVTKNDKEDMKREIHIMQHLSGQ  153



>ref|XP_010060346.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X1 
[Eucalyptus grandis]
Length=535

 Score = 92.0 bits (227),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 72/131 (55%), Gaps = 6/131 (5%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  478  STRRAYACKSI  510
            ST R YACKSI
Sbjct  116  STGRQYACKSI  126


 Score = 48.5 bits (114),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKED+KREI IMQHLSGQ
Sbjct  129  RKLVTKNDKEDMKREIHIMQHLSGQ  153



>ref|XP_010060380.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW67038.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=543

 Score = 92.0 bits (227),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 72/131 (55%), Gaps = 6/131 (5%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  478  STRRAYACKSI  510
            ST R YACKSI
Sbjct  116  STGRQYACKSI  126


 Score = 48.5 bits (114),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSKNDKED++REI IMQHLSGQ
Sbjct  129  RKLVSKNDKEDMRREIHIMQHLSGQ  153



>gb|KCW67039.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=492

 Score = 91.7 bits (226),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 72/131 (55%), Gaps = 6/131 (5%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  478  STRRAYACKSI  510
            ST R YACKSI
Sbjct  116  STGRQYACKSI  126


 Score = 48.5 bits (114),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSKNDKED++REI IMQHLSGQ
Sbjct  129  RKLVSKNDKEDMRREIHIMQHLSGQ  153



>ref|XP_006350481.1| PREDICTED: calcium-dependent protein kinase-like [Solanum tuberosum]
Length=545

 Score = 94.4 bits (233),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 77/137 (56%), Gaps = 13/137 (9%)
 Frame = +1

Query  121  MGGCFSKSK--SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ  294
            MGGCFSK+K   R G  N  R  RG      P +  H K    +    TQ ERPY PQ  
Sbjct  1    MGGCFSKNKYIERDGKGNRPRTRRGNT----PASYQHYKHPVYYHPRPTQ-ERPYMPQHP  55

Query  295  SYAPVH----VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
                      V  K +    PV      +P  ILGKP+E+IKAHY+LG+ELGRGQ+GV Y
Sbjct  56   QQQQQRHAHQVTVKSTQPNVPVIQRIEQDP--ILGKPYENIKAHYTLGRELGRGQYGVIY  113

Query  463  LCTEISTRRAYACKSIL  513
            LCTE STRR YACKSIL
Sbjct  114  LCTENSTRRNYACKSIL  130


 Score = 45.1 bits (105),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV++ D+EDIKREIQ+MQHLSGQ
Sbjct  132  RKLVNRKDREDIKREIQMMQHLSGQ  156



>ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=538

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 79/134 (59%), Gaps = 17/134 (13%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ----PVTESHQKASSTHAQTYTQPERPYNPQ  288
            MG C SK K  + DVNG+R G  V    Q    PV ++  K  +   QT+  PER   PQ
Sbjct  1    MGLCISKEKVPEPDVNGHRSGANVVRHQQRRQEPVVQAQPKIPAQ--QTHLLPER-RQPQ  57

Query  289  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  468
            P + APV          +P       + + ILGKPFEDIKAHY+LGKELGRGQFGVTYLC
Sbjct  58   PPAAAPV----------KPSPHSLVHKQDTILGKPFEDIKAHYTLGKELGRGQFGVTYLC  107

Query  469  TEISTRRAYACKSI  510
            TE ST   YACKSI
Sbjct  108  TENSTGHTYACKSI  121


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 41/75 (55%), Gaps = 3/75 (4%)
 Frame = +2

Query  371  QITYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKE  544
            Q T  G     ++    LGK  G    G +T +      G   A +    RKLVSKNDK+
Sbjct  75   QDTILGKPFEDIKAHYTLGKELGRGQFG-VTYLCTENSTGHTYACKSISKRKLVSKNDKD  133

Query  545  DIKREIQIMQHLSGQ  589
            DIKREIQIMQHL+GQ
Sbjct  134  DIKREIQIMQHLTGQ  148



>ref|XP_002532559.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF29820.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=533

 Score = 89.7 bits (221),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 75/145 (52%), Gaps = 44/145 (30%)
 Frame = +1

Query  121  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQ-------------PVTESHQKASST-HAQT  255
            MG C SK K S+Q   NG       ATG Q             P   S+Q  S T  AQ 
Sbjct  1    MGFCLSKEKRSQQHHYNG-------ATGLQHQSREPVAYQSKSPAQPSYQFPSQTPGAQI  53

Query  256  YTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKEL  435
               P +P  P P S  PVH                  +P+ IL KP+ED+K HY++GKEL
Sbjct  54   ---PRKPVVPAP-SPKPVH------------------KPDTILEKPYEDVKLHYTIGKEL  91

Query  436  GRGQFGVTYLCTEISTRRAYACKSI  510
            GRGQFGVTYLCTEIST + YACKSI
Sbjct  92   GRGQFGVTYLCTEISTGKLYACKSI  116


 Score = 49.3 bits (116),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV++NDKED+KREIQIMQHLSGQ
Sbjct  119  RKLVTRNDKEDMKREIQIMQHLSGQ  143



>ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=541

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 86/145 (59%), Gaps = 32/145 (22%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ--  294
            MGGC SK++    D+NGYR G    TGYQ   +SHQ         Y +P   Y PQP+  
Sbjct  1    MGGCCSKNEPSTRDINGYRSGGAGNTGYQ---QSHQ---------YQKPSTQYTPQPERH  48

Query  295  ------------SYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELG  438
                          AP H PA     PQP   VQ+ E NNILGKPFED+K+ Y++GKELG
Sbjct  49   HHPTPPTQPHPPIPAP-HGPA-----PQPQNAVQKLEHNNILGKPFEDVKSKYTIGKELG  102

Query  439  RGQFGVTYLCTEISTRRAYACKSIL  513
            RGQFGVTY CTEI+T + YACKSIL
Sbjct  103  RGQFGVTYSCTEIATGQQYACKSIL  127


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 50/105 (48%), Gaps = 19/105 (18%)
 Frame = +2

Query  284  HSPSPMLQSMSLQNPHQCPNLLGL-FRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG*L  460
            H P+P  Q+   +  H   N+LG  F D+             +    +GK  G    G +
Sbjct  65   HGPAPQPQNAVQKLEHN--NILGKPFEDV-------------KSKYTIGKELGRGQFG-V  108

Query  461  TCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            T        G   A +    RKLVSKNDKED+KRE+ IMQHLSGQ
Sbjct  109  TYSCTEIATGQQYACKSILKRKLVSKNDKEDMKREVHIMQHLSGQ  153



>ref|XP_008385882.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
isoform 2 [Malus domestica]
Length=470

 Score = 84.7 bits (208),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            N ILGKPFED++  Y++GKELGRGQFGVTYLCTEIST + YACKSI
Sbjct  61   NTILGKPFEDVRLRYTIGKELGRGQFGVTYLCTEISTGKKYACKSI  106


 Score = 51.6 bits (122),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKEDIKREIQIMQHLSGQ
Sbjct  109  RKLVTKNDKEDIKREIQIMQHLSGQ  133



>ref|XP_011047988.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Populus 
euphratica]
Length=533

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 77/140 (55%), Gaps = 30/140 (21%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGY---------QPVTESHQKASSTHAQTYTQPER  273
            MG C SK  +R+ DVNGYR   G ATGY             +S QK +    QT T P R
Sbjct  1    MGCCASKENARRPDVNGYR---GPATGYPRQTNQQQQPQYHQSQQKVTVPQIQTQTPPTR  57

Query  274  PYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFG  453
            P   Q Q+  P   P                 P+ ILGKPFEDIK HY+LGKELGRGQFG
Sbjct  58   PQQTQHQT--PPTRPV----------------PDTILGKPFEDIKQHYTLGKELGRGQFG  99

Query  454  VTYLCTEISTRRAYACKSIL  513
            VTYLCTE ST   YACKSIL
Sbjct  100  VTYLCTENSTGHTYACKSIL  119



>ref|XP_011047987.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Populus 
euphratica]
Length=544

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 80/140 (57%), Gaps = 19/140 (14%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGY---------QPVTESHQKASSTHAQTYTQPER  273
            MG C SK  +R+ DVNGYR   G ATGY             +S QK +    QT T P R
Sbjct  1    MGCCASKENARRPDVNGYR---GPATGYPRQTNQQQQPQYHQSQQKVTVPQIQTQTPPTR  57

Query  274  PYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFG  453
            P   Q Q+        +  +  +PV       P+ ILGKPFEDIK HY+LGKELGRGQFG
Sbjct  58   PQQTQHQTPPARPQQTQQQTPTRPV-------PDTILGKPFEDIKQHYTLGKELGRGQFG  110

Query  454  VTYLCTEISTRRAYACKSIL  513
            VTYLCTE ST   YACKSIL
Sbjct  111  VTYLCTENSTGHTYACKSIL  130



>ref|XP_007213894.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
 gb|EMJ15093.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
Length=545

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 76/138 (55%), Gaps = 18/138 (13%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTE--SHQKASSTHAQTYTQPER------P  276
            MG C SKSK  +   NGYR G G    YQ   E  +HQ  +S     +  PE+       
Sbjct  1    MGKCLSKSKDSEPQYNGYRSGGGAGAHYQKPHEPVAHQPKASAQQARHQLPEKRGSAAAQ  60

Query  277  YNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGV  456
              PQP ++ P  VP K               P+ ILGKPFED+K HY++GKELGRGQFGV
Sbjct  61   QEPQP-AWKP-SVPVKSPKPVY--------RPDTILGKPFEDVKQHYTIGKELGRGQFGV  110

Query  457  TYLCTEISTRRAYACKSI  510
            TYLCTE ST   YACKSI
Sbjct  111  TYLCTENSTGNKYACKSI  128


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 60/125 (48%), Gaps = 29/125 (23%)
 Frame = +2

Query  221  AIKRHPQPMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLR  400
            A ++ PQP  KP   +K     SP P+ +  ++        L   F D+ Q         
Sbjct  58   AAQQEPQPAWKPSVPVK-----SPKPVYRPDTI--------LGKPFEDVKQ---------  95

Query  401  TLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDIKREIQIMQ  574
               H T+ GK  G    G +T +      G   A +    RKLV+KNDKEDIKREIQIMQ
Sbjct  96   ---HYTI-GKELGRGQFG-VTYLCTENSTGNKYACKSISKRKLVTKNDKEDIKREIQIMQ  150

Query  575  HLSGQ  589
            HLSGQ
Sbjct  151  HLSGQ  155



>gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea]
Length=503

 Score = 87.4 bits (215),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            EPNNI GKPFE+IK+ Y++G+ELGRGQFGVTYLCTEI++ + YACKSIL
Sbjct  38   EPNNIFGKPFENIKSKYAVGRELGRGQFGVTYLCTEIASGQQYACKSIL  86


 Score = 45.4 bits (106),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDK+D+KRE+ IM+HLSGQ
Sbjct  88   RKLVTKNDKDDMKREVHIMEHLSGQ  112



>ref|XP_010675716.1| PREDICTED: calcium-dependent protein kinase 33-like [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score = 88.6 bits (218),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 73/130 (56%), Gaps = 11/130 (8%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C SK+K  + + NGYR G      Y    ++  +      +      R  NP+P   
Sbjct  1    MGICASKNKDSKVEQNGYRAG----NEYNQQPKAPVQQQQPQQEQQQYVPRQ-NPEPN--  53

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             PV  P    S     +  QR +PN ILGKPFED+K HY+LGKELGRGQFGVTYLC + +
Sbjct  54   -PVSQPG---SKGVAAKGGQRNDPNTILGKPFEDVKMHYTLGKELGRGQFGVTYLCVDKT  109

Query  481  TRRAYACKSI  510
            + + YACKSI
Sbjct  110  SGQQYACKSI  119


 Score = 44.3 bits (103),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV++ DKED+KREIQIMQH+SGQ
Sbjct  122  KKLVTRADKEDMKREIQIMQHMSGQ  146



>ref|XP_009798561.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=521

 Score = 88.2 bits (217),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 68/127 (54%), Gaps = 27/127 (21%)
 Frame = +1

Query  130  CFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPV  309
            C SKSK  Q + NG+    GV          H+          T+ +   +P P+S  PV
Sbjct  5    CSSKSKPEQSNANGHHGSGGVG--------PHR----------TEIQYTKSPGPESQLPV  46

Query  310  HVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRR  489
              P  P  V              ILGKP+ED++ HY+LGKELGRGQFGVTYLCTEIST +
Sbjct  47   RAPPSPKPVSAH---------GTILGKPYEDVRVHYTLGKELGRGQFGVTYLCTEISTGQ  97

Query  490  AYACKSI  510
             YACKSI
Sbjct  98   QYACKSI  104


 Score = 43.9 bits (102),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  107  KKLVTKADKDDMRREIQIMQHLSGQ  131



>gb|KHG26977.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=524

 Score = 83.6 bits (205),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 72/131 (55%), Gaps = 24/131 (18%)
 Frame = +1

Query  121  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MGGC +K+K S     NGY+ G    T       + ++   TH      PE+P    P  
Sbjct  1    MGGCLTKTKGSNPQHNNGYKSGATTTT-------AAEQPQVTHI-----PEKPGTQAP--  46

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
            + PV VP               P+ + ILGKP+EDI+ HY++GKELG+GQFGVTYLC E 
Sbjct  47   WKPV-VPT--------PSAKPAPKSDTILGKPYEDIRMHYTIGKELGKGQFGVTYLCIEN  97

Query  478  STRRAYACKSI  510
            ST + YACK+I
Sbjct  98   STGKQYACKTI  108


 Score = 47.8 bits (112),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL++KNDKED++REIQ+MQHLSGQ
Sbjct  111  RKLITKNDKEDMRREIQLMQHLSGQ  135



>ref|XP_011095398.1| PREDICTED: calcium-dependent protein kinase 33-like [Sesamum 
indicum]
Length=523

 Score = 85.5 bits (210),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            N ILGKP+ED+KAHYSLGKELGRGQFGVT+LCT+I+T + YACKSI
Sbjct  61   NTILGKPYEDVKAHYSLGKELGRGQFGVTHLCTDIATGQKYACKSI  106


 Score = 45.8 bits (107),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K+DKED++REIQIMQHLSGQ
Sbjct  109  KKLVTKSDKEDMRREIQIMQHLSGQ  133



>ref|XP_008365060.1| PREDICTED: calcium-dependent protein kinase 2 [Malus domestica]
Length=544

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 74/135 (55%), Gaps = 13/135 (10%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQ--PER---PYNP  285
            MG C SKSK  +   NGYR    V  G       HQK  S  A    Q  PER   P N 
Sbjct  1    MGKCLSKSKDSERQHNGYR---SVGGGEGGGGVHHQKPHSHEAAAVHQQRPERRGLPVNQ  57

Query  286  QPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  465
            +PQ      V AK      P         N ILGKPFED++ HY++GKELGRGQFGVTYL
Sbjct  58   EPQPAWKPTVXAKTPKPVAPRPA-----DNTILGKPFEDVRVHYTIGKELGRGQFGVTYL  112

Query  466  CTEISTRRAYACKSI  510
            CTEIST + YACKSI
Sbjct  113  CTEISTGKKYACKSI  127


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 52/125 (42%), Gaps = 26/125 (21%)
 Frame = +2

Query  221  AIKRHPQPMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLR  400
             + + PQP  KP    K P   +P P                       +  T  G    
Sbjct  54   PVNQEPQPAWKPTVXAKTPKPVAPRP-----------------------ADNTILGKPFE  90

Query  401  TLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDIKREIQIMQ  574
             +R    +GK  G    G +T +      G   A +    RKLV+KNDKEDIKREIQIMQ
Sbjct  91   DVRVHYTIGKELGRGQFG-VTYLCTEISTGKKYACKSISKRKLVTKNDKEDIKREIQIMQ  149

Query  575  HLSGQ  589
             LSGQ
Sbjct  150  DLSGQ  154



>ref|XP_004152931.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 ref|XP_004172987.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 gb|KGN56125.1| hypothetical protein Csa_3G077600 [Cucumis sativus]
Length=519

 Score = 81.3 bits (199),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            + ILGKP ED+K HY++GKELGRGQFGVTYLCTE S+ + YACKSIL
Sbjct  58   DTILGKPLEDVKLHYTIGKELGRGQFGVTYLCTENSSGKQYACKSIL  104


 Score = 48.9 bits (115),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDKEDI+REI IMQHLSGQ
Sbjct  106  RKLVTKNDKEDIRREIHIMQHLSGQ  130



>gb|ABD98804.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score = 80.5 bits (197),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 73/133 (55%), Gaps = 20/133 (15%)
 Frame = +1

Query  121  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQTPPSYNNAQ----PPP  43

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            Q+      PA    V  PV    +P P+ ILGK ++D+++ Y LGKELGRGQFGVTYLCT
Sbjct  44   QAEVRYTPPAMNPPVVPPVVAPSKPMPDTILGKQYDDVRSVYPLGKELGRGQFGVTYLCT  103

Query  472  EISTRRAYACKSI  510
            EIST R YACKSI
Sbjct  104  EISTGRQYACKSI  116


 Score = 48.9 bits (115),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK DKEDI+REIQIMQHLSGQ
Sbjct  119  RKLVSKADKEDIRREIQIMQHLSGQ  143



>ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=541

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 73/134 (54%), Gaps = 12/134 (9%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ----PVTESHQKASSTHAQTYTQPERPYNPQ  288
            MG C SKS+  +   NGYR G G    YQ    PV    + ++  H Q   +     + +
Sbjct  1    MGKCLSKSREPEPQHNGYRSGGGAGAHYQKPHEPVVHQPKASAQQHHQIPEKRGMAAHQE  60

Query  289  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  468
            PQ      VPA+               P+ ILGKP+ED+K HY+LGKELGRGQFGVTYLC
Sbjct  61   PQPAWKPSVPARHPKPVH--------RPDTILGKPYEDVKLHYTLGKELGRGQFGVTYLC  112

Query  469  TEISTRRAYACKSI  510
            TE ST   YACKSI
Sbjct  113  TENSTGMKYACKSI  126


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 52/126 (41%), Gaps = 27/126 (21%)
 Frame = +2

Query  275  PITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYW-------------------GSLL  397
            P+ H P       S Q  HQ P   G+         W                   G   
Sbjct  34   PVVHQPK-----ASAQQHHQIPEKRGMAAHQEPQPAWKPSVPARHPKPVHRPDTILGKPY  88

Query  398  RTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDIKREIQIM  571
              ++    LGK  G    G +T +      G+  A +    RKLV+KNDKEDIKREIQI+
Sbjct  89   EDVKLHYTLGKELGRGQFG-VTYLCTENSTGMKYACKSISKRKLVTKNDKEDIKREIQIL  147

Query  572  QHLSGQ  589
            QHLSGQ
Sbjct  148  QHLSGQ  153



>ref|XP_010545509.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
 ref|XP_010545510.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
Length=534

 Score = 84.3 bits (207),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 76/137 (55%), Gaps = 27/137 (20%)
 Frame = +1

Query  121  MGGCFSKS----KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYT-QPERPY--  279
            MG CFSK     K +Q   NGYR     A  ++    SHQ      AQ  + QPE+P   
Sbjct  1    MGICFSKKNHGLKPQQ---NGYRSAE--AENHR----SHQDPPPYAAQQRSAQPEKPAGA  51

Query  280  NPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  459
            N QP S + + VP+   +             + IL KP+ED++  YSLGKELGRGQFGVT
Sbjct  52   NQQPPSRSSMPVPSPKGTKH-----------STILEKPYEDVRLFYSLGKELGRGQFGVT  100

Query  460  YLCTEISTRRAYACKSI  510
            YLCTE ST + YACKSI
Sbjct  101  YLCTENSTGKQYACKSI  117


 Score = 44.7 bits (104),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K D+ED++REIQIMQHLSGQ
Sbjct  120  KKLVTKGDREDMRREIQIMQHLSGQ  144



>ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 ref|XP_004155602.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus]
Length=552

 Score = 82.8 bits (203),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 69/147 (47%), Gaps = 27/147 (18%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVAT-----GYQP--VTESHQKASSTHAQT--------  255
            MG C S        VNG+    G+AT      YQP     +  K S+   Q         
Sbjct  1    MGCCSSTQMPPSSGVNGFDSATGIATRGPYQAYQPQSTVPTPHKVSAPQTQIPSSRNQPQ  60

Query  256  -YTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKE  432
                 E P +    S   V  P    +            P  ILG+P++DIK +Y+LGKE
Sbjct  61   PPPPAEHPTSASAFSKPAVSTPRTAQNY-----------PETILGRPYDDIKKYYTLGKE  109

Query  433  LGRGQFGVTYLCTEISTRRAYACKSIL  513
            LGRGQFG+TYLCTE ST + YACKSIL
Sbjct  110  LGRGQFGITYLCTENSTGQTYACKSIL  136


 Score = 45.4 bits (106),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+SKNDK+D+KREI I+QHLSGQ
Sbjct  138  RKLISKNDKDDMKREILILQHLSGQ  162



>ref|XP_009604147.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
tomentosiformis]
Length=521

 Score = 84.0 bits (206),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+ED++ HY+LGKELGRGQFGVTYLCTEIST + YACKSI
Sbjct  61   ILGKPYEDVRVHYTLGKELGRGQFGVTYLCTEISTGQQYACKSI  104


 Score = 43.9 bits (102),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  107  KKLVTKADKDDMRREIQIMQHLSGQ  131



>gb|KDO62703.1| hypothetical protein CISIN_1g009382mg [Citrus sinensis]
Length=536

 Score = 79.7 bits (195),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            P+ ILGKP+ED+K+HY++GKELGRGQ+G+ YLC E ST R +ACKS+
Sbjct  54   PDTILGKPYEDVKSHYTMGKELGRGQYGIIYLCIENSTGRQFACKSV  100


 Score = 47.4 bits (111),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D++DIKRE+QIMQHLSGQ
Sbjct  103  RKLVSKTDRDDIKREVQIMQHLSGQ  127



>gb|KJB81727.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=536

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 76/136 (56%), Gaps = 22/136 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGC +K+K      NGYR G   AT            ++ H Q Y  P RP   QPQ Y
Sbjct  1    MGGCLTKNKDPMPQHNGYRSG---AT----------TTAAVHQQRYQDPVRPAPIQPQVY  47

Query  301  APVHVPAKpssvpqpvrpvqrpEP------NNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
               H+P KP +       V  P P      + ILGKPFEDI+ HY++GKELG+GQFGVTY
Sbjct  48   ---HIPQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQFGVTY  104

Query  463  LCTEISTRRAYACKSI  510
             CTE ST + YACK+I
Sbjct  105  HCTENSTGKQYACKTI  120


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 60/129 (47%), Gaps = 20/129 (16%)
 Frame = +2

Query  227  KRHPQPMPKPIPNLKGPITHSP------SPMLQSMSLQNPHQCPNLLGLFRDLSQITYWG  388
            +R+  P+ +P P ++  + H P      +P   ++   +P   PN+          T  G
Sbjct  31   QRYQDPV-RPAP-IQPQVYHIPQKPGTQTPWKPAVPAPSPKPTPNI---------DTILG  79

Query  389  SLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDIKREI  562
                 +R    +GK  G    G +T        G   A +    RKLV KNDKED+KREI
Sbjct  80   KPFEDIRIHYTIGKELGKGQFG-VTYHCTENSTGKQYACKTISKRKLVRKNDKEDMKREI  138

Query  563  QIMQHLSGQ  589
            QIMQHLSGQ
Sbjct  139  QIMQHLSGQ  147



>gb|EYU27336.1| hypothetical protein MIMGU_mgv1a004414mg [Erythranthe guttata]
Length=528

 Score = 82.8 bits (203),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            N ILGKP+EDIK HY+LG+ELGRGQFGVT+LCT+I+T + YACKSI
Sbjct  64   NTILGKPYEDIKIHYTLGRELGRGQFGVTHLCTDIATGQEYACKSI  109


 Score = 43.9 bits (102),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+++DKED++REIQ+MQHLSGQ
Sbjct  112  KKLVTRSDKEDMRREIQLMQHLSGQ  136



>dbj|BAA13440.1| calcium dependent protein kinase [Ipomoea batatas]
Length=514

 Score = 82.8 bits (203),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED++AHYSLGKELGRGQFGVTYLCTEI T + YACKSI
Sbjct  52   DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIRTGKQYACKSI  97


 Score = 43.9 bits (102),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++RE+QIMQHLSGQ
Sbjct  100  KKLVTKGDKDDMRREVQIMQHLSGQ  124



>ref|XP_008651864.1| PREDICTED: calcium-dependent protein kinase 2 isoform X1 [Zea 
mays]
Length=531

 Score = 78.2 bits (191),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED+++ YSLGKELGRGQFGVTYLCTEI++ R YACKSI
Sbjct  69   DTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEIASGRQYACKSI  114


 Score = 48.1 bits (113),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D+EDI+REIQIMQHLSGQ
Sbjct  117  RKLVSKADREDIRREIQIMQHLSGQ  141



>ref|NP_001105542.1| calcium-dependent protein kinase 2 [Zea mays]
 sp|P49101.1|CDPK2_MAIZE RecName: Full=Calcium-dependent protein kinase 2; Short=CDPK 
2 [Zea mays]
 gb|AAA69507.1| calcium-dependent protein kinase [Zea mays]
Length=513

 Score = 78.2 bits (191),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = +1

Query  271  RPYNPQPQSYAPVHV--PAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRG  444
            R YNP PQ  A V     A  SS   PV    +P  + ILGK +ED+++ YS GKELGRG
Sbjct  16   RVYNP-PQQAAEVRYTPSATNSSAVPPVAVPPKPTADTILGKQYEDVRSVYSFGKELGRG  74

Query  445  QFGVTYLCTEISTRRAYACKSI  510
            QFGVTYLCTEI++ R YACKSI
Sbjct  75   QFGVTYLCTEIASGRQYACKSI  96


 Score = 48.1 bits (113),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D+EDI+REIQIMQHLSGQ
Sbjct  99   RKLVSKADREDIRREIQIMQHLSGQ  123



>ref|XP_006600312.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Glycine 
max]
 gb|KHN03472.1| Calcium-dependent protein kinase 21 [Glycine soja]
Length=538

 Score = 78.6 bits (192),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            ILGKPF+DIK +YSLGKELGRGQFG+TYLCT+ ++   YACKSIL
Sbjct  78   ILGKPFDDIKKYYSLGKELGRGQFGITYLCTDNASGGTYACKSIL  122


 Score = 47.8 bits (112),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D+ED+KREIQIMQHLSGQ
Sbjct  124  RKLVSKADREDMKREIQIMQHLSGQ  148



>ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine 
max]
Length=529

 Score = 78.6 bits (192),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  376  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +I+GKPF+DIK +YS+GKELGRGQFG+TYLCTE S+   YACKSIL
Sbjct  68   SIVGKPFDDIKKYYSIGKELGRGQFGITYLCTENSSGGTYACKSIL  113


 Score = 47.8 bits (112),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D+ED+KREIQIMQHLSGQ
Sbjct  115  RKLVSKADREDMKREIQIMQHLSGQ  139



>ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
 gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
Length=532

 Score = 83.6 bits (205),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 74/138 (54%), Gaps = 30/138 (22%)
 Frame = +1

Query  127  GCFS-KSKSRQGDVNG--YRQGRGVATGYQ-----PVTESHQKASSTHAQTYTQPERPYN  282
            GCFS K K+ + D NG  YR      TGY         +S QKA +   QT + P RP  
Sbjct  2    GCFSSKEKAPRPDANGCTYRPS---TTGYSRQQQPQYHQSQQKAVAPQIQTQSPPRRP--  56

Query  283  PQPQSYAPVH-VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  459
             Q Q   P   VP                + + ILGKPFEDIK  Y+L KELGRGQFG+T
Sbjct  57   QQTQQKTPTRPVP----------------KVDTILGKPFEDIKQLYTLSKELGRGQFGIT  100

Query  460  YLCTEISTRRAYACKSIL  513
            YLCTE +T  +YACKSIL
Sbjct  101  YLCTENATGHSYACKSIL  118


 Score = 42.7 bits (99),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D +DIKRE+ IMQHLSGQ
Sbjct  120  RKLVNKKDGDDIKREVNIMQHLSGQ  144



>ref|NP_001234582.1| calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
 gb|AAK52801.1|AF363784_1 calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
Length=521

 Score = 83.6 bits (205),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGKP+ED+K HY+LGKELGRGQFGVTYLCTEI+T + YACKSI
Sbjct  59   DTILGKPYEDVKLHYTLGKELGRGQFGVTYLCTEIATGQQYACKSI  104


 Score = 42.4 bits (98),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REI+IMQHLSGQ
Sbjct  107  KKLVTKADKDDMRREIKIMQHLSGQ  131



>ref|XP_004957849.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Setaria italica]
 gb|AGG54988.1| CDPK1, partial [Setaria italica]
Length=531

 Score = 79.3 bits (194),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED++  YSLGKELGRGQFGVTYLCTEI+T R YACKSI
Sbjct  69   DTILGKQYEDVRTVYSLGKELGRGQFGVTYLCTEIATGRQYACKSI  114


 Score = 46.6 bits (109),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL SK D+EDI+REIQIMQHLSGQ
Sbjct  117  RKLTSKADREDIRREIQIMQHLSGQ  141



>ref|XP_002874812.1| calcium-dependent protein kinase 23 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51071.1| calcium-dependent protein kinase 23 [Arabidopsis lyrata subsp. 
lyrata]
Length=535

 Score = 80.5 bits (197),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  ILGKP EDI+  YSLGKELGRGQFG+TY+C EI T   YACKSIL
Sbjct  52   DPATILGKPLEDIRRFYSLGKELGRGQFGITYMCKEIGTGNNYACKSIL  100


 Score = 45.1 bits (105),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K DKE++KREIQIMQHLSGQ
Sbjct  118  RKLVNKYDKENLKREIQIMQHLSGQ  142



>ref|XP_010508871.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
 ref|XP_010508878.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
Length=541

 Score = 81.6 bits (200),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 70/133 (53%), Gaps = 14/133 (11%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQ-PERPY--NPQP  291
            MG CF+K+             R V  G   VT     + +  A+T TQ PE+P   N QP
Sbjct  1    MGNCFAKNNGLMKPQQNVHTNRSVDVG---VTNQDPPSYTPQARTTTQQPEKPGSGNSQP  57

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
                    P   ++   P    +  + N+IL   FED+K  Y+LGKELGRGQFGVTYLCT
Sbjct  58   --------PPWRTAAAAPGPSPKTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCT  109

Query  472  EISTRRAYACKSI  510
            E ST + YACKSI
Sbjct  110  ENSTGKKYACKSI  122


 Score = 43.9 bits (102),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  125  KKLVTKADKDDMRREIQIMQHLSGQ  149



>ref|XP_006346214.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Solanum 
tuberosum]
Length=521

 Score = 82.8 bits (203),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGKP+ED+K HY+LGKELGRGQFGVTYLCTEI T + YACKSI
Sbjct  59   DTILGKPYEDVKLHYTLGKELGRGQFGVTYLCTEIVTGQQYACKSI  104


 Score = 42.4 bits (98),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REI+IMQHLSGQ
Sbjct  107  KKLVTKADKDDMRREIKIMQHLSGQ  131



>ref|NP_001275371.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|AAL09044.3|AF418563_1 calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|ADK10908.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=515

 Score = 82.8 bits (203),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGKP+ED+K HY+LGKELGRGQFGVTYLCTEI T + YACKSI
Sbjct  59   DTILGKPYEDVKLHYTLGKELGRGQFGVTYLCTEIVTGQQYACKSI  104


 Score = 42.4 bits (98),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REI+IMQHLSGQ
Sbjct  107  KKLVTKADKDDMRREIKIMQHLSGQ  131



>ref|XP_004957848.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Setaria italica]
Length=559

 Score = 78.6 bits (192),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED++  YSLGKELGRGQFGVTYLCTEI+T R YACKSI
Sbjct  69   DTILGKQYEDVRTVYSLGKELGRGQFGVTYLCTEIATGRQYACKSI  114


 Score = 46.6 bits (109),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL SK D+EDI+REIQIMQHLSGQ
Sbjct  117  RKLTSKADREDIRREIQIMQHLSGQ  141



>ref|XP_006452344.1| hypothetical protein CICLE_v10007980mg [Citrus clementina]
 ref|XP_006475076.1| PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis]
 gb|ESR65584.1| hypothetical protein CICLE_v10007980mg [Citrus clementina]
Length=531

 Score = 77.0 bits (188),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+ED+K HY++GKELGRGQ+G+ YLCTE ST R +ACKS+
Sbjct  52   ILGKPYEDVKCHYTMGKELGRGQYGIIYLCTENSTGRQFACKSV  95


 Score = 47.8 bits (112),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D++DIKRE+QIMQHLSGQ
Sbjct  98   RKLVSKTDRDDIKREVQIMQHLSGQ  122



>ref|XP_007020822.1| Calmodulin-domain protein kinase 9 isoform 3 [Theobroma cacao]
 gb|EOY12347.1| Calmodulin-domain protein kinase 9 isoform 3 [Theobroma cacao]
Length=382

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 73/136 (54%), Gaps = 22/136 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGC +KSK  +   NGYR G                  + H Q Y +P RP   QPQ +
Sbjct  1    MGGCLTKSKEPKPKHNGYRSGATTTV-------------AVHQQRYQEPVRPAPVQPQFH  47

Query  301  APVHVPAK------pssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
               H+P K         V     P   P  + ILGKP+EDI+  Y++GKELG+GQFGVTY
Sbjct  48   ---HIPEKPGAQTPWKPVAPAPSPKPAPRVDTILGKPYEDIRMRYTIGKELGKGQFGVTY  104

Query  463  LCTEISTRRAYACKSI  510
            LCTE ST + YACK+I
Sbjct  105  LCTENSTGKQYACKTI  120


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    +GK  G    G +T +      G   A +    RKLV+KNDKED+
Sbjct  76   TILGKPYEDIRMRYTIGKELGKGQFG-VTYLCTENSTGKQYACKTISKRKLVTKNDKEDM  134

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHLSGQ
Sbjct  135  KREIQIMQHLSGQ  147



>ref|NP_188676.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
 sp|Q38868.1|CDPK9_ARATH RecName: Full=Calcium-dependent protein kinase 9; AltName: Full=Calmodulin-domain 
protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAB03242.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 dbj|BAB02824.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAM53285.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAP68337.1| At3g20410 [Arabidopsis thaliana]
 gb|AEE76375.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
Length=541

 Score = 80.5 bits (197),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 68/130 (52%), Gaps = 8/130 (6%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF+K+             R V  G   VT     + +  A+T  QPE+P +   Q  
Sbjct  1    MGNCFAKNHGLMKPQQNGNTTRSVEVG---VTNQDPPSYTPQARTTQQPEKPGSVNSQPP  57

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                   + ++    + P    + N+IL   FED+K  Y+LGKELGRGQFGVTYLCTE S
Sbjct  58   P-----WRAAAAAPGLSPKTTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENS  112

Query  481  TRRAYACKSI  510
            T + YACKSI
Sbjct  113  TGKKYACKSI  122


 Score = 43.9 bits (102),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  125  KKLVTKADKDDMRREIQIMQHLSGQ  149



>ref|XP_010466227.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466228.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466229.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
Length=542

 Score = 80.5 bits (197),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 19/136 (14%)
 Frame = +1

Query  121  MGGCFSKSKSR---QGDVNGYRQ-GRGVATGYQPVTESHQKASSTHAQTYTQPERPY--N  282
            MG CF+K+      Q +V+  R    GV T   P + + Q  ++T      QPE+P   N
Sbjct  1    MGNCFAKNNGLMKPQQNVHTNRSVDVGVVTNQDPPSYTPQARATTQ-----QPEKPGSGN  55

Query  283  PQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
             QP        P   ++   P    +  + N+IL   FED+K  Y+LGKELGRGQFGVTY
Sbjct  56   SQP--------PPWRTAAAAPGPSPKTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTY  107

Query  463  LCTEISTRRAYACKSI  510
            LCTE ST + YACKSI
Sbjct  108  LCTENSTGKKYACKSI  123


 Score = 43.9 bits (102),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  126  KKLVTKADKDDMRREIQIMQHLSGQ  150



>ref|XP_006297378.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
 gb|EOA30276.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
Length=540

 Score = 80.1 bits (196),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 67/130 (52%), Gaps = 9/130 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF+K+             R V  G   VT     + +  A++  QPE+P +   Q  
Sbjct  1    MGNCFAKNNGLMKPQQNGHTNRSVEVG---VTNQDPPSYTPQARSTQQPEKPGSGNSQPP  57

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                    P+  P+        + N+IL   FED+K  Y+LGKELGRGQFGVTYLCTE S
Sbjct  58   PWRTAAPAPAPSPKTT------KSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENS  111

Query  481  TRRAYACKSI  510
            T + YACKSI
Sbjct  112  TGKKYACKSI  121


 Score = 43.9 bits (102),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  124  KKLVTKADKDDMRREIQIMQHLSGQ  148



>ref|XP_004500067.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Cicer 
arietinum]
Length=548

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDV--NGYRQG-RGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG C SK K    +   NGYR G   V   ++   + +Q  +ST   T  QP++  +   
Sbjct  1    MGSCISKGKDSDSEAEQNGYRYGGNSVVNNHRNNEKVNQTRTSTQPSTSNQPQKHVSSTH  60

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
               + V VP+         +P  + E N ILGK FED+K  Y+LGKELGRGQFGVTYLCT
Sbjct  61   MKPSSVSVPS--------PKPFMKQETNTILGKGFEDVKDFYTLGKELGRGQFGVTYLCT  112

Query  472  EISTRRAYACKSI  510
            E ST+  YACKSI
Sbjct  113  ENSTKLLYACKSI  125


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 51/107 (48%), Gaps = 8/107 (7%)
 Frame = +2

Query  275  PITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG  454
            P  H  S  ++  S+  P   P     F      T  G     ++    LGK  G    G
Sbjct  52   PQKHVSSTHMKPSSVSVPSPKP-----FMKQETNTILGKGFEDVKDFYTLGKELGRGQFG  106

Query  455  *LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDIKREIQIMQHLSGQ  589
             +T +       L+ A +    +KLVSK+D+EDIKREIQIMQHLSGQ
Sbjct  107  -VTYLCTENSTKLLYACKSISKKKLVSKSDREDIKREIQIMQHLSGQ  152



>ref|XP_002883243.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59502.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score = 79.7 bits (195),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 67/130 (52%), Gaps = 8/130 (6%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF+K+             R V  G   VT     + +  A++  QPE+P +   Q  
Sbjct  1    MGNCFAKNHGLMKPQQNGHTTRSVEVG---VTNQDPPSYTPQARSTQQPEKPGSVNSQPP  57

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                   + ++      P    + N+IL   FED+K  Y+LGKELGRGQFGVTYLCTE S
Sbjct  58   P-----WRAAAAAPGPSPKTTSKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENS  112

Query  481  TRRAYACKSI  510
            T + YACKSI
Sbjct  113  TGKKYACKSI  122


 Score = 43.9 bits (102),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  125  KKLVTKADKDDMRREIQIMQHLSGQ  149



>gb|ACR34538.1| unknown [Zea mays]
Length=531

 Score = 75.1 bits (183),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED+++ YSLGKELGRGQF VTYLCTEI++ R YACKSI
Sbjct  69   DTILGKQYEDVRSVYSLGKELGRGQFRVTYLCTEIASGRQYACKSI  114


 Score = 48.1 bits (113),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D+EDI+REIQIMQHLSGQ
Sbjct  117  RKLVSKADREDIRREIQIMQHLSGQ  141



>ref|XP_010430219.1| PREDICTED: calcium-dependent protein kinase 19 [Camelina sativa]
Length=482

 Score = 84.3 bits (207),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSIL
Sbjct  11   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSIL  59


 Score = 38.9 bits (89),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+   D+ED++REIQIM +LSGQ
Sbjct  61   RKLIRTQDREDVRREIQIMHYLSGQ  85



>ref|XP_002888057.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64316.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score = 84.3 bits (207),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSIL
Sbjct  82   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSIL  130


 Score = 38.5 bits (88),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+   D+ED++REIQIM +LSGQ
Sbjct  132  RKLIRTQDREDVRREIQIMHYLSGQ  156



>ref|XP_006452345.1| hypothetical protein CICLE_v10007978mg [Citrus clementina]
 ref|XP_006475077.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
 gb|ESR65585.1| hypothetical protein CICLE_v10007978mg [Citrus clementina]
 gb|KDO62704.1| hypothetical protein CISIN_1g009561mg [Citrus sinensis]
Length=532

 Score = 72.4 bits (176),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LGK ++D++ +Y+LGK+LGRGQFGVTYLCTE ST R +ACKSI
Sbjct  54   VLGKAYDDVRLYYNLGKKLGRGQFGVTYLCTEKSTGRQFACKSI  97


 Score = 50.4 bits (119),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+KNDK+DIKREIQIMQHLSGQ
Sbjct  100  RKLVTKNDKDDIKREIQIMQHLSGQ  124



>ref|NP_001105306.1| calcium-dependent protein kinase [Zea mays]
 dbj|BAA12715.1| calcium-dependent protein kinase [Zea mays]
 gb|ACN30810.1| unknown [Zea mays]
 gb|ACN34633.1| unknown [Zea mays]
 tpg|DAA40972.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
 tpg|DAA40973.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 2 [Zea mays]
 tpg|DAA40974.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 3 [Zea mays]
 tpg|DAA40975.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 4 [Zea mays]
Length=531

 Score = 75.9 bits (185),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED+++ YSLGKELGRGQFGVTYLCTE+++ + YACKSI
Sbjct  69   DTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEVASGKQYACKSI  114


 Score = 46.6 bits (109),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL SK D+EDI+REIQIMQHLSGQ
Sbjct  117  RKLTSKADREDIRREIQIMQHLSGQ  141



>emb|CAD70165.1| calcium-dependent protein kinase [Landoltia punctata]
Length=548

 Score = 72.8 bits (177),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LGKPFED+KA Y++GK LGRGQFGVTYLCT  ST   YACKSI
Sbjct  89   VLGKPFEDVKAKYTIGKVLGRGQFGVTYLCTCNSTGAKYACKSI  132


 Score = 49.7 bits (117),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV++ND+ED+KREIQIMQHLSGQ
Sbjct  135  RKLVNRNDREDVKREIQIMQHLSGQ  159



>gb|KFK39368.1| hypothetical protein AALP_AA3G235800 [Arabis alpina]
Length=535

 Score = 77.8 bits (190),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 70/138 (51%), Gaps = 28/138 (20%)
 Frame = +1

Query  121  MGGCFSKS----KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQ-PERPYNP  285
            MG CF+K+    K +Q   N +   R V         S Q   S   Q  +Q PE+P  P
Sbjct  1    MGNCFAKNHGLMKPQQ---NVHTNNRSVEVD----NRSQQDPPSYTPQARSQTPEKPSQP  53

Query  286  QP---QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGV  456
             P    + AP   P             +  + N+IL   FED+K  Y+LGKELGRGQFGV
Sbjct  54   PPWRMAAAAPGPSP-------------KTTKSNSILENAFEDVKLFYTLGKELGRGQFGV  100

Query  457  TYLCTEISTRRAYACKSI  510
            TYLCTE ST + YACKSI
Sbjct  101  TYLCTENSTGKKYACKSI  118


 Score = 43.9 bits (102),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  121  KKLVTKADKDDMRREIQIMQHLSGQ  145



>ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
tomentosiformis]
Length=534

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 76/131 (58%), Gaps = 12/131 (9%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGCFSK  +R+G   GYR  R      + V + ++K      +   QP+    PQPQ++
Sbjct  1    MGGCFSKKYTREGAKGGYRATR------RNVNQEYKKTPQPQPERPYQPQPQPQPQPQAH  54

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                 PA+     Q          NNILGKPFEDI+ HY+LGKELGRGQFGVTY CTE S
Sbjct  55   TVTAQPAQTQDQMQGPHL------NNILGKPFEDIRKHYTLGKELGRGQFGVTYHCTENS  108

Query  481  TRRAYACKSIL  513
            T   YACKSIL
Sbjct  109  TGNPYACKSIL  119


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 49/105 (47%), Gaps = 16/105 (15%)
 Frame = +2

Query  281  THSPSPMLQSMSLQNPHQCPNLLGL-FRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG*  457
            T +  P      +Q PH   N+LG  F D+             +H T LGK  G    G 
Sbjct  55   TVTAQPAQTQDQMQGPH-LNNILGKPFEDIR------------KHYT-LGKELGRGQFGV  100

Query  458  LT-CVLRFPPVGLMLASRF*RKLVSKNDKEDIKREIQIMQHLSGQ  589
               C            S   RKLVSKND+ED+KREIQIMQHLSGQ
Sbjct  101  TYHCTENSTGNPYACKSILKRKLVSKNDREDMKREIQIMQHLSGQ  145



>ref|XP_010439398.1| PREDICTED: calcium-dependent protein kinase 15-like [Camelina 
sativa]
Length=560

 Score = 78.2 bits (191),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 77/149 (52%), Gaps = 30/149 (20%)
 Frame = +1

Query  127  GCFS-KSKSRQGD-VNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERP-YNPQPQS  297
            GCFS K ++ + D +NG           Q    +HQ  SS  ++  ++P++P ++  P +
Sbjct  2    GCFSSKHRNTESDLING---------SVQSSITTHQSQSSV-SRNVSEPQKPPFHQIPTT  51

Query  298  YAPVH-----------------VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLG  426
              P H                 V  +      P++P+   E   ILGKPFE+I+ HY+L 
Sbjct  52   TQPNHRNQQQKQQEEEAKPIVKVIEEKQVRTTPLKPIVFRETETILGKPFEEIRKHYTLD  111

Query  427  KELGRGQFGVTYLCTEISTRRAYACKSIL  513
             ELGRGQFG+TY C EIST   YACKSIL
Sbjct  112  HELGRGQFGITYSCKEISTGNVYACKSIL  140


 Score = 43.1 bits (100),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+ K D++D+KREIQIMQHLSGQ
Sbjct  142  RKLMRKQDRDDVKREIQIMQHLSGQ  166



>gb|KHG17079.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=536

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 75/136 (55%), Gaps = 22/136 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGC +K+K      NGYR G   AT            ++ H Q Y    RP   QP+ Y
Sbjct  1    MGGCLTKNKDPMPQHNGYRSG---AT----------TTAAVHQQRYQDTVRPAPIQPRVY  47

Query  301  APVHVPAKpssvpqpvrpvqrpEP------NNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
               H+P KP +       V  P P      + ILGKPFEDI+ HY++GKELG+GQFGVTY
Sbjct  48   ---HIPQKPGTQTPWKPAVPAPSPKPAPNIDTILGKPFEDIRMHYTIGKELGKGQFGVTY  104

Query  463  LCTEISTRRAYACKSI  510
             CTE ST + YACK+I
Sbjct  105  HCTENSTGKQYACKTI  120


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    +GK  G    G +T        G   A +    RKLV KNDKED+
Sbjct  76   TILGKPFEDIRMHYTIGKELGKGQFG-VTYHCTENSTGKQYACKTISKRKLVRKNDKEDM  134

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHLSGQ
Sbjct  135  KREIQIMQHLSGQ  147



>gb|KFK35914.1| hypothetical protein AALP_AA4G052700 [Arabis alpina]
Length=512

 Score = 74.3 bits (181),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + IL KP+ED+K  Y+L KELGRGQFGVTYLCTEI+T + +ACKSI
Sbjct  50   STILEKPYEDVKQFYTLSKELGRGQFGVTYLCTEITTGKRFACKSI  95


 Score = 47.0 bits (110),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K+DKED+KREIQIMQHLSGQ
Sbjct  98   KKLVTKSDKEDMKREIQIMQHLSGQ  122



>ref|XP_002891589.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67848.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score = 75.5 bits (184),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            IL KP+ED+K  Y+L KELGRGQFGVTYLCTE STR+ +ACKSI
Sbjct  61   ILEKPYEDVKLFYTLSKELGRGQFGVTYLCTEKSTRKRFACKSI  104


 Score = 45.1 bits (105),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DKED++REIQIMQHLSGQ
Sbjct  107  KKLVTKADKEDMRREIQIMQHLSGQ  131



>ref|XP_006406385.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
 gb|ESQ47838.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
Length=537

 Score = 77.0 bits (188),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 68/135 (50%), Gaps = 20/135 (15%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF+K+    G V   + G+  +       E   +   TH     Q    Y PQP+S 
Sbjct  1    MGNCFAKN---HGLVKPQQNGQTRSV------EIDHRGGGTH-----QDPPSYTPQPRSQ  46

Query  301  APVHVPAKpssvpqpvrpvqrpEP-----NNILGKPFEDIKAHYSLGKELGRGQFGVTYL  465
             P   PA      +       P P     N+IL   FED+K  Y+LGKELGRGQFGVTYL
Sbjct  47   TP-EKPASQPPPWRMAAAAPGPSPKATKSNSILENAFEDVKLFYTLGKELGRGQFGVTYL  105

Query  466  CTEISTRRAYACKSI  510
            CTE ST + YACKSI
Sbjct  106  CTENSTGKKYACKSI  120


 Score = 43.9 bits (102),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  123  KKLVTKADKDDMRREIQIMQHLSGQ  147



>sp|P28582.2|CDPK_DAUCA RecName: Full=Calcium-dependent protein kinase; Short=CDPK [Daucus 
carota]
 emb|CAA39936.1| calcium- dependent protein kinase [Daucus carota]
Length=532

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 71/133 (53%), Gaps = 22/133 (17%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGCFSK K  Q D NGYR      T Y  VT+   + SS  +Q   QP+        S 
Sbjct  1    MGGCFSK-KEYQADGNGYRSA---PTAYHTVTDQSYEKSSQRSQPQAQPQPQVQQTGPSL  56

Query  301  AP--VHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTE  474
             P  VH P                E N ILGKPFEDI+  Y+LGKELGRGQFG  Y CTE
Sbjct  57   KPRQVHRP----------------ESNTILGKPFEDIRGKYTLGKELGRGQFGCVYQCTE  100

Query  475  ISTRRAYACKSIL  513
             S+ + YACKSIL
Sbjct  101  NSSGQLYACKSIL  113


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 41/75 (55%), Gaps = 7/75 (9%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPP--VGLMLASR--F*RKLVSKNDKE  544
            T  G     +R    LGK  G    G   CV +      G + A +    RKLVSKNDKE
Sbjct  68   TILGKPFEDIRGKYTLGKELGRGQFG---CVYQCTENSSGQLYACKSILKRKLVSKNDKE  124

Query  545  DIKREIQIMQHLSGQ  589
            DIKREIQI+QHLSGQ
Sbjct  125  DIKREIQILQHLSGQ  139



>ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo]
Length=552

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 80/141 (57%), Gaps = 15/141 (11%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATG--YQPVTESHQKASST---HAQTYTQPERPYN-  282
            MG C S  K     +NG+   RGVAT   YQP    +Q  S+    H  +  Q + P N 
Sbjct  1    MGCCSSTQKPPSSGINGFDAARGVATRGPYQP----YQPQSTVPIPHKVSAPQTQIPSNR  56

Query  283  --PQPQSYAPVHVPAKpssvpqpvrpvqrpE--PNNILGKPFEDIKAHYSLGKELGRGQF  450
              PQP   A  H P+  +     V   +  +  P  ILG+P++DIK +Y+LGKELGRGQF
Sbjct  57   NQPQPPPTAE-HPPSASAFSKPAVSTPRTAQNYPETILGRPYDDIKKYYTLGKELGRGQF  115

Query  451  GVTYLCTEISTRRAYACKSIL  513
            G+TYLCTE ST + YACKSIL
Sbjct  116  GITYLCTENSTGQTYACKSIL  136



>ref|XP_007142270.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
 gb|ESW14264.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
Length=525

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 67/130 (52%), Gaps = 21/130 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGC SK+ S   + NGYR   G A  ++       +    HA     P+  + P   S 
Sbjct  1    MGGCLSKNGSESEEHNGYRHVVGGAHNHKSHEPFVNQLPEKHA-----PQAAWRPTVHSP  55

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
            +P HV                   + I GKP ED+K HY+LGKELGRGQFGVTYLCTE S
Sbjct  56   SPKHV----------------HRADTITGKPLEDVKQHYTLGKELGRGQFGVTYLCTENS  99

Query  481  TRRAYACKSI  510
            T   YACKSI
Sbjct  100  TGLQYACKSI  109


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 51/107 (48%), Gaps = 22/107 (21%)
 Frame = +2

Query  275  PITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG  454
            P  HSPSP       ++ H+              T  G  L  ++    LGK  G    G
Sbjct  50   PTVHSPSP-------KHVHRAD------------TITGKPLEDVKQHYTLGKELGRGQFG  90

Query  455  *LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDIKREIQIMQHLSGQ  589
             +T +      GL  A +    RKLV ++DKED+KREIQIMQHLSGQ
Sbjct  91   -VTYLCTENSTGLQYACKSISKRKLVRRDDKEDMKREIQIMQHLSGQ  136



>ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 emb|CEH19767.1| Calcium-dependent protein kinase [Populus tremula x Populus tremuloides]
Length=532

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 70/131 (53%), Gaps = 13/131 (10%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C SK  +   DVNGYR   G ATGY P   + Q+    H      P +     PQ  
Sbjct  1    MGCCGSKGNAPTPDVNGYR---GPATGY-PRQTNQQQQPQYH------PSQQKVTVPQIQ  50

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                      +  Q         P+ ILGKPFEDIK HY+LGKELGRGQFGVTYLCTE S
Sbjct  51   TQTPPTRPQQTQQQTPTRPA---PDTILGKPFEDIKQHYTLGKELGRGQFGVTYLCTENS  107

Query  481  TRRAYACKSIL  513
            T   YACKSIL
Sbjct  108  TSHTYACKSIL  118



>ref|XP_004231610.1| PREDICTED: calcium-dependent protein kinase 2-like [Solanum lycopersicum]
Length=527

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 69/131 (53%), Gaps = 19/131 (15%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGCFSK        N Y +G G  T  +P             Q Y  P   Y+P+P + 
Sbjct  1    MGGCFSK--------NRYLEGDGKGTSNRPGRRRRGNTGVASYQHYKHPVY-YHPRPTA-  50

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                              V+  +P  ILGKP+E+I+AHY+LG+ELGRGQ+GV Y CTE S
Sbjct  51   ---------QQRHAHQVTVKSSQPGTILGKPYENIRAHYTLGRELGRGQYGVIYFCTENS  101

Query  481  TRRAYACKSIL  513
            TRR YACKSIL
Sbjct  102  TRRNYACKSIL  112



>ref|NP_175485.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
 sp|Q9C6P3.1|CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33 [Arabidopsis 
thaliana]
 gb|AAG51192.1|AC079279_13 calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAT06478.1| At1g50700 [Arabidopsis thaliana]
 dbj|BAD43386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32581.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
Length=521

 Score = 72.4 bits (176),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            IL KP+ED+K  Y+L KELGRGQFGVTYLCTE ST + +ACKSI
Sbjct  61   ILEKPYEDVKLFYTLSKELGRGQFGVTYLCTEKSTGKRFACKSI  104


 Score = 45.8 bits (107),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DKED++REIQIMQHLSGQ
Sbjct  107  KKLVTKGDKEDMRREIQIMQHLSGQ  131



>ref|XP_006828852.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
 gb|ERM96268.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
Length=532

 Score = 75.9 bits (185),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 71/145 (49%), Gaps = 35/145 (24%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKAS--------STHAQTYTQPERP  276
            MG CFSK K  +   +  R+   V+ G  PV    +K          STH QT  +P  P
Sbjct  1    MGDCFSKPKFPE---SPPRRTLPVSNGSSPVPSLPKKEQPTRPANRPSTHQQT-RKPATP  56

Query  277  YNP----QP---QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKEL  435
             NP    QP    S    HV A+                N ILGKP  D+ + Y+L +EL
Sbjct  57   SNPSANRQPLPLTSALKSHVSAE----------------NTILGKPMVDVSSLYALDREL  100

Query  436  GRGQFGVTYLCTEISTRRAYACKSI  510
            GRGQFGVTYLCTE +T   YACKS+
Sbjct  101  GRGQFGVTYLCTERTTGLQYACKSV  125


 Score = 41.2 bits (95),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+SK+D EDIKRE+ I+QHL+GQ
Sbjct  128  RKLMSKSDVEDIKREVLILQHLTGQ  152



>ref|XP_010461925.1| PREDICTED: calcium-dependent protein kinase 33 [Camelina sativa]
Length=521

 Score = 72.0 bits (175),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  376  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +IL KP+ED+K  Y+L KELGRGQFGVTYLCTE ST + +ACKSI
Sbjct  60   SILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFACKSI  104


 Score = 45.1 bits (105),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DKED++REIQIMQHLSGQ
Sbjct  107  KKLVTKADKEDMRREIQIMQHLSGQ  131



>ref|XP_010479536.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=521

 Score = 72.0 bits (175),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  376  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +IL KP+ED+K  Y+L KELGRGQFGVTYLCTE ST + +ACKSI
Sbjct  60   SILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFACKSI  104


 Score = 45.1 bits (105),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DKED++REIQIMQHLSGQ
Sbjct  107  KKLVTKADKEDMRREIQIMQHLSGQ  131



>ref|XP_010501945.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=582

 Score = 71.6 bits (174),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  376  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +IL KP+ED+K  Y+L KELGRGQFGVTYLCTE ST + +ACKSI
Sbjct  60   SILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFACKSI  104


 Score = 45.1 bits (105),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DKED++REIQIMQHLSGQ
Sbjct  107  KKLVTKADKEDMRREIQIMQHLSGQ  131



>gb|AGG35978.1| calcium-dependent protein kinase 9, partial [Brassica napus]
Length=539

 Score = 73.2 bits (178),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 69/135 (51%), Gaps = 23/135 (17%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF+K+                  G     ++ Q  S    QT+  P   Y PQP+S+
Sbjct  1    MGNCFAKNH-----------------GLMKPQQNGQTRSVEVDQTHQDPP-SYTPQPRSH  42

Query  301  APVHVPAKpss-----vpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  465
             P    ++ +      +  P    +  + ++IL   +ED+K  Y+LGKELGRGQFGVTYL
Sbjct  43   TPEKRSSETNQPPPWRMAAPAPSPKAAKSSSILENAYEDVKLFYTLGKELGRGQFGVTYL  102

Query  466  CTEISTRRAYACKSI  510
            CTE ST + YACKSI
Sbjct  103  CTENSTGKKYACKSI  117


 Score = 43.9 bits (102),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  120  KKLVTKADKDDMRREIQIMQHLSGQ  144



>ref|XP_007026067.1| Calcium-dependent protein kinase 21 isoform 2 [Theobroma cacao]
 gb|EOY28689.1| Calcium-dependent protein kinase 21 isoform 2 [Theobroma cacao]
Length=486

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C SK K  + D   YR G   +   QP   S  +   T   +  Q + P   QPQ  
Sbjct  1    MGCCGSKHKLSEPDYKDYRSGMPPSRPVQPA--SQPQPVQTQKMSVPQIQAPQMRQPQ--  56

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P+  P KPS         Q      ILGKP EDIK +Y+LGKELGRGQFG+TYLCTE S
Sbjct  57   -PIPAPLKPSPASSRPVQGQ----ETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENS  111

Query  481  TRRAYACKSIL  513
            T   YACKSIL
Sbjct  112  TGNTYACKSIL  122


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 54/122 (44%), Gaps = 28/122 (23%)
 Frame = +2

Query  230  RHPQPMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLR  409
            R PQP+P P+          PSP     +   P Q            Q T  G  L  ++
Sbjct  53   RQPQPIPAPL---------KPSP-----ASSRPVQ-----------GQETILGKPLEDIK  87

Query  410  HTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLS  583
                LGK  G    G +T +      G   A +    RKL +K D+EDIK+E+QIMQHLS
Sbjct  88   QYYTLGKELGRGQFG-ITYLCTENSTGNTYACKSILKRKLKNKQDREDIKKEVQIMQHLS  146

Query  584  GQ  589
            GQ
Sbjct  147  GQ  148



>ref|XP_007026068.1| Calcium-dependent protein kinase 21 isoform 3 [Theobroma cacao]
 gb|EOY28690.1| Calcium-dependent protein kinase 21 isoform 3 [Theobroma cacao]
Length=481

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C SK K  + D   YR G   +   QP   S  +   T   +  Q + P   QPQ  
Sbjct  1    MGCCGSKHKLSEPDYKDYRSGMPPSRPVQPA--SQPQPVQTQKMSVPQIQAPQMRQPQ--  56

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P+  P KPS         Q      ILGKP EDIK +Y+LGKELGRGQFG+TYLCTE S
Sbjct  57   -PIPAPLKPSPASSRPVQGQ----ETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENS  111

Query  481  TRRAYACKSIL  513
            T   YACKSIL
Sbjct  112  TGNTYACKSIL  122


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 54/122 (44%), Gaps = 28/122 (23%)
 Frame = +2

Query  230  RHPQPMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLR  409
            R PQP+P P+          PSP     +   P Q            Q T  G  L  ++
Sbjct  53   RQPQPIPAPL---------KPSP-----ASSRPVQ-----------GQETILGKPLEDIK  87

Query  410  HTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLS  583
                LGK  G    G +T +      G   A +    RKL +K D+EDIK+E+QIMQHLS
Sbjct  88   QYYTLGKELGRGQFG-ITYLCTENSTGNTYACKSILKRKLKNKQDREDIKKEVQIMQHLS  146

Query  584  GQ  589
            GQ
Sbjct  147  GQ  148



>ref|XP_009135689.1| PREDICTED: calcium-dependent protein kinase 9 [Brassica rapa]
Length=542

 Score = 72.4 bits (176),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 72/135 (53%), Gaps = 21/135 (16%)
 Frame = +1

Query  121  MGGCFSKS----KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQ-PERPYNP  285
            MG CF+K+    K +Q   NG  Q R V      V ++HQ   S   Q  +Q PE+P + 
Sbjct  1    MGNCFAKNHGLMKPQQ---NG--QTRSV-----EVDQTHQDPPSYTPQPRSQTPEKPSSE  50

Query  286  QPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  465
              Q       P    + P P     +    +IL   +ED+K  Y+LGKELGRGQFGVTYL
Sbjct  51   TNQP------PPWRMAAPAPSPKAAKSSSTSILENAYEDVKLFYTLGKELGRGQFGVTYL  104

Query  466  CTEISTRRAYACKSI  510
            CTE ST + YACKSI
Sbjct  105  CTENSTGKKYACKSI  119


 Score = 43.9 bits (102),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  122  KKLVTKADKDDMRREIQIMQHLSGQ  146



>gb|AAD17800.1| Ca2+-dependent protein kinase [Mesembryanthemum crystallinum]
Length=534

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 76/130 (58%), Gaps = 13/130 (10%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C SK+K+ Q + NGY    GV +  Q      +  +  +       +    PQP S+
Sbjct  1    MGICASKNKATQPEDNGYTPANGVGSNNQ-----SKPPAQQNYHQQPPQQPVAPPQPASH  55

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             PV +P+         +P  + EPN ILGKPFED+K +Y+LG+ELGRGQFGVTYLCT+  
Sbjct  56   PPVRMPS--------PKPAPKVEPNTILGKPFEDVKVYYTLGRELGRGQFGVTYLCTDKK  107

Query  481  TRRAYACKSI  510
            T + YACKSI
Sbjct  108  TGQQYACKSI  117



>ref|XP_007026066.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
 gb|EOY28688.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
Length=538

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C SK K  + D   YR G   +   QP   S  +   T   +  Q + P   QPQ  
Sbjct  1    MGCCGSKHKLSEPDYKDYRSGMPPSRPVQPA--SQPQPVQTQKMSVPQIQAPQMRQPQ--  56

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P+  P KPS         Q      ILGKP EDIK +Y+LGKELGRGQFG+TYLCTE S
Sbjct  57   -PIPAPLKPSPASSRPVQGQ----ETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENS  111

Query  481  TRRAYACKSIL  513
            T   YACKSIL
Sbjct  112  TGNTYACKSIL  122


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 54/122 (44%), Gaps = 28/122 (23%)
 Frame = +2

Query  230  RHPQPMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLR  409
            R PQP+P P+          PSP     +   P Q            Q T  G  L  ++
Sbjct  53   RQPQPIPAPL---------KPSP-----ASSRPVQ-----------GQETILGKPLEDIK  87

Query  410  HTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLS  583
                LGK  G    G +T +      G   A +    RKL +K D+EDIK+E+QIMQHLS
Sbjct  88   QYYTLGKELGRGQFG-ITYLCTENSTGNTYACKSILKRKLKNKQDREDIKKEVQIMQHLS  146

Query  584  GQ  589
            GQ
Sbjct  147  GQ  148



>ref|XP_003610425.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92622.1| calcium-dependent kinase [Medicago truncatula]
Length=543

 Score = 68.2 bits (165),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            IL KP+EDIK  Y+ GKEL RG+FG+TY CTE ST + YAC+SIL
Sbjct  83   ILEKPYEDIKKLYTFGKELSRGKFGITYFCTENSTGQNYACRSIL  127


 Score = 47.8 bits (112),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK DKEDIKREIQI+QH SGQ
Sbjct  129  RKLVSKADKEDIKREIQILQHFSGQ  153



>ref|XP_007153943.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
 gb|ESW25937.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
Length=546

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = +1

Query  223  HQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFED  402
             Q +++T AQ  T P  P  PQP S A V  P KP   P       +     ILGKPFED
Sbjct  30   QQPSTTTVAQVQTSP--PPKPQPHSEA-VASPPKPKLSPTQNARAVQKPDATILGKPFED  86

Query  403  IKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            IK +YSLGKELGRGQFG+TYLCTE +T   YACKSIL
Sbjct  87   IKKYYSLGKELGRGQFGITYLCTENATGMTYACKSIL  123


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 54/118 (46%), Gaps = 14/118 (12%)
 Frame = +2

Query  242  PMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTV  421
            P PKP P+ +  +   P P L         Q P+           T  G     ++    
Sbjct  44   PPPKPQPHSEA-VASPPKPKLSPTQNARAVQKPD----------ATILGKPFEDIKKYYS  92

Query  422  LGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            LGK  G    G +T +      G+  A +    RKLVS+ D+ED+KREIQIMQHLSGQ
Sbjct  93   LGKELGRGQFG-ITYLCTENATGMTYACKSILKRKLVSRADREDMKREIQIMQHLSGQ  149



>ref|XP_006303970.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
 gb|EOA36868.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
Length=520

 Score = 70.9 bits (172),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  376  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +IL KP+ED+K  Y+L +ELGRGQFGVTYLCTE ST + +ACKSI
Sbjct  59   SILEKPYEDVKLLYTLSRELGRGQFGVTYLCTEKSTGKRFACKSI  103


 Score = 45.1 bits (105),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DKED++REIQIMQHLSGQ
Sbjct  106  KKLVTKADKEDMRREIQIMQHLSGQ  130



>ref|XP_011034967.1| PREDICTED: calcium-dependent protein kinase 29 [Populus euphratica]
Length=539

 Score = 76.3 bits (186),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 64/135 (47%), Gaps = 19/135 (14%)
 Frame = +1

Query  121  MGGCFSK---SKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG CFS+   SK R  D+  +        GYQP      K     AQ +      YNP P
Sbjct  1    MGICFSRLGFSKFRSHDI--HISSTSEEDGYQP------KPPKRRAQEH------YNPPP  46

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNN--ILGKPFEDIKAHYSLGKELGRGQFGVTYL  465
               A    P   +              N   ILGKPF DI   Y L +ELGRGQFG+TYL
Sbjct  47   SQAATKPAPPSETFGKSQTALTPSSTSNIGPILGKPFVDITKIYDLHRELGRGQFGITYL  106

Query  466  CTEISTRRAYACKSI  510
            CTE +T+R YACKSI
Sbjct  107  CTEKATQRKYACKSI  121


 Score = 39.3 bits (90),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  518  KLVSKNDKEDIKREIQIMQHLSGQ  589
            KLV+K D ED+K+EI IMQHLSGQ
Sbjct  125  KLVTKKDIEDVKKEILIMQHLSGQ  148



>ref|XP_006287505.1| hypothetical protein CARUB_v10000714mg [Capsella rubella]
 gb|EOA20403.1| hypothetical protein CARUB_v10000714mg [Capsella rubella]
Length=524

 Score = 77.8 bits (190),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +1

Query  247  AQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLG  426
            AQT+   + P   +PQ+  P   P           P+     + ILGKPFEDI+  YSLG
Sbjct  25   AQTHVVNQVPEQSKPQT--PTRKPTNQQIPTPSANPISARGLDTILGKPFEDIRKVYSLG  82

Query  427  KELGRGQFGVTYLCTEISTRRAYACKSIL  513
            KELG+G F  TY+CTEIST   YACKSIL
Sbjct  83   KELGQGYFATTYMCTEISTGNTYACKSIL  111


 Score = 37.7 bits (86),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  521  LVSKNDKEDIKREIQIMQHLSGQ  589
            L+S+  +ED+KREIQIMQHLSGQ
Sbjct  115  LISQIYEEDVKREIQIMQHLSGQ  137



>emb|CDX82244.1| BnaA03g35770D [Brassica napus]
Length=534

 Score = 71.6 bits (174),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 69/134 (51%), Gaps = 27/134 (20%)
 Frame = +1

Query  121  MGGCFSKS----KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ  288
            MG CF+K+    K +Q   NG  Q R V      V ++HQ            P+ P  P 
Sbjct  1    MGNCFAKNHGLMKPQQ---NG--QTRSV-----EVDQTHQDP----------PQTPEKPS  40

Query  289  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  468
             ++  P   P    + P P     +    +IL   +ED+K  Y+LGKELGRGQFGVTYLC
Sbjct  41   SETNQP---PPWRMAAPAPSPKAAKSSSTSILENAYEDVKLFYTLGKELGRGQFGVTYLC  97

Query  469  TEISTRRAYACKSI  510
            TE ST + YACKSI
Sbjct  98   TENSTGKKYACKSI  111


 Score = 43.9 bits (102),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  114  KKLVTKADKDDMRREIQIMQHLSGQ  138



>emb|CDY36037.1| BnaC03g41610D [Brassica napus]
Length=531

 Score = 70.9 bits (172),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            IL   +ED+K  Y+LGKELGRGQFGVTYLCTE ST + YACKSI
Sbjct  66   ILENAYEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSI  109


 Score = 43.5 bits (101),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +KLV+K DK+D++REIQIMQHLSGQ
Sbjct  112  KKLVTKADKDDMRREIQIMQHLSGQ  136



>gb|AAK92828.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
Length=531

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 56/91 (62%), Gaps = 5/91 (5%)
 Frame = +1

Query  247  AQTYTQPE--RPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYS  420
             QT+  PE  +P  P P+   P+  P           PV   +P+ ILGKPFEDI+  YS
Sbjct  25   VQTHVVPEHRKPQTPTPK---PMTQPIHQQISTPSSNPVSVRDPDTILGKPFEDIRKFYS  81

Query  421  LGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            LGKELGRGQFG+TY+C EI T   YACKSIL
Sbjct  82   LGKELGRGQFGITYMCKEIGTGNTYACKSIL  112


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 6/113 (5%)
 Frame = +2

Query  257  IPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNW  436
            +P  + P T +P PM Q +  Q      N + + RD   I   G     +R    LGK  
Sbjct  30   VPEHRKPQTPTPKPMTQPIHQQISTPSSNPVSV-RDPDTI--LGKPFEDIRKFYSLGKEL  86

Query  437  GGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            G    G +T + +    G   A +    RKL+SK DKED+KREIQIMQ+LSGQ
Sbjct  87   GRGQFG-ITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQ  138



>ref|NP_192381.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
 sp|Q9ZSA2.1|CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21 [Arabidopsis 
thaliana]
 gb|AAD03453.1| contains similarity to eukaryotic protein kinase domains (Pfam: 
PF00069, score=312.6, E=4.7e-90, N=1) and EF hand domains 
(Pfam: PF00036, score=131, E=2.1e-35, N=4) [Arabidopsis thaliana]
 emb|CAB80837.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
 gb|AAN13018.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE82416.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
Length=531

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 56/91 (62%), Gaps = 5/91 (5%)
 Frame = +1

Query  247  AQTYTQPE--RPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYS  420
             QT+  PE  +P  P P+   P+  P           PV   +P+ ILGKPFEDI+  YS
Sbjct  25   VQTHVVPEHRKPQTPTPK---PMTQPIHQQISTPSSNPVSVRDPDTILGKPFEDIRKFYS  81

Query  421  LGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            LGKELGRGQFG+TY+C EI T   YACKSIL
Sbjct  82   LGKELGRGQFGITYMCKEIGTGNTYACKSIL  112


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 6/113 (5%)
 Frame = +2

Query  257  IPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNW  436
            +P  + P T +P PM Q +  Q      N + + RD   I   G     +R    LGK  
Sbjct  30   VPEHRKPQTPTPKPMTQPIHQQISTPSSNPVSV-RDPDTI--LGKPFEDIRKFYSLGKEL  86

Query  437  GGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            G    G +T + +    G   A +    RKL+SK DKED+KREIQIMQ+LSGQ
Sbjct  87   GRGQFG-ITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQ  138



>ref|XP_006855881.1| hypothetical protein AMTR_s00037p00138680 [Amborella trichopoda]
 gb|ERN17348.1| hypothetical protein AMTR_s00037p00138680 [Amborella trichopoda]
Length=390

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 67/132 (51%), Gaps = 12/132 (9%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CFSK        N   +  G   GYQP +    +         T+ ERP    P S 
Sbjct  1    MGDCFSKK-------NSESEADGAGGGYQPASRQQNQQKEQQQPHNTRSERPGQQLPPSS  53

Query  301  APVHVPAKpssvpqpvrpvqrpEP--NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTE  474
             P   P    +           EP  + ILGKPF ++K+ Y+LGKELGRGQFGVTYLCTE
Sbjct  54   QPKASPLPHPASSYEQPKP---EPGVDTILGKPFLNVKSFYTLGKELGRGQFGVTYLCTE  110

Query  475  ISTRRAYACKSI  510
             ST  +YACKSI
Sbjct  111  NSTGLSYACKSI  122



>ref|XP_010093289.1| Calcium-dependent protein kinase 15 [Morus notabilis]
 gb|EXB53814.1| Calcium-dependent protein kinase 15 [Morus notabilis]
Length=539

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 72/140 (51%), Gaps = 25/140 (18%)
 Frame = +1

Query  121  MGGCFSKSKS-----RQGDVNGYRQGRGVATGYQ----PVTESHQKASSTHAQTYTQPER  273
            MG C SK+K+     R  + N +      +T  Q    P+    QK  +T       PE 
Sbjct  1    MGCCGSKTKTITSTARPNNDNVHGSSTITSTSQQAHQEPIIHP-QKVQTTFPPPKHTPEP  59

Query  274  PYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFG  453
              +P+PQ   P   P                 P+ ILG+PFEDIK HY+LGKELGRGQFG
Sbjct  60   ERHPKPQPVLPQTNPVP---------------PDAILGRPFEDIKQHYTLGKELGRGQFG  104

Query  454  VTYLCTEISTRRAYACKSIL  513
            +TYLCTE ST   +ACKSIL
Sbjct  105  ITYLCTENSTGETFACKSIL  124



>emb|CDP05759.1| unnamed protein product [Coffea canephora]
Length=520

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            P+ ILGKP+EDIK HY+LGKELGRGQFGVTYLCT+I T R YACKSI
Sbjct  58   PDTILGKPYEDIKLHYTLGKELGRGQFGVTYLCTDIETGRQYACKSI  104



>gb|KCW75309.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=536

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 70/135 (52%), Gaps = 9/135 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQ----GRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ  288
            MG   SK KS Q   NGY      G+  A       ++H+ ++        Q +   NP 
Sbjct  1    MGCRGSKEKSPQSGANGYSSTTVSGQNQAYQQGAAVQTHKVSAQMPQPRPQQQQPASNP-  59

Query  289  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  468
                APV               V +   N ILGKPFE+IK HY+LGKELGRGQFG+TYLC
Sbjct  60   ----APVSSEVAQKRPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLC  115

Query  469  TEISTRRAYACKSIL  513
            TE ST + YACKSIL
Sbjct  116  TEKSTGQTYACKSIL  130


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +2

Query  287  SPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG*LTC  466
            +P+P+   ++ + P   P   G+ + +   T  G     ++    LGK  G    G +T 
Sbjct  58   NPAPVSSEVAQKRP--APVSSGVAQKMDN-TILGKPFEEIKQHYTLGKELGRGQFG-ITY  113

Query  467  VLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +      G   A +    RKL+SK D++D+KREIQIMQHLSGQ
Sbjct  114  LCTEKSTGQTYACKSILKRKLLSKGDRDDMKREIQIMQHLSGQ  156



>ref|XP_010057925.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW75311.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=546

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 70/135 (52%), Gaps = 9/135 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQ----GRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ  288
            MG   SK KS Q   NGY      G+  A       ++H+ ++        Q +   NP 
Sbjct  1    MGCRGSKEKSPQSGANGYSSTTVSGQNQAYQQGAAVQTHKVSAQMPQPRPQQQQPASNP-  59

Query  289  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  468
                APV               V +   N ILGKPFE+IK HY+LGKELGRGQFG+TYLC
Sbjct  60   ----APVSSEVAQKRPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLC  115

Query  469  TEISTRRAYACKSIL  513
            TE ST + YACKSIL
Sbjct  116  TEKSTGQTYACKSIL  130


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +2

Query  287  SPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG*LTC  466
            +P+P+   ++ + P   P   G+ + +   T  G     ++    LGK  G    G +T 
Sbjct  58   NPAPVSSEVAQKRP--APVSSGVAQKMDN-TILGKPFEEIKQHYTLGKELGRGQFG-ITY  113

Query  467  VLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +      G   A +    RKL+SK D++D+KREIQIMQHLSGQ
Sbjct  114  LCTEKSTGQTYACKSILKRKLLSKGDRDDMKREIQIMQHLSGQ  156



>gb|KCW75310.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=543

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 70/135 (52%), Gaps = 9/135 (7%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQ----GRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ  288
            MG   SK KS Q   NGY      G+  A       ++H+ ++        Q +   NP 
Sbjct  1    MGCRGSKEKSPQSGANGYSSTTVSGQNQAYQQGAAVQTHKVSAQMPQPRPQQQQPASNP-  59

Query  289  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  468
                APV               V +   N ILGKPFE+IK HY+LGKELGRGQFG+TYLC
Sbjct  60   ----APVSSEVAQKRPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLC  115

Query  469  TEISTRRAYACKSIL  513
            TE ST + YACKSIL
Sbjct  116  TEKSTGQTYACKSIL  130


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +2

Query  287  SPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG*LTC  466
            +P+P+   ++ + P   P   G+ + +   T  G     ++    LGK  G    G +T 
Sbjct  58   NPAPVSSEVAQKRP--APVSSGVAQKMDN-TILGKPFEEIKQHYTLGKELGRGQFG-ITY  113

Query  467  VLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +      G   A +    RKL+SK D++D+KREIQIMQHLSGQ
Sbjct  114  LCTEKSTGQTYACKSILKRKLLSKGDRDDMKREIQIMQHLSGQ  156



>gb|AFY10519.1| calcium dependent protein kinase 1 [Dendrobium catenatum]
Length=525

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 67/114 (59%), Gaps = 15/114 (13%)
 Frame = +1

Query  181  GRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvq  360
            G+G  TG +    SHQ  ++       QP +P  P P+++      A PS          
Sbjct  6    GKGKRTGLEANGHSHQPPATV------QPVKPSRPSPETHY-----APPSPAKPNPPIAS  54

Query  361  rpEP----NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
             P+P    N ILGKPFED+++HYSLGKELGRGQFGVTY C EI+T  +YACKSI
Sbjct  55   PPKPAPTNNTILGKPFEDVRSHYSLGKELGRGQFGVTYFCKEIATGHSYACKSI  108


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T   +    G   A +    RKLV KNDKEDI
Sbjct  64   TILGKPFEDVRSHYSLGKELGRGQFG-VTYFCKEIATGHSYACKSISKRKLVHKNDKEDI  122

Query  551  KREIQIMQHLSGQ  589
            KRE+QI+QHL+GQ
Sbjct  123  KREMQILQHLTGQ  135



>ref|XP_009783685.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=522

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 68/130 (52%), Gaps = 25/130 (19%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C SK+K  +   NG+                ++    +     TQ +   +P P+S 
Sbjct  1    MGICLSKTKPAESKSNGH----------------NRSGGGSGGHHQTQIQYTKSPGPESQ  44

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P+   A          P    +   ILGKPFED+KAHY+LGKELGRGQFGVT+LCTEI+
Sbjct  45   LPMRPSA---------SPKPVFKQETILGKPFEDVKAHYTLGKELGRGQFGVTFLCTEIA  95

Query  481  TRRAYACKSI  510
            T   YACKSI
Sbjct  96   TGHQYACKSI  105



>gb|KFK30983.1| hypothetical protein AALP_AA6G053500 [Arabis alpina]
Length=538

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P+ ILGKPFE+IK  YSLGKELGRGQFG+TYLCTEIST   YACKSIL
Sbjct  71   DPDTILGKPFEEIKKLYSLGKELGRGQFGITYLCTEISTGNTYACKSIL  119



>ref|XP_010266343.1| PREDICTED: uncharacterized protein LOC104603873 [Nelumbo nucifera]
Length=1074

 Score = 74.3 bits (181),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 41/94 (44%), Positives = 53/94 (56%), Gaps = 13/94 (14%)
 Frame = +1

Query  229  KASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIK  408
            K S T  Q  T+P++  +P   +Y P  +P          +     +   ILGKP  D+ 
Sbjct  9    KTSFTKEQQSTKPQQQLSP---TYLPTSLP----------KATSSSQNGTILGKPICDLT  55

Query  409  AHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + Y L KELGRGQFG+TYLCTE +T R YACKSI
Sbjct  56   SIYDLDKELGRGQFGITYLCTEKATGRKYACKSI  89


 Score = 38.1 bits (87),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++REI ++QHL+GQ
Sbjct  92   RKLVNKKDIEDVQREIMLLQHLTGQ  116


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 51/99 (52%), Gaps = 0/99 (0%)
 Frame = +1

Query  214  TESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKP  393
            T+++Q   ++     TQ       + QS  P       S      +     +   ILGKP
Sbjct  559  TKTNQIPITSSPDRPTQQPSKKTKEQQSKKPHQQSDAASLPTSLSKATSSSQIGTILGKP  618

Query  394  FEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
              D+ + Y L KELGRGQFG+TYLCTE +T R YACKSI
Sbjct  619  ICDLTSIYDLDKELGRGQFGITYLCTEKATGRKYACKSI  657



>ref|XP_006391947.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
 gb|ESQ29233.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
Length=553

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TYLCTEIS+ ++YACKSIL
Sbjct  84   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYLCTEISSGKSYACKSIL  132



>ref|XP_004293286.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 61/100 (61%), Gaps = 18/100 (18%)
 Frame = +1

Query  214  TESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKP  393
            T+  QK S+   +   +PE  + P+PQ   P  VP                 P++IL KP
Sbjct  47   TQQPQKVSAPPTRPKPEPEPQFQPKPQRPKPA-VP-----------------PDSILEKP  88

Query  394  FEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            FEDIK +Y+LGKELGRGQFG+TYLCTE ST  +YACKSIL
Sbjct  89   FEDIKRYYTLGKELGRGQFGITYLCTENSTGDSYACKSIL  128



>ref|XP_010453282.1| PREDICTED: calcium-dependent protein kinase 17 [Camelina sativa]
Length=530

 Score = 71.2 bits (173),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ YSLGKELGRGQFGVT+LCT+ +T + +ACK+I
Sbjct  63   VLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTI  106


 Score = 40.8 bits (94),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  109  RKLVNKEDIEDVRREVQIMHHLTGQ  133



>ref|XP_008806408.1| PREDICTED: calcium-dependent protein kinase 2 [Phoenix dactylifera]
Length=548

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 76/141 (54%), Gaps = 21/141 (15%)
 Frame = +1

Query  121  MGGCFSKSKS---RQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG C SK K    R G  NGY       + +Q   +  Q  SS H   Y QP+ P     
Sbjct  1    MGHCCSKEKDSGRRGGGANGY-------SSHQQQLKPSQPPSSYHG--YNQPQPPPTTTE  51

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpE--------PNNILGKPFEDIKAHYSLGKELGRGQ  447
               AP   P K S+      PV  P         P+ ILGKPFED+++ Y+LGKELGRGQ
Sbjct  52   ARQAPPS-PLKSSAPTPAPVPVPVPSPAITAPRGPDTILGKPFEDVRSFYTLGKELGRGQ  110

Query  448  FGVTYLCTEISTRRAYACKSI  510
            FGVTYLCTEI+T + YACKSI
Sbjct  111  FGVTYLCTEIATGKRYACKSI  131



>ref|XP_010419805.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Camelina sativa]
 ref|XP_010491975.1| PREDICTED: calcium-dependent protein kinase 17-like [Camelina 
sativa]
Length=527

 Score = 71.2 bits (173),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ YSLGKELGRGQFGVT+LCT+ +T + +ACK+I
Sbjct  60   VLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTI  103


 Score = 40.8 bits (94),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  106  RKLVNKEDIEDVRREVQIMHHLTGQ  130



>ref|XP_006289327.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
 gb|EOA22225.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
Length=530

 Score = 71.2 bits (173),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ YSLGKELGRGQFGVT+LCT+ +T + +ACK+I
Sbjct  63   VLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTI  106


 Score = 40.8 bits (94),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  109  RKLVNKEDIEDVRREVQIMHHLTGQ  133



>gb|KFK25494.1| hypothetical protein AALP_AA8G122000 [Arabis alpina]
Length=528

 Score = 71.2 bits (173),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+KA YSLGKELGRGQFGVT+LCT+ +T   +ACK+I
Sbjct  61   VLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTI  104


 Score = 40.8 bits (94),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  107  RKLVNKEDIEDVRREVQIMHHLTGQ  131



>ref|XP_010529441.1| PREDICTED: calcium-dependent protein kinase 21 [Tarenaya hassleriana]
Length=544

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 71/136 (52%), Gaps = 19/136 (14%)
 Frame = +1

Query  127  GCFS-KSKSRQGDVNGYRQG------RGVATGYQPVTESHQKASSTHAQTYTQPERPYNP  285
            GCFS K +  Q  V+G R        +     + P         +   QT +QP+    P
Sbjct  2    GCFSNKHRGAQAGVSGGRSSVPTNPTQTHVVHHVPEPRKQSDPQNHQPQTNSQPKPANQP  61

Query  286  QPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  465
             PQ    V  P KP +V          EP+ ILGK FEDIK  Y+LGKELGRGQFG+TY 
Sbjct  62   IPQQ---VSTPLKPVAVR---------EPDTILGKSFEDIKKFYTLGKELGRGQFGITYR  109

Query  466  CTEISTRRAYACKSIL  513
            CTEIST   YACKSIL
Sbjct  110  CTEISTGNTYACKSIL  125



>ref|XP_010419806.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Camelina sativa]
Length=528

 Score = 71.2 bits (173),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ YSLGKELGRGQFGVT+LCT+ +T + +ACK+I
Sbjct  61   VLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTI  104


 Score = 40.8 bits (94),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  107  RKLVNKEDIEDVRREVQIMHHLTGQ  131



>ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=546

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            PN+ILGKPF+DIK +Y+LGKELGRGQFG+TYLCTE ST  +YACKSIL
Sbjct  83   PNSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSIL  130


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (56%), Gaps = 3/70 (4%)
 Frame = +2

Query  386  GSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKRE  559
            G     ++    LGK  G    G +T +      G   A +    RKLVSKND+EDIKRE
Sbjct  88   GKPFDDIKQYYTLGKELGRGQFG-ITYLCTENSTGHSYACKSILKRKLVSKNDREDIKRE  146

Query  560  IQIMQHLSGQ  589
            IQIMQHLSGQ
Sbjct  147  IQIMQHLSGQ  156



>ref|XP_010519813.1| PREDICTED: calcium-dependent protein kinase 34 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score = 70.9 bits (172),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 60/131 (46%), Gaps = 30/131 (23%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS-  297
            MG C S  +    D +    G G      P  E+    +S HA        P +P P + 
Sbjct  1    MGNCCSHGRESPEDTDEPTPGNGATAQSNPAAETSAAPASKHA--------PPSPPPATK  52

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
              P+                       +LG+P ED+KA YSLGKELGRGQFGVT+LCT  
Sbjct  53   QGPI---------------------GPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTHK  91

Query  478  STRRAYACKSI  510
            +T   +ACK+I
Sbjct  92   ATGHQFACKTI  102


 Score = 40.8 bits (94),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  105  RKLVNKEDIEDVRREVQIMHHLTGQ  129



>ref|XP_006365956.1| PREDICTED: calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=526

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 68/130 (52%), Gaps = 21/130 (16%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C SKSK  +   +G+ +  G   G+             H     Q +   +P P++ 
Sbjct  1    MGVCLSKSKPAESKSDGHYRSGGSDGGH------------NHGTHQAQIQYTKSPGPETQ  48

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P+   A          P    +   ILGK FED+KAHY+LGKELGRGQFGVT+LCTEI+
Sbjct  49   LPLRPQA---------SPKPVFKQETILGKAFEDVKAHYTLGKELGRGQFGVTFLCTEIA  99

Query  481  TRRAYACKSI  510
            T   YACKSI
Sbjct  100  TGHQYACKSI  109



>ref|NP_176386.2| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
 sp|Q1PFH8.1|CDPKJ_ARATH RecName: Full=Calcium-dependent protein kinase 19 [Arabidopsis 
thaliana]
 gb|ABE65733.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AEE33906.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
Length=551

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +1

Query  157  GDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssv  336
            G+ N   + R +    QP     Q A     Q   QP +   P PQ       P +   +
Sbjct  21   GEQNTEVKSREITPKEQP--RQRQPAPRAKFQIVVQPHKLPLPLPQ-------PQEKQKL  71

Query  337  pqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
                +     +P  ILG+PFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSIL
Sbjct  72   INHQKQSTLQQPEPILGRPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSIL  130



>gb|AAC28510.1| Similar to gb|AF072908 calcium-dependent protein kinase from 
Nicotiana tabacum [Arabidopsis thaliana]
Length=553

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +1

Query  157  GDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssv  336
            G+ N   + R +    QP     Q A     Q   QP +   P PQ       P +   +
Sbjct  21   GEQNTEVKSREITPKEQP--RQRQPAPRAKFQIVVQPHKLPLPLPQ-------PQEKQKL  71

Query  337  pqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
                +     +P  ILG+PFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSIL
Sbjct  72   INHQKQSTLQQPEPILGRPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSIL  130



>ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
 gb|EOA22559.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
Length=534

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EIST   YACKSIL
Sbjct  67   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREISTGNTYACKSIL  115


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T + R    G   A +    RKL+SK DKED+
Sbjct  70   TILGKPFEDIRKFYSLGKELGRGQFG-ITYMCREISTGNTYACKSILKRKLISKQDKEDV  128

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQ+LSGQ
Sbjct  129  KREIQIMQYLSGQ  141



>ref|XP_008224828.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
2-like [Prunus mume]
Length=560

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            PN+ILGKPF+DIK +Y+LGKELGRGQFG+TYLCTE ST  +YACKSIL
Sbjct  97   PNSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSIL  144


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 3/70 (4%)
 Frame = +2

Query  386  GSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKRE  559
            G     ++    LGK  G    G +T +      G   A +    RKLVSKND++DIKRE
Sbjct  102  GKPFDDIKQYYTLGKELGRGQFG-ITYLCTENSTGHSYACKSILKRKLVSKNDRDDIKRE  160

Query  560  IQIMQHLSGQ  589
            IQIMQHLSGQ
Sbjct  161  IQIMQHLSGQ  170



>ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
sylvestris]
Length=542

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 68/147 (46%), Gaps = 36/147 (24%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGR-GVATGYQP---------------VTESHQKASSTHAQ  252
            MGGCFSK   ++G   GYR  R  V   YQ                     Q       Q
Sbjct  1    MGGCFSKKYRQEGANGGYRATRRNVNQEYQKPPQHQPERPYQPQPQPQPQPQPQPRPQPQ  60

Query  253  TYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKE  432
             +T   +P   Q Q   P H+                   NNILGKPFEDI+  Y+LGKE
Sbjct  61   AHTVTAQPAQTQDQMQGP-HL-------------------NNILGKPFEDIRKQYTLGKE  100

Query  433  LGRGQFGVTYLCTEISTRRAYACKSIL  513
            LGRGQFGVTY CTE ST   YACKSIL
Sbjct  101  LGRGQFGVTYHCTENSTGNPYACKSIL  127


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 46/105 (44%), Gaps = 16/105 (15%)
 Frame = +2

Query  281  THSPSPMLQSMSLQNPHQCPNLLGL-FRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG*  457
            T +  P      +Q PH   N+LG  F D+             R    LGK  G    G 
Sbjct  63   TVTAQPAQTQDQMQGPH-LNNILGKPFEDI-------------RKQYTLGKELGRGQFGV  108

Query  458  -LTCVLRFPPVGLMLASRF*RKLVSKNDKEDIKREIQIMQHLSGQ  589
               C            S   RKLV KND+EDIKREIQIMQHLSGQ
Sbjct  109  TYHCTENSTGNPYACKSILKRKLVRKNDREDIKREIQIMQHLSGQ  153



>emb|CDX70450.1| BnaC03g05340D [Brassica napus]
Length=523

 Score = 71.2 bits (173),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ YSLGKELGRGQFGVT+LCT+ +T + +ACK+I
Sbjct  56   VLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTI  99


 Score = 40.0 bits (92),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM H++GQ
Sbjct  102  RKLVNKEDIEDVRREVQIMHHMTGQ  126



>ref|XP_009125853.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=522

 Score = 70.9 bits (172),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 64/130 (49%), Gaps = 32/130 (25%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C S+ +    + +GY Q +G+             AS+           P  PQ +  
Sbjct  1    MGNCCSQGRDSADNADGYTQDKGIT------------ASTAE---------PSVPQSKHA  39

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P   PA       P           +LG+P ED+K+ YSLGKELGRGQFGVT+LCT+ +
Sbjct  40   PPSPPPATKQGPIGP-----------VLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKA  88

Query  481  TRRAYACKSI  510
            T + +ACK+I
Sbjct  89   TGQQFACKTI  98


 Score = 40.0 bits (92),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM H++GQ
Sbjct  101  RKLVNKEDIEDVRREVQIMHHMTGQ  125



>ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 
[Glycine max]
Length=528

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 68/132 (52%), Gaps = 23/132 (17%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPER--PYNPQPQ  294
            MG C SK  S   +   YR   G   G   V  +H+       Q Y  PE+  P+ P P 
Sbjct  1    MGCCMSKKGSEPEEHIVYRHVAG--AGGAGVYNNHKSHEPPSHQPYPLPEKHAPWRPPP-  57

Query  295  SYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTE  474
              +P HV                 + + I GKPFED+K HY+LGKELGRGQFGVTYLCTE
Sbjct  58   --SPKHV----------------HKHDTITGKPFEDVKQHYTLGKELGRGQFGVTYLCTE  99

Query  475  ISTRRAYACKSI  510
             ST   YACKSI
Sbjct  100  NSTGFQYACKSI  111


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 57/121 (47%), Gaps = 24/121 (20%)
 Frame = +2

Query  236  PQPMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGL-FRDLSQITYWGSLLRTLRH  412
            P   P P+P    P    PSP       ++ H+   + G  F D+ Q            H
Sbjct  39   PSHQPYPLPEKHAPWRPPPSP-------KHVHKHDTITGKPFEDVKQ------------H  79

Query  413  TTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDIKREIQIMQHLSG  586
             T LGK  G    G +T +      G   A +    RKLVS++DKED+KREIQIMQHLSG
Sbjct  80   YT-LGKELGRGQFG-VTYLCTENSTGFQYACKSISKRKLVSRDDKEDMKREIQIMQHLSG  137

Query  587  Q  589
            Q
Sbjct  138  Q  138



>gb|AFR11230.1| calcium dependent protein kinase 1 [Chenopodium album]
Length=543

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            ILGKPFEDI++HY LGKELGRGQFG+TYLCTE ST + YACKSIL
Sbjct  83   ILGKPFEDIRSHYKLGKELGRGQFGITYLCTENSTGQTYACKSIL  127


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLV+K DKEDI
Sbjct  82   TILGKPFEDIRSHYKLGKELGRGQFG-ITYLCTENSTGQTYACKSILKRKLVTKADKEDI  140

Query  551  KREIQIMQHLSGQ  589
            KREIQI+QHLSGQ
Sbjct  141  KREIQILQHLSGQ  153



>ref|XP_008349938.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
isoform 2-like [Malus domestica]
Length=453

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            N ILGKPFED++  Y++GKELGRGQFGVTYLCTEIST + YACKSI
Sbjct  44   NTILGKPFEDVRLRYTIGKELGRGQFGVTYLCTEISTGKKYACKSI  89


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = +2

Query  332  QCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF  511
            Q  +LL   +  S  T  G     +R    +GK  G    G +T +      G   A + 
Sbjct  30   QALDLLQAAQGPSDNTILGKPFEDVRLRYTIGKELGRGQFG-VTYLCTEISTGKKYACKS  88

Query  512  *--RKLVSKNDKEDIKREIQIMQHLSGQ  589
               RKLV+KNDKEDIKREIQIMQHLSGQ
Sbjct  89   ISKRKLVTKNDKEDIKREIQIMQHLSGQ  116



>ref|XP_010467929.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=873

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 70/130 (54%), Gaps = 15/130 (12%)
 Frame = +1

Query  127  GCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ-SYA  303
            GCFS    +  +  G R     +    PV    Q   +     + +P+ P  P+P+ +Y 
Sbjct  2    GCFSSKPRKTQNHGGER-----SIPINPV----QTHVANQVPEHRKPQIP-TPKPKPTYQ  51

Query  304  PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIST  483
            P+H             P+   +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EI T
Sbjct  52   PIH----QQISTPSSNPISVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIET  107

Query  484  RRAYACKSIL  513
               YACKSIL
Sbjct  108  GNTYACKSIL  117


 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 70/130 (54%), Gaps = 15/130 (12%)
 Frame = +1

Query  127  GCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ-SYA  303
            GCFS    +  +  G R     +    PV    Q   +     + +P+ P  P+P+ +Y 
Sbjct  339  GCFSSKPRKTQNHGGER-----SIPINPV----QTHVANQVPEHRKPQIP-TPKPKPTYQ  388

Query  304  PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIST  483
            P+H             P+   +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EI T
Sbjct  389  PIH----QQISTPSSNPISVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIET  444

Query  484  RRAYACKSIL  513
               YACKSIL
Sbjct  445  GNTYACKSIL  454


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 44/123 (36%), Positives = 57/123 (46%), Gaps = 19/123 (15%)
 Frame = +2

Query  230  RHPQ-PMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTL  406
            R PQ P PKP P  +       +P    +S+++P                T  G     +
Sbjct  37   RKPQIPTPKPKPTYQPIHQQISTPSSNPISVRDPD---------------TILGKPFEDI  81

Query  407  RHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHL  580
            R    LGK  G    G +T + R    G   A +    RKL+SK DKED+KREIQIMQ+L
Sbjct  82   RKFYSLGKELGRGQFG-ITYMCREIETGNTYACKSILKRKLISKQDKEDVKREIQIMQYL  140

Query  581  SGQ  589
            SGQ
Sbjct  141  SGQ  143


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 44/123 (36%), Positives = 57/123 (46%), Gaps = 19/123 (15%)
 Frame = +2

Query  230  RHPQ-PMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTL  406
            R PQ P PKP P  +       +P    +S+++P                T  G     +
Sbjct  374  RKPQIPTPKPKPTYQPIHQQISTPSSNPISVRDPD---------------TILGKPFEDI  418

Query  407  RHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHL  580
            R    LGK  G    G +T + R    G   A +    RKL+SK DKED+KREIQIMQ+L
Sbjct  419  RKFYSLGKELGRGQFG-ITYMCREIETGNTYACKSILKRKLISKQDKEDVKREIQIMQYL  477

Query  581  SGQ  589
            SGQ
Sbjct  478  SGQ  480



>ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51070.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +1

Query  247  AQTYTQPERPYNPQPQSYAP--VHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYS  420
             QT+   + P + +PQ+  P  ++ P           P+   +P  ILGKPFEDI+  YS
Sbjct  25   VQTHVVNQVPEHRKPQTPTPKPMNQPILQQISTPSSNPISVRDPETILGKPFEDIRKFYS  84

Query  421  LGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            LGKELGRGQFG+TY+C EI T   YACKSIL
Sbjct  85   LGKELGRGQFGITYMCKEIGTGNTYACKSIL  115


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 6/113 (5%)
 Frame = +2

Query  257  IPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNW  436
            +P  + P T +P PM Q +  Q      N + + RD    T  G     +R    LGK  
Sbjct  33   VPEHRKPQTPTPKPMNQPILQQISTPSSNPISV-RDPE--TILGKPFEDIRKFYSLGKEL  89

Query  437  GGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            G    G +T + +    G   A +    RKL+SK DKED+KREIQIMQ+LSGQ
Sbjct  90   GRGQFG-ITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQ  141



>emb|CDY07254.1| BnaC04g19170D [Brassica napus]
Length=543

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 64/113 (57%), Gaps = 22/113 (19%)
 Frame = +1

Query  187  GVATGYQPVTESHQKASSTHAQTYTQPER---PYN-PQPQSYAPVHVPAKpssvpqpvrp  354
            G AT  QP+ +  Q A   + Q   QP +   P + PQPQ    +               
Sbjct  30   GEATQKQPLRQ-RQTAPRANIQIVVQPHKLPLPVSIPQPQEQQKL---------------  73

Query  355  vqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
                +P  ILGKPFED+K  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSIL
Sbjct  74   --MHQPEPILGKPFEDVKETYSLGRELGRGQFGITYICTEISSGKNFACKSIL  124



>ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis]
 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis]
Length=548

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGKPFEDIK HY+ GKELGRGQFGVTYLCTE ST R YACKSI
Sbjct  87   DTILGKPFEDIKNHYTFGKELGRGQFGVTYLCTENSTGRLYACKSI  132


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +++    GK  G    G +T +      G + A +    RKLVSKNDKED+
Sbjct  88   TILGKPFEDIKNHYTFGKELGRGQFG-VTYLCTENSTGRLYACKSISKRKLVSKNDKEDM  146

Query  551  KREIQIMQHLSGQ  589
            KREI+IMQHLSGQ
Sbjct  147  KREIRIMQHLSGQ  159



>gb|KDP36877.1| hypothetical protein JCGZ_08168 [Jatropha curcas]
Length=519

 Score = 72.4 bits (176),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 61/130 (47%), Gaps = 24/130 (18%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CFSKS SR   +                       SS+ + ++T P RP   Q + Y
Sbjct  1    MGLCFSKSCSRNILI-----------------------SSSDSPSHTPPRRPTTTQDRYY  37

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P   P        P           +LGKP+ DI A Y L KELGRGQFG+TYLCTE +
Sbjct  38   PPQP-PPPVRPRTTPSSTSLASNIGPVLGKPYVDITALYDLDKELGRGQFGITYLCTEKA  96

Query  481  TRRAYACKSI  510
            T   YACKSI
Sbjct  97   TGLKYACKSI  106


 Score = 37.4 bits (85),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +2

Query  518  KLVSKNDKEDIKREIQIMQHLSGQ  589
            KLV+  D ED++REI IMQHLSGQ
Sbjct  110  KLVNDKDIEDVRREILIMQHLSGQ  133



>ref|XP_006657762.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Oryza brachyantha]
Length=531

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 75/130 (58%), Gaps = 14/130 (11%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C S++ S          GRG A GY     SHQ  S+    +Y  P+    P P + 
Sbjct  1    MGMCCSRATSPDS-------GRGGANGY---GYSHQAKSAQAPPSYNHPQ----PPPPAE  46

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                 PA    V  PV    +P P+ ILGKP+ED+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  47   VRYTPPAMNPPVVPPVVAPPKPTPDTILGKPYEDVRSAYSLGKELGRGQFGVTYLCTEIA  106

Query  481  TRRAYACKSI  510
            T + YACKSI
Sbjct  107  TGKQYACKSI  116


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  72   TILGKPYEDVRSAYSLGKELGRGQFG-VTYLCTEIATGKQYACKSISKRKLVSKADKEDI  130

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  131  RREIQIMQHLSGQ  143



>ref|XP_009144515.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica rapa]
 emb|CDX97315.1| BnaA02g21060D [Brassica napus]
Length=520

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY C EIST   YACKSIL
Sbjct  53   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSIL  101


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T   R    G   A +    RKL+SK DKED+
Sbjct  56   TILGKPFEDIRKFYSLGKELGRGQFG-ITYRCREISTGNTYACKSILKRKLISKQDKEDV  114

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQ+LSGQ
Sbjct  115  KREIQIMQYLSGQ  127



>gb|EAZ40006.1| hypothetical protein OsJ_24444 [Oryza sativa Japonica Group]
Length=454

 Score = 60.5 bits (145),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  418  SLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            SLGKELGRGQFGVTYLCTEI++ + YACKSI
Sbjct  7    SLGKELGRGQFGVTYLCTEIASGKQYACKSI  37


 Score = 48.9 bits (115),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK DKEDI+REIQIMQHLSGQ
Sbjct  40   RKLVSKADKEDIRREIQIMQHLSGQ  64



>gb|KFK40633.1| hypothetical protein AALP_AA2G022000 [Arabis alpina]
Length=551

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  ILGKPFED+K  YSLG+ELGRGQFG+TYLCTEIS+ + +ACKSIL
Sbjct  85   QPEPILGKPFEDVKEKYSLGRELGRGQFGITYLCTEISSGKNFACKSIL  133



>ref|XP_010418170.1| PREDICTED: calcium-dependent protein kinase 19-like [Camelina 
sativa]
Length=555

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSIL
Sbjct  84   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSIL  132



>ref|XP_006301218.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
 gb|EOA34116.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
Length=547

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSIL
Sbjct  78   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSIL  126



>ref|XP_006657761.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Oryza brachyantha]
Length=559

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 75/130 (58%), Gaps = 14/130 (11%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C S++ S          GRG A GY     SHQ  S+    +Y  P+    P P + 
Sbjct  1    MGMCCSRATSPDS-------GRGGANGY---GYSHQAKSAQAPPSYNHPQ----PPPPAE  46

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                 PA    V  PV    +P P+ ILGKP+ED+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  47   VRYTPPAMNPPVVPPVVAPPKPTPDTILGKPYEDVRSAYSLGKELGRGQFGVTYLCTEIA  106

Query  481  TRRAYACKSI  510
            T + YACKSI
Sbjct  107  TGKQYACKSI  116


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  72   TILGKPYEDVRSAYSLGKELGRGQFG-VTYLCTEIATGKQYACKSISKRKLVSKADKEDI  130

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  131  RREIQIMQHLSGQ  143



>ref|XP_004499307.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
29-like [Cicer arietinum]
Length=764

 Score = 74.3 bits (181),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILG+P+ D+KA Y++GKELGRGQFGVTYLCTE +T R YACKSI
Sbjct  301  ILGRPYIDMKALYNIGKELGRGQFGVTYLCTEKATGRRYACKSI  344


 Score = 34.7 bits (78),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+ K + ED+K EI I+QHL+GQ
Sbjct  347  RKLIRKKEIEDVKMEIMILQHLTGQ  371


 Score = 59.7 bits (143),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+  I   Y + KELGRGQ GVTYLC E  T R YACKSI
Sbjct  55   ILGKPYVVINQIYEMKKELGRGQSGVTYLCVEKITGREYACKSI  98


 Score = 34.3 bits (77),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  518  KLVSKNDKEDIKREIQIMQHLSGQ  589
            KL+S+ + +D+KRE+ I+QHLSGQ
Sbjct  102  KLLSEQEIDDVKREVMILQHLSGQ  125



>ref|XP_010422295.1| PREDICTED: calcium-dependent protein kinase 21 [Camelina sativa]
Length=534

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EI T   YACKSIL
Sbjct  67   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIETGNTYACKSIL  115


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 58/124 (47%), Gaps = 23/124 (19%)
 Frame = +2

Query  230  RHPQ-PMPKPIPNLKGPITHSPS-PMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRT  403
            R PQ P+PKP      PI    S P    +S+++P                T  G     
Sbjct  37   RKPQIPIPKPTNQ---PIHQQISTPSSNPISVRDPD---------------TILGKPFED  78

Query  404  LRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQH  577
            +R    LGK  G    G +T + R    G   A +    RKL+SK DKED+KREIQIMQ+
Sbjct  79   IRKFYSLGKELGRGQFG-ITYMCREIETGNTYACKSILKRKLISKQDKEDVKREIQIMQY  137

Query  578  LSGQ  589
            LSGQ
Sbjct  138  LSGQ  141



>gb|ADM14342.1| calcium-dependent protein kinase 19 [Oryza sativa Japonica Group]
Length=533

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 74/130 (57%), Gaps = 14/130 (11%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C S++ S          GRG A GY     SHQ   +    +Y  P+ P  P    Y
Sbjct  1    MGSCCSRATSPDS-------GRGGANGY---GYSHQTKPAQTTPSYNHPQPP-PPAEVRY  49

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P    A    V  PV    +P P+ ILGKP++D+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  50   TP---SAMNPPVVPPVVAPPKPTPDTILGKPYDDVRSVYSLGKELGRGQFGVTYLCTEIA  106

Query  481  TRRAYACKSI  510
            + + YACKSI
Sbjct  107  SGKQYACKSI  116



>ref|XP_010455773.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=536

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 67/129 (52%), Gaps = 13/129 (10%)
 Frame = +1

Query  127  GCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAP  306
            GCFS    +  +  G R     +    P+    Q         + +P+ P  P+P+   P
Sbjct  2    GCFSSKHRKTQNHGGER-----SIPINPI----QTHVPNQVPEHRKPQIP-TPKPK---P  48

Query  307  VHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTR  486
             + P           P+   +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EI T 
Sbjct  49   TNQPIHQQVSTPSSNPISVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIETG  108

Query  487  RAYACKSIL  513
              YACKSIL
Sbjct  109  NTYACKSIL  117


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 57/123 (46%), Gaps = 19/123 (15%)
 Frame = +2

Query  230  RHPQ-PMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTL  406
            R PQ P PKP P  +       +P    +S+++P                T  G     +
Sbjct  37   RKPQIPTPKPKPTNQPIHQQVSTPSSNPISVRDPD---------------TILGKPFEDI  81

Query  407  RHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHL  580
            R    LGK  G    G +T + R    G   A +    RKL+SK DKED+KREIQIMQ+L
Sbjct  82   RKFYSLGKELGRGQFG-ITYMCREIETGNTYACKSILKRKLISKQDKEDVKREIQIMQYL  140

Query  581  SGQ  589
            SGQ
Sbjct  141  SGQ  143



>ref|NP_001059775.1| Os07g0515100 [Oryza sativa Japonica Group]
 sp|P53683.2|CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform 2; Short=CDPK 
2 [Oryza sativa Japonica Group]
 dbj|BAC20693.1| CDP2_ORYSA Calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF21689.1| Os07g0515100 [Oryza sativa Japonica Group]
Length=533

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 74/130 (57%), Gaps = 14/130 (11%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG C S++ S          GRG A GY     SHQ   +    +Y  P+ P  P    Y
Sbjct  1    MGSCCSRATSPDS-------GRGGANGY---GYSHQTKPAQTTPSYNHPQPP-PPAEVRY  49

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
             P    A    V  PV    +P P+ ILGKP++D+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  50   TP---SAMNPPVVPPVVAPPKPTPDTILGKPYDDVRSVYSLGKELGRGQFGVTYLCTEIA  106

Query  481  TRRAYACKSI  510
            + + YACKSI
Sbjct  107  SGKQYACKSI  116


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  72   TILGKPYDDVRSVYSLGKELGRGQFG-VTYLCTEIASGKQYACKSISKRKLVSKADKEDI  130

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  131  RREIQIMQHLSGQ  143



>ref|XP_007213195.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
 gb|EMJ14394.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
Length=534

 Score = 67.8 bits (164),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+++ YS+GKELGRGQFGVT+LCT  +T   +ACK+I
Sbjct  67   VLGRPMEDVRSMYSIGKELGRGQFGVTHLCTHKATGEHFACKTI  110


 Score = 40.8 bits (94),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  113  RKLVNKEDIEDVRREVQIMHHLTGQ  137



>dbj|BAJ99143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +1

Query  121  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQTPPSYNNAQ----PPP  43

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            Q+      PA    V  PV    +P P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCT
Sbjct  44   QAEVRYTPPAMNPPVVPPVVAPSKPTPDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCT  103

Query  472  EISTRRAYACKSI  510
            EIST R YACKSI
Sbjct  104  EISTGRQYACKSI  116


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  72   TILGKQYEDVRSVYSLGKELGRGQFG-VTYLCTEISTGRQYACKSISKRKLVSKADKEDI  130

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  131  RREIQIMQHLSGQ  143



>ref|NP_001280761.1| calcium-dependent protein kinase 2-like [Malus domestica]
 gb|AAR28084.1| calcium-dependent protein kinase [Malus domestica]
Length=543

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            N+ILGKPF+DIK +Y+LGKELGRGQFG+TYLCTE ST  +YACKSIL
Sbjct  81   NSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSIL  127


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  404  LRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQH  577
            ++    LGK  G    G +T +      G   A +    RKLVSKND++DIKREIQIMQH
Sbjct  91   IKQYYTLGKELGRGQFG-ITYLCTENSTGHSYACKSILKRKLVSKNDRDDIKREIQIMQH  149

Query  578  LSGQ  589
            LSGQ
Sbjct  150  LSGQ  153



>gb|ABC59619.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMT05971.1| Calcium-dependent protein kinase isoform 2 [Aegilops tauschii]
Length=532

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +1

Query  121  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQAPPSYNNAQ----PPP  43

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            Q+      PA    V  PV    +P P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCT
Sbjct  44   QAEVRYTPPAMNPPVVPPVVAPSKPMPDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCT  103

Query  472  EISTRRAYACKSI  510
            EIST R YACKSI
Sbjct  104  EISTGRQYACKSI  116


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  72   TILGKQYEDVRSVYSLGKELGRGQFG-VTYLCTEISTGRQYACKSISKRKLVSKADKEDI  130

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  131  RREIQIMQHLSGQ  143



>gb|ABD98803.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|ABY59008.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMS66675.1| Calcium-dependent protein kinase isoform 2 [Triticum urartu]
Length=532

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +1

Query  121  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQTPPSYNNAQ----PPP  43

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            Q+      PA    V  PV    +P P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCT
Sbjct  44   QAEVRYTPPAMNPPVVPPVVAPSKPMPDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCT  103

Query  472  EISTRRAYACKSI  510
            EIST R YACKSI
Sbjct  104  EISTGRQYACKSI  116


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  72   TILGKQYEDVRSVYSLGKELGRGQFG-VTYLCTEISTGRQYACKSISKRKLVSKADKEDI  130

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  131  RREIQIMQHLSGQ  143



>ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
 gb|ESQ38125.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
Length=535

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY C EIST   YACKSIL
Sbjct  68   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSIL  116


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T   R    G   A +    RKL+SK DKED+
Sbjct  71   TILGKPFEDIRKFYSLGKELGRGQFG-ITYRCREISTGNTYACKSILKRKLISKQDKEDV  129

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQ+LSGQ
Sbjct  130  KREIQIMQYLSGQ  142



>ref|XP_002299975.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa]
 gb|EEE84780.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa]
Length=505

 Score = 67.4 bits (163),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ YS+GKELGRGQFG+T+LCT   T   +ACK+I
Sbjct  37   VLGRPMEDVKSIYSIGKELGRGQFGITHLCTNKVTGEQFACKTI  80


 Score = 41.2 bits (95),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  83   RKLVNKEDVEDVRREVQIMHHLTGQ  107



>gb|KDO78219.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
 gb|KDO78220.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=447

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 67/134 (50%), Gaps = 12/134 (9%)
 Frame = +1

Query  127  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            +  AP   P +              +P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  472  EISTRRAYACKSIL  513
            E ST  +YACKSIL
Sbjct  115  ENSTGNSYACKSIL  128


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G  L  +R    LGK  G    G +T +      G   A +    RKLV+K D+EDI
Sbjct  83   TVLGKPLEDIRQFYTLGKELGRGQFG-ITYLCTENSTGNSYACKSILKRKLVNKQDREDI  141

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHLSGQ
Sbjct  142  KREIQIMQHLSGQ  154



>gb|AGJ83807.1| calcium-dependent protein kinase 1e [Vitis amurensis]
Length=536

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 68/131 (52%), Gaps = 13/131 (10%)
 Frame = +1

Query  121  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MG C SKSK   +   NGY  G      Y  + E   + ++     +  PE+     P +
Sbjct  1    MGICLSKSKRGSEPAYNGYGSGAVAGGVYDRIQE---RPAAVQQPPHQLPEKRV---PAA  54

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
              PV  P           P     P+ ILGK FED+K HY++GKELGRGQFGVTYLCTE 
Sbjct  55   QPPVKPPT------VAASPKPVHRPDTILGKSFEDVKLHYTIGKELGRGQFGVTYLCTEN  108

Query  478  STRRAYACKSI  510
            ST   YACKSI
Sbjct  109  STGLQYACKSI  119


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     ++    +GK  G    G +T +      GL  A +    RKLV+KNDKEDI
Sbjct  75   TILGKSFEDVKLHYTIGKELGRGQFG-VTYLCTENSTGLQYACKSISKRKLVTKNDKEDI  133

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQ LSGQ
Sbjct  134  RREIQIMQDLSGQ  146



>gb|ACB71246.2| calcium-dependent protein kinase 1 [Hevea brasiliensis]
Length=556

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 48/77 (62%), Gaps = 11/77 (14%)
 Frame = +1

Query  283  PQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
            P P   AP ++ A+               P  ILGKP EDIK +YSLGKELGRGQFGVTY
Sbjct  75   PPPVRAAPTNLTARSVQT-----------PQTILGKPLEDIKQYYSLGKELGRGQFGVTY  123

Query  463  LCTEISTRRAYACKSIL  513
            LCTE ST   YACKSIL
Sbjct  124  LCTENSTGHIYACKSIL  140


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G  L  ++    LGK  G    G +T +      G + A +    RKL++K D+EDI
Sbjct  95   TILGKPLEDIKQYYSLGKELGRGQFG-VTYLCTENSTGHIYACKSILKRKLINKGDREDI  153

Query  551  KREIQIMQHLSGQ  589
            KRE+QIMQHLSGQ
Sbjct  154  KREVQIMQHLSGQ  166



>ref|XP_006452356.1| hypothetical protein CICLE_v10010666mg [Citrus clementina]
 gb|ESR65596.1| hypothetical protein CICLE_v10010666mg [Citrus clementina]
Length=491

 Score = 71.6 bits (174),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGKP+ED++ HY++GKELG+G F VTYLCTE ST   +ACKSI
Sbjct  27   DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCTENSTGLQFACKSI  72


 Score = 37.0 bits (84),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +K+V+  +K+D++REI+IM+HLSGQ
Sbjct  75   KKIVAAYEKDDVRREIEIMRHLSGQ  99



>gb|KDO37230.1| hypothetical protein CISIN_1g047606mg [Citrus sinensis]
Length=476

 Score = 71.6 bits (174),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGKP+ED++ HY++GKELG+G F VTYLCTE ST   +ACKSI
Sbjct  27   DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCTENSTGLQFACKSI  72


 Score = 36.6 bits (83),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +K+V+  +K+D++REI+IM+HLSGQ
Sbjct  75   KKIVAAYEKDDVRREIEIMRHLSGQ  99



>gb|KDP43197.1| hypothetical protein JCGZ_22749 [Jatropha curcas]
Length=531

 Score = 66.2 bits (160),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ Y++GKELGRGQFGVT+LCT   T   +ACK+I
Sbjct  71   VLGRPMEDVKSVYTIGKELGRGQFGVTHLCTHKITGEQFACKTI  114


 Score = 42.0 bits (97),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED+KRE+QIM HL+GQ
Sbjct  117  RKLVNKEDVEDVKREVQIMHHLTGQ  141



>ref|XP_006475081.1| PREDICTED: calcium-dependent protein kinase 33-like isoform X1 
[Citrus sinensis]
Length=533

 Score = 71.2 bits (173),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGKP+ED++ HY++GKELG+G F VTYLCTE ST   +ACKSI
Sbjct  27   DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCTENSTGLQFACKSI  72


 Score = 37.0 bits (84),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +K+V+  +K+D++REI+IM+HLSGQ
Sbjct  75   KKIVAAYEKDDVRREIEIMRHLSGQ  99



>gb|KJB62816.1| hypothetical protein B456_009G438300 [Gossypium raimondii]
Length=524

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 72/131 (55%), Gaps = 24/131 (18%)
 Frame = +1

Query  121  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            MGGC +K+K S     NGY+ G    T       + ++   TH      PE+P    P  
Sbjct  1    MGGCLTKTKGSNPQHNNGYKSGATTTT-------AAEQPQPTHI-----PEKPGTQAP--  46

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
            + PV VP               P+ + ILGKP+EDI+ HY++GKELG+GQFGVTYLC E 
Sbjct  47   WKPV-VPT--------PSAKPAPKSDTILGKPYEDIRMHYTIGKELGKGQFGVTYLCIEN  97

Query  478  STRRAYACKSI  510
            ST + YACK+I
Sbjct  98   STGKQYACKTI  108


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    +GK  G    G +T +      G   A +    RKL++KNDKED+
Sbjct  64   TILGKPYEDIRMHYTIGKELGKGQFG-VTYLCIENSTGKQYACKTISKRKLITKNDKEDM  122

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  123  RREIQIMQHLSGQ  135



>ref|XP_010686845.1| PREDICTED: calcium-dependent protein kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            P+ ILGKP+EDI+++Y LGKELGRGQFG+TYLCTE ST + YACKSIL
Sbjct  126  PDTILGKPYEDIRSNYRLGKELGRGQFGITYLCTENSTGQTYACKSIL  173



>ref|XP_006452348.1| hypothetical protein CICLE_v10008325mg [Citrus clementina]
 gb|ESR65588.1| hypothetical protein CICLE_v10008325mg [Citrus clementina]
Length=439

 Score = 71.2 bits (173),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGKP+ED++ HY++GKELG+G F VTYLCTE ST   +ACKSI
Sbjct  27   DAILGKPYEDVRLHYTIGKELGKGAFAVTYLCTENSTGLQFACKSI  72


 Score = 37.0 bits (84),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            +K+V+  +K+D++REI+IM+HLSGQ
Sbjct  75   KKIVAAYEKDDVRREIEIMRHLSGQ  99



>gb|AIO04122.1| calcium-dependent protein kinase [Hevea brasiliensis]
Length=556

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 48/77 (62%), Gaps = 11/77 (14%)
 Frame = +1

Query  283  PQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  462
            P P   AP ++ A+               P  ILGKP EDIK +YSLGKELGRGQFG+TY
Sbjct  75   PPPVRAAPTNLTARSVQT-----------PQTILGKPLEDIKQYYSLGKELGRGQFGITY  123

Query  463  LCTEISTRRAYACKSIL  513
            LCTE ST   YACKSIL
Sbjct  124  LCTENSTGHIYACKSIL  140


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G  L  ++    LGK  G    G +T +      G + A +    RKL +K D+EDI
Sbjct  95   TILGKPLEDIKQYYSLGKELGRGQFG-ITYLCTENSTGHIYACKSILKRKLTNKGDREDI  153

Query  551  KREIQIMQHLSGQ  589
            KRE+QIMQHLSGQ
Sbjct  154  KREVQIMQHLSGQ  166



>gb|KHN02836.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=551

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 70/131 (53%), Gaps = 4/131 (3%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHA-QTYTQPERPYNPQPQS  297
            MG C SK    Q   NGYR G       Q   E     S   A Q Y  PE+      Q+
Sbjct  1    MGCCVSKDSEPQH--NGYRHGGTGGVHNQKTHEPLVNQSRAPANQPYHLPEKHAASTAQT  58

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
              P ++P KPS      +PV     + ILGK FED+K  Y+LGKELGRGQFGVTYLCTE 
Sbjct  59   -VPQNMPWKPSGPALSPKPVVSVRQDTILGKQFEDVKQFYTLGKELGRGQFGVTYLCTEN  117

Query  478  STRRAYACKSI  510
            ST   YACKSI
Sbjct  118  STGLQYACKSI  128


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 42/77 (55%), Gaps = 3/77 (4%)
 Frame = +2

Query  365  LSQITYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKND  538
            + Q T  G     ++    LGK  G    G +T +      GL  A +    RKLV K+D
Sbjct  80   VRQDTILGKQFEDVKQFYTLGKELGRGQFG-VTYLCTENSTGLQYACKSISKRKLVKKSD  138

Query  539  KEDIKREIQIMQHLSGQ  589
            KEDIKREIQIMQHLSGQ
Sbjct  139  KEDIKREIQIMQHLSGQ  155



>ref|XP_002526062.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF36339.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=536

 Score = 65.9 bits (159),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 67/132 (51%), Gaps = 22/132 (17%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVA--TGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ  294
            MG C S+  S  GD     +G  VA  T       ++Q+ S+T             P P+
Sbjct  1    MGNCCSRGDS--GDAAENEKGEAVANNTNGSVANNANQENSTT-------------PPPK  45

Query  295  SYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTE  474
            S AP       S  P    P+       +LG+P E++K+ Y++GKELGRGQFGVT+LCT 
Sbjct  46   STAPTSPSPAASPKPAKAAPIGP-----VLGRPMEEVKSVYTIGKELGRGQFGVTHLCTH  100

Query  475  ISTRRAYACKSI  510
             +T   +ACK+I
Sbjct  101  KATGEQFACKTI  112


 Score = 42.4 bits (98),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED+KRE+QIM HL+GQ
Sbjct  115  RKLVNKEDVEDVKREVQIMHHLTGQ  139



>ref|XP_011024983.1| PREDICTED: calcium-dependent protein kinase 17 [Populus euphratica]
Length=530

 Score = 67.0 bits (162),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ YS+GKELGRGQFG+T+LCT   T   +ACK+I
Sbjct  63   VLGRPMEDVKSIYSIGKELGRGQFGITHLCTNKVTGEQFACKTI  106


 Score = 41.2 bits (95),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  109  RKLVNKEDVEDVRREVQIMHHLTGQ  133



>emb|CBI23246.3| unnamed protein product [Vitis vinifera]
Length=514

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 66/130 (51%), Gaps = 34/130 (26%)
 Frame = +1

Query  127  GCFS-KSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYA  303
            GCFS K +  + D+ G R  RG  T             + H      P +P +P  ++  
Sbjct  2    GCFSSKERVTERDIKGGRSERGAPT------------QTYHQPPPQPPLKPSHPNTRAI-  48

Query  304  PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIST  483
                                 +P+ ILG+PF+DIK +Y+LGKELGRGQFGVTYLCT+ ST
Sbjct  49   --------------------QKPDTILGRPFDDIKHYYTLGKELGRGQFGVTYLCTQNST  88

Query  484  RRAYACKSIL  513
               YACKSIL
Sbjct  89   GNTYACKSIL  98


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     ++H   LGK  G    G +T +      G   A +    RKLV+KNDKEDI
Sbjct  53   TILGRPFDDIKHYYTLGKELGRGQFG-VTYLCTQNSTGNTYACKSILKRKLVTKNDKEDI  111

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHL+GQ
Sbjct  112  KREIQIMQHLTGQ  124



>ref|XP_003622837.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|KEH17263.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=534

 Score = 67.0 bits (162),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +L +P ED++A YS+GKELGRGQFGVT+LCT   T+  +ACK+I
Sbjct  66   VLQRPMEDVRATYSIGKELGRGQFGVTHLCTHKVTKEQFACKTI  109


 Score = 40.8 bits (94),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  112  RKLVNKEDIEDVRREVQIMHHLTGQ  136



>ref|XP_003589572.1| Calcium-dependent protein kinase [Medicago truncatula]
Length=901

 Score = 74.3 bits (181),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +1

Query  265  PERPYNPQP-QSYAPVHVPAKpssvpqpvrpvqrpEPNN----ILGKPFEDIKAHYSLGK  429
            P  P   QP Q   P H+ AK                ++    ILG+P+ D+K  YS+GK
Sbjct  391  PNPPTRNQPRQPRYPHHIAAKSDPTSYSSASSSNANASDHHQPILGRPYIDMKTLYSIGK  450

Query  430  ELGRGQFGVTYLCTEISTRRAYACKSI  510
            ELGRGQFGVTYLCTE +T R YACKSI
Sbjct  451  ELGRGQFGVTYLCTENATGRNYACKSI  477


 Score = 33.5 bits (75),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL  K + ED+KREI I+Q LSGQ
Sbjct  480  RKLTRKKEIEDVKREIMILQDLSGQ  504


 Score = 61.6 bits (148),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+  I   Y + KELGRGQ GVTYLCTE +T R YACKSI
Sbjct  182  ILGKPYVVINNIYDMKKELGRGQSGVTYLCTEKTTGREYACKSI  225


 Score = 33.5 bits (75),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  518  KLVSKNDKEDIKREIQIMQHLSGQ  589
            KL+S+ + +D++RE+ I+QHLSGQ
Sbjct  229  KLLSEQEIDDVRREVMILQHLSGQ  252



>gb|KDO78218.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=523

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 67/134 (50%), Gaps = 12/134 (9%)
 Frame = +1

Query  127  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            +  AP   P +              +P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  472  EISTRRAYACKSIL  513
            E ST  +YACKSIL
Sbjct  115  ENSTGNSYACKSIL  128


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G  L  +R    LGK  G    G +T +      G   A +    RKLV+K D+EDI
Sbjct  83   TVLGKPLEDIRQFYTLGKELGRGQFG-ITYLCTENSTGNSYACKSILKRKLVNKQDREDI  141

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHLSGQ
Sbjct  142  KREIQIMQHLSGQ  154



>gb|AES59823.2| calcium-dependent kinase [Medicago truncatula]
Length=533

 Score = 74.3 bits (181),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILG+P+ D+K  YS+GKELGRGQFGVTYLCTE +T R YACKSI
Sbjct  66   ILGRPYIDMKTLYSIGKELGRGQFGVTYLCTENATGRNYACKSI  109


 Score = 33.5 bits (75),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL  K + ED+KREI I+Q LSGQ
Sbjct  112  RKLTRKKEIEDVKREIMILQDLSGQ  136



>gb|AGJ83806.1| calcium-dependent protein kinase 1d [Vitis amurensis]
Length=545

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P+ ILGKPF+DIK +Y+LGKELGRGQFGVTYLCT+ ST   YACKSIL
Sbjct  81   KPDTILGKPFDDIKHYYTLGKELGRGQFGVTYLCTQNSTGNTYACKSIL  129


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     ++H   LGK  G    G +T +      G   A +    RKLV+KNDKEDI
Sbjct  84   TILGKPFDDIKHYYTLGKELGRGQFG-VTYLCTQNSTGNTYACKSILKRKLVTKNDKEDI  142

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHL+GQ
Sbjct  143  KREIQIMQHLTGQ  155



>gb|KDO78217.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=544

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 67/134 (50%), Gaps = 12/134 (9%)
 Frame = +1

Query  127  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            +  AP   P +              +P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  472  EISTRRAYACKSIL  513
            E ST  +YACKSIL
Sbjct  115  ENSTGNSYACKSIL  128


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G  L  +R    LGK  G    G +T +      G   A +    RKLV+K D+EDI
Sbjct  83   TVLGKPLEDIRQFYTLGKELGRGQFG-ITYLCTENSTGNSYACKSILKRKLVNKQDREDI  141

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHLSGQ
Sbjct  142  KREIQIMQHLSGQ  154



>ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis]
Length=544

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 67/134 (50%), Gaps = 12/134 (9%)
 Frame = +1

Query  127  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            +  AP   P +              +P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  472  EISTRRAYACKSIL  513
            E ST  +YACKSIL
Sbjct  115  ENSTGNSYACKSIL  128


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G  L  +R    LGK  G    G +T +      G   A +    RKLV+K D+EDI
Sbjct  83   TVLGKPLEDIRQFYTLGKELGRGQFG-ITYLCTENSTGNSYACKSILKRKLVNKQDREDI  141

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHL+GQ
Sbjct  142  KREIQIMQHLAGQ  154



>gb|KDO62705.1| hypothetical protein CISIN_1g040917mg, partial [Citrus sinensis]
Length=494

 Score = 70.5 bits (171),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED++ HY++G+E+GRG+FG+TYLCTE ST   +ACKSI
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSI  66


 Score = 37.4 bits (85),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV   +K+D++REI+IM+HLSGQ
Sbjct  69   RKLVKDVEKDDVRREIEIMRHLSGQ  93



>gb|AGG35971.1| calcium-dependent protein kinase 29 [Brassica napus]
Length=538

 Score = 71.6 bits (174),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 64/131 (49%), Gaps = 22/131 (17%)
 Frame = +1

Query  118  RMGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            RMG CFSKS++++                 P++ S   + ST    Y    +P NPQ Q+
Sbjct  11   RMGFCFSKSQTQE----------------IPISSS---SDSTPPHRYQPLPKPTNPQTQT  51

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
                  P  P   P P       +   IL +P  D+ A Y L KELGRGQFGVTY CT+ 
Sbjct  52   ST---FPTNPKPKPAPPPSSSGSQIGPILNRPMIDLSALYDLHKELGRGQFGVTYRCTDK  108

Query  478  STRRAYACKSI  510
            S  R YACKSI
Sbjct  109  SNGREYACKSI  119


 Score = 36.2 bits (82),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+ + D ED++RE+ I+QHL+GQ
Sbjct  122  RKLIRQKDIEDVRREVMILQHLTGQ  146



>ref|NP_001266075.1| calcium-dependent protein kinase 21-like [Cicer arietinum]
 gb|AAP72281.2| calcium-dependent calmodulin-independent protein kinase isoform 
1 [Cicer arietinum]
Length=556

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 60/108 (56%), Gaps = 26/108 (24%)
 Frame = +1

Query  214  TESHQ----KASSTHAQTYTQPERPYNPQP----QSYAPVHVPAKpssvpqpvrpvqrpE  369
            T +HQ    + SSTH QT   P+   NP+P    Q+   VH                   
Sbjct  35   TNNHQYHSVQPSSTHVQT-PPPKPDSNPKPTVTTQNVKTVH-----------------KT  76

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
               ILGKPF+DIK HY+LG+ELGRGQFG+TY CTE ST   YACKSIL
Sbjct  77   DTTILGKPFDDIKKHYTLGQELGRGQFGITYFCTENSTGNTYACKSIL  124


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (46%), Gaps = 22/118 (19%)
 Frame = +2

Query  242  PMPKPIPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTV  421
            P PKP  N        P P + + +++  H+           +  T  G     ++    
Sbjct  53   PPPKPDSN--------PKPTVTTQNVKTVHK-----------TDTTILGKPFDDIKKHYT  93

Query  422  LGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
            LG+  G    G +T        G   A +    RKLVSK+D+EDIKREIQI+QHLSGQ
Sbjct  94   LGQELGRGQFG-ITYFCTENSTGNTYACKSILKRKLVSKSDREDIKREIQILQHLSGQ  150



>ref|XP_006452346.1| hypothetical protein CICLE_v10010522mg, partial [Citrus clementina]
 gb|ESR65586.1| hypothetical protein CICLE_v10010522mg, partial [Citrus clementina]
Length=456

 Score = 70.5 bits (171),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED++ HY++G+E+GRG+FG+TYLCTE ST   +ACKSI
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSI  66


 Score = 37.4 bits (85),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV   +K+D++REI+IM+HLSGQ
Sbjct  69   RKLVKDVEKDDVRREIEIMRHLSGQ  93



>emb|CDX73219.1| BnaC06g36670D [Brassica napus]
Length=552

 Score = 71.6 bits (174),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 64/131 (49%), Gaps = 22/131 (17%)
 Frame = +1

Query  118  RMGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  297
            RMG CFSKS++++                 P++ S   + ST    Y    +P NPQ Q+
Sbjct  25   RMGFCFSKSQTQE----------------IPISSS---SDSTPPHRYQPLPKPTNPQTQT  65

Query  298  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  477
                  P  P   P P       +   IL +P  D+ A Y L KELGRGQFGVTY CT+ 
Sbjct  66   ST---FPTNPKPKPAPPPSSSGSQIGPILNRPMIDLSALYDLHKELGRGQFGVTYRCTDK  122

Query  478  STRRAYACKSI  510
            S  R YACKSI
Sbjct  123  SNGREYACKSI  133


 Score = 36.2 bits (82),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+ + D ED++RE+ I+QHL+GQ
Sbjct  136  RKLIRQKDIEDVRREVMILQHLTGQ  160



>gb|AEY99979.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=522

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKPFED+KA+Y+LGKELGRGQFGVT+LCTEI+T   YACKSI
Sbjct  62   ILGKPFEDVKAYYTLGKELGRGQFGVTFLCTEIATGHQYACKSI  105



>ref|NP_001275456.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
 gb|AAQ08324.2| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=558

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            NNILGKPFEDI+  Y+LGKELGRGQFGVTY CTE ST   YACKSIL
Sbjct  96   NNILGKPFEDIRKLYTLGKELGRGQFGVTYYCTENSTENPYACKSIL  142


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 35/69 (51%), Gaps = 1/69 (1%)
 Frame = +2

Query  386  GSLLRTLRHTTVLGKNWGGASLG*-LTCVLRFPPVGLMLASRF*RKLVSKNDKEDIKREI  562
            G     +R    LGK  G    G    C            S   RKLVSKND+ED+KREI
Sbjct  100  GKPFEDIRKLYTLGKELGRGQFGVTYYCTENSTENPYACKSILKRKLVSKNDREDMKREI  159

Query  563  QIMQHLSGQ  589
            QIMQHLSGQ
Sbjct  160  QIMQHLSGQ  168



>ref|XP_010533815.1| PREDICTED: calcium-dependent protein kinase 19 [Tarenaya hassleriana]
Length=548

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  ILGKP EDIK  ++ G+ELGRGQFG+TYLCTEIST R +ACKSIL
Sbjct  81   QPEPILGKPLEDIKEKFTFGRELGRGQFGITYLCTEISTGRTFACKSIL  129



>gb|ABB54456.1| calcium-dependent protein kinase [Hordeum brevisubulatum]
Length=532

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCTEIST R YACKSI
Sbjct  70   PDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEISTGRQYACKSI  116


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  72   TILGKQYEDVRSVYSLGKELGRGQFG-VTYLCTEISTGRQYACKSISKRKLVSKADKEDI  130

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  131  RREIQIMQHLSGQ  143



>gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=540

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 71/131 (54%), Gaps = 6/131 (5%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MGGCFSK   ++G   GYR  R      +   + +QK      +   QP+    PQPQ  
Sbjct  1    MGGCFSKKYRQEGANGGYRATR------RNANQEYQKPPQHQPERPYQPQPQPQPQPQPR  54

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                         Q    +Q P  NNILGKPFEDI+  Y+LGKELGRGQFGVTY CTE S
Sbjct  55   PQPQAHTVTXQPXQTQDQMQGPHLNNILGKPFEDIRKQYTLGKELGRGQFGVTYHCTENS  114

Query  481  TRRAYACKSIL  513
            T   YACKSIL
Sbjct  115  TGNPYACKSIL  125


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +2

Query  386  GSLLRTLRHTTVLGKNWGGASLG*-LTCVLRFPPVGLMLASRF*RKLVSKNDKEDIKREI  562
            G     +R    LGK  G    G    C            S   RKLV KND+ED+KREI
Sbjct  83   GKPFEDIRKQYTLGKELGRGQFGVTYHCTENSTGNPYACKSILKRKLVRKNDREDMKREI  142

Query  563  QIMQHLSGQ  589
            QIMQHLSGQ
Sbjct  143  QIMQHLSGQ  151



>ref|XP_006475078.1| PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis]
Length=551

 Score = 70.1 bits (170),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            + ILGK +ED++ HY++G+E+GRG+FG+TYLCTE ST   +ACKSI
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSI  66


 Score = 37.4 bits (85),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV   +K+D++REI+IM+HLSGQ
Sbjct  69   RKLVKDVEKDDVRREIEIMRHLSGQ  93



>ref|XP_004250895.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
lycopersicum]
Length=529

 Score = 65.9 bits (159),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K  YS+GKELGRGQFGVT+LCT       +ACK+I
Sbjct  60   VLGRPMEDVKKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTI  103


 Score = 41.6 bits (96),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED+KRE+QIM HL+GQ
Sbjct  106  RKLVNKEDIEDVKREVQIMHHLTGQ  130



>ref|XP_009592788.1| PREDICTED: calcium-dependent protein kinase 2 [Nicotiana tomentosiformis]
Length=522

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKPFED+KA+Y+LGKELGRGQFGVT+LCTEI+T   YACKSI
Sbjct  62   ILGKPFEDVKAYYTLGKELGRGQFGVTFLCTEIATGHQYACKSI  105



>emb|CDP20327.1| unnamed protein product [Coffea canephora]
Length=530

 Score = 66.6 bits (161),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+++ Y++GKELGRGQFGVT+LCT   T   +ACK+I
Sbjct  61   VLGRPMEDVRSLYTIGKELGRGQFGVTHLCTNKQTGEQFACKTI  104


 Score = 40.8 bits (94),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  107  RKLVNKEDIEDVRREVQIMHHLTGQ  131



>gb|AGG35967.1| calcium-dependent protein kinase 15, partial [Brassica napus]
Length=570

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 78/148 (53%), Gaps = 19/148 (13%)
 Frame = +1

Query  127  GCFS-KSKSRQGDVNGYRQGRGVATGYQPV-----TESHQKASSTHAQTY-----TQPER  273
            GCFS K +  Q DV      R + T            +H    +  +QT+     T+P+ 
Sbjct  2    GCFSSKHRRTQSDVVNGNVQRSIPTNQSQTHVPRDVTAHSSIPTNQSQTHVSRDATEPQI  61

Query  274  P-------YNPQPQSYA-PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGK  429
            P       +NPQ Q  + PV+ P +   V +P++P+   E   ILGKPFE IK  Y+LG 
Sbjct  62   PTTTQNHHHNPQEQQESKPVNQPIEEYQVFKPLKPIALLETETILGKPFEQIKRLYTLGH  121

Query  430  ELGRGQFGVTYLCTEISTRRAYACKSIL  513
            ELGRGQFG+TY C E ST   YACKSIL
Sbjct  122  ELGRGQFGITYTCKENSTGNTYACKSIL  149



>ref|NP_001275322.1| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ACZ26302.1| calcium dependant protein kinase [Solanum tuberosum]
Length=532

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGK FED+KAHY+LGKELGRGQFGVT+LCTEI+T   YACKSI
Sbjct  72   ILGKAFEDVKAHYTLGKELGRGQFGVTFLCTEIATGHQYACKSI  115



>ref|XP_009360846.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=543

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            N+ILGKPF DIK +Y+LGKELGRGQFG+TYLCTE ST   YACKSIL
Sbjct  81   NSILGKPFNDIKQYYTLGKELGRGQFGITYLCTENSTGHCYACKSIL  127


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 3/70 (4%)
 Frame = +2

Query  386  GSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKRE  559
            G     ++    LGK  G    G +T +      G   A +    RKLVSKND++DIKRE
Sbjct  85   GKPFNDIKQYYTLGKELGRGQFG-ITYLCTENSTGHCYACKSILKRKLVSKNDRDDIKRE  143

Query  560  IQIMQHLSGQ  589
            IQIMQHLSGQ
Sbjct  144  IQIMQHLSGQ  153



>ref|XP_006386161.1| hypothetical protein POPTR_0002s01850g [Populus trichocarpa]
 gb|ERP63958.1| hypothetical protein POPTR_0002s01850g [Populus trichocarpa]
Length=542

 Score = 72.8 bits (177),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  376  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +ILGKP+ DI   Y L KELGRGQFG+TYLCTE +T+R YACKSI
Sbjct  80   SILGKPYVDITKIYDLDKELGRGQFGITYLCTEKATQRKYACKSI  124


 Score = 34.3 bits (77),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +2

Query  518  KLVSKNDKEDIKREIQIMQHLSGQ  589
            KLV+K D ED+K EI I++HL+GQ
Sbjct  128  KLVTKKDIEDVKMEILILEHLTGQ  151



>ref|XP_010434101.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
15-like [Camelina sativa]
Length=556

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 73/136 (54%), Gaps = 8/136 (6%)
 Frame = +1

Query  127  GCFS-KSKSRQGD-VNGYRQGRGVATGYQPVTESH----QKASSTHAQTYTQPERPYNPQ  288
            GCFS K ++ + D +NG  Q        Q     +    QK  S    T TQP    N Q
Sbjct  2    GCFSSKHRNTESDLINGSVQSSIPTNQSQSYVSRNVSEPQKPPSHQIPTTTQPNH-RNQQ  60

Query  289  PQSYAPVH-VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  465
             Q   P+  V  +      P++P+   E   ILGKPFE+I+ HY+LG ELGRGQFG+TY 
Sbjct  61   QQEAKPIDKVIEEKQVRTTPLKPIVFRETETILGKPFEEIRKHYTLGHELGRGQFGITYS  120

Query  466  CTEISTRRAYACKSIL  513
            C EIST   YACKSIL
Sbjct  121  CKEISTGNVYACKSIL  136



>gb|AHN16201.1| CPK3-2.1 [Brassica napus]
Length=527

 Score = 71.2 bits (173),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP ED+KA Y  G+ELGRGQFGVTYL T   T++ +ACKSI
Sbjct  62   ILGKPMEDVKATYDFGRELGRGQFGVTYLVTHKETKKVFACKSI  105


 Score = 35.4 bits (80),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            R+LV  +D ED++RE+ IM HLSG 
Sbjct  108  RRLVQSDDIEDVRREVHIMHHLSGH  132



>ref|XP_009414250.1| PREDICTED: calcium-dependent protein kinase 29-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score = 68.2 bits (165),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG P  D+ + Y+L KELGRGQFGVTYLC E ST R YACKS+
Sbjct  57   VLGNPMVDVTSLYALDKELGRGQFGVTYLCMEKSTGRKYACKSV  100


 Score = 38.5 bits (88),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+ I+QHL+GQ
Sbjct  103  RKLVTKRDMEDMRREVLILQHLTGQ  127



>emb|CDY54853.1| BnaC01g15460D [Brassica napus]
Length=525

 Score = 71.2 bits (173),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP ED+KA Y  G+ELGRGQFGVTYL T   T++ +ACKSI
Sbjct  60   ILGKPMEDVKATYDFGRELGRGQFGVTYLVTHKETKKVFACKSI  103


 Score = 35.4 bits (80),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            R+LV  +D ED++RE+ IM HLSG 
Sbjct  106  RRLVQSDDIEDVRREVHIMHHLSGH  130



>ref|XP_010929942.1| PREDICTED: calcium-dependent protein kinase 2-like [Elaeis guineensis]
Length=544

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 76/137 (55%), Gaps = 16/137 (12%)
 Frame = +1

Query  121  MGGCFSKSKS--RQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP-  291
            MG CFSK K   R+G  NGY       + +Q  +++ Q +SS H   Y QP  P  P P 
Sbjct  1    MGHCFSKEKEPGRRGGANGY-------SSHQQESKASQTSSSYHG--YNQPRPPPPPPPP  51

Query  292  ----QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  459
                Q+     VPA   +             + +LGK FED+++ Y+LGKELGRGQFGVT
Sbjct  52   AEVRQAPPKPSVPAPAPAPASASAIAAARAADTVLGKSFEDVRSLYTLGKELGRGQFGVT  111

Query  460  YLCTEISTRRAYACKSI  510
            YLCTEI+T   YACKSI
Sbjct  112  YLCTEIATGNRYACKSI  128


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKL SKND+EDI
Sbjct  84   TVLGKSFEDVRSLYTLGKELGRGQFG-VTYLCTEIATGNRYACKSISKRKLSSKNDREDI  142

Query  551  KREIQIMQHLSGQ  589
            +RE+QIMQHL+GQ
Sbjct  143  RREVQIMQHLTGQ  155



>ref|XP_009137281.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=525

 Score = 69.7 bits (169),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP ED+K  Y LG+ELGRGQFGVT+L T   T++ +ACKSI
Sbjct  60   ILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSI  103


 Score = 37.4 bits (85),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            R+LV  +D ED++RE+QIM HLSG 
Sbjct  106  RRLVQSDDIEDVRREVQIMHHLSGH  130



>ref|XP_002268814.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=545

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P+ ILG+PF+DIK +Y+LGKELGRGQFGVTYLCT+ ST   YACKSIL
Sbjct  81   KPDTILGRPFDDIKHYYTLGKELGRGQFGVTYLCTQNSTGNTYACKSIL  129


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     ++H   LGK  G    G +T +      G   A +    RKLV+KNDKEDI
Sbjct  84   TILGRPFDDIKHYYTLGKELGRGQFG-VTYLCTQNSTGNTYACKSILKRKLVTKNDKEDI  142

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHL+GQ
Sbjct  143  KREIQIMQHLTGQ  155



>gb|AGG35973.1| calcium-dependent protein kinase 3, partial [Brassica napus]
Length=525

 Score = 69.3 bits (168),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP ED+K  Y LG+ELGRGQFGVT+L T   T++ +ACKSI
Sbjct  60   ILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSI  103


 Score = 37.4 bits (85),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            R+LV  +D ED++RE+QIM HLSG 
Sbjct  106  RRLVQSDDIEDVRREVQIMHHLSGH  130



>emb|CDY44125.1| BnaA01g13330D [Brassica napus]
Length=525

 Score = 69.7 bits (169),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP ED+K  Y LG+ELGRGQFGVT+L T   T++ +ACKSI
Sbjct  60   ILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSI  103


 Score = 37.4 bits (85),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            R+LV  +D ED++RE+QIM HLSG 
Sbjct  106  RRLVQSDDIEDVRREVQIMHHLSGH  130



>ref|XP_002276630.2| PREDICTED: calcium-dependent protein kinase 34-like [Vitis vinifera]
Length=534

 Score = 65.9 bits (159),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED++  Y++GKELGRGQFGVT+LCT  +T   +ACK+I
Sbjct  68   VLGRPMEDVRTLYTIGKELGRGQFGVTHLCTSKATGEQFACKTI  111


 Score = 40.8 bits (94),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  114  RKLVNKEDIEDVRREVQIMHHLTGQ  138



>ref|XP_010031714.1| PREDICTED: calcium-dependent protein kinase 34-like [Eucalyptus 
grandis]
 gb|KCW51080.1| hypothetical protein EUGRSUZ_J00686 [Eucalyptus grandis]
Length=534

 Score = 65.9 bits (159),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P E++K+ Y++GKELGRGQFGVT+LCT   T + +ACK+I
Sbjct  68   VLGRPMEEVKSMYTIGKELGRGQFGVTHLCTHKQTGQQFACKTI  111


 Score = 40.8 bits (94),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  114  RKLVNKEDIEDVRREVQIMYHLTGQ  138



>sp|Q9ZSA3.2|CDPKM_ARATH RecName: Full=Calcium-dependent protein kinase 22 [Arabidopsis 
thaliana]
Length=498

 Score = 73.6 bits (179),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP EDIK HYS G ELG+G FG TYLC E ST ++YACKSI
Sbjct  24   ILGKPLEDIKKHYSFGDELGKGNFGTTYLCKENSTGKSYACKSI  67


 Score = 33.1 bits (74),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            R L S+ +KE +K EIQIM H+SGQ
Sbjct  70   RTLSSEEEKEAVKTEIQIMDHVSGQ  94



>emb|CAN62888.1| hypothetical protein VITISV_025544 [Vitis vinifera]
Length=540

 Score = 65.5 bits (158),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED++  Y++GKELGRGQFGVT+LCT  +T   +ACK+I
Sbjct  68   VLGRPMEDVRTLYTIGKELGRGQFGVTHLCTSKATGEQFACKTI  111


 Score = 40.8 bits (94),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+QIM HL+GQ
Sbjct  114  RKLVNKEDIEDVRREVQIMHHLTGQ  138



>emb|CDP07348.1| unnamed protein product [Coffea canephora]
Length=534

 Score = 68.9 bits (167),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP  DI A Y L KELGRGQFG+TYLCTE +T   YACKSI
Sbjct  72   ILGKPCVDINAFYDLDKELGRGQFGITYLCTEKATGLKYACKSI  115


 Score = 37.4 bits (85),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +2

Query  518  KLVSKNDKEDIKREIQIMQHLSGQ  589
            KL +  D ED++REI IMQHLSGQ
Sbjct  119  KLATPKDIEDVRREISIMQHLSGQ  142



>ref|XP_008387908.1| PREDICTED: calcium-dependent protein kinase 29 [Malus domestica]
Length=527

 Score = 73.9 bits (180),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 71/130 (55%), Gaps = 19/130 (15%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF+K +S   D+        +++   P   +H K++ TH      P +P   +P  Y
Sbjct  1    MGLCFTKCQSH--DI-------PISSSDSPPHRTHPKSNRTH-----DPYKPAPSKPNPY  46

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
            +P +     SS     R     +   ILGKP+ ++ + Y+L KELGRGQFGVTYLCTE +
Sbjct  47   SPAY-----SSGTSFGRTHSSFQIGPILGKPYFNVNSLYTLDKELGRGQFGVTYLCTEKT  101

Query  481  TRRAYACKSI  510
            T + YACKSI
Sbjct  102  TGKKYACKSI  111


 Score = 32.7 bits (73),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +2

Query  518  KLVSKNDKEDIKREIQIMQHLSGQ  589
            KL +  D ED++REI I QHL+GQ
Sbjct  115  KLSTTKDIEDVRREIMIQQHLTGQ  138



>gb|ABC59620.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +1

Query  121  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQTPPSYNNAQ----PPP  43

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            Q+      PA    V  PV    +P P+ ILGK ++D+++ YSLGKELGRGQFGVTYLCT
Sbjct  44   QAEVWYTPPAMNPPVVPPVVAPSKPMPDTILGKQYQDVRSVYSLGKELGRGQFGVTYLCT  103

Query  472  EISTRRAYACKSI  510
            EIST R YACKSI
Sbjct  104  EISTGRQYACKSI  116


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G   + +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  72   TILGKQYQDVRSVYSLGKELGRGQFG-VTYLCTEISTGRQYACKSISKRKLVSKADKEDI  130

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  131  RREIQIMQHLSGQ  143



>gb|AIU98504.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=511

 Score = 67.8 bits (164),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG P  D+ + Y+L KELGRGQFGVTYLC E ST R YACKS+
Sbjct  57   VLGNPMVDVTSLYALDKELGRGQFGVTYLCMEKSTGRKYACKSV  100


 Score = 38.9 bits (89),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+K D ED++RE+ I+QHL+GQ
Sbjct  103  RKLVTKRDMEDMRREVLILQHLTGQ  127



>ref|XP_008463413.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis melo]
Length=519

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 68/135 (50%), Gaps = 35/135 (26%)
 Frame = +1

Query  121  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQ---TYTQPERPYNPQ  288
            MG C SK K SRQ D   Y Q        QP      KA + HA     Y QP       
Sbjct  1    MGICTSKGKYSRQYD--RYEQ--------QP------KAPAQHAHRSPEYHQPAAAAKSS  44

Query  289  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  468
                +P H P +                + ILGKP ED+K HY++GKELGRGQFGVTYLC
Sbjct  45   GPPKSPKHTPFRS---------------DTILGKPLEDVKLHYTIGKELGRGQFGVTYLC  89

Query  469  TEISTRRAYACKSIL  513
            TE S+ + YACKSIL
Sbjct  90   TENSSGKQYACKSIL  104


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 51/109 (47%), Gaps = 10/109 (9%)
 Frame = +2

Query  269  KGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNWGGAS  448
            + P  H P+   +S     P + P       D    T  G  L  ++    +GK  G   
Sbjct  30   RSPEYHQPAAAAKS---SGPPKSPKHTPFRSD----TILGKPLEDVKLHYTIGKELGRGQ  82

Query  449  LG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDIKREIQIMQHLSGQ  589
             G +T +      G   A +    RKLV++NDKEDI+REI IMQHLSGQ
Sbjct  83   FG-VTYLCTENSSGKQYACKSILKRKLVTRNDKEDIRREIHIMQHLSGQ  130



>gb|KJB69279.1| hypothetical protein B456_011G014200 [Gossypium raimondii]
Length=551

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 58/103 (56%), Gaps = 12/103 (12%)
 Frame = +1

Query  205  QPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNIL  384
            QP     QK S   AQ       P   QPQ+   V VP KPS+             + +L
Sbjct  36   QPQQVQTQKVSVPEAQV------PQTRQPQA---VSVPLKPSAASTRPIQTME---DTVL  83

Query  385  GKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            GKP EDIK +Y LGKELGRGQFG+TYLCTE ST   YACKSIL
Sbjct  84   GKPLEDIKQYYKLGKELGRGQFGITYLCTENSTGNTYACKSIL  126



>ref|XP_006473712.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X1 
[Citrus sinensis]
 gb|KDO84958.1| hypothetical protein CISIN_1g010263mg [Citrus sinensis]
Length=514

 Score = 69.7 bits (169),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 61/130 (47%), Gaps = 26/130 (20%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF++S+S   D+              P++ S  ++          P   Y P P+  
Sbjct  1    MGLCFTRSRSH--DI--------------PISSSSDES----------PHHRYQPLPRRT  34

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                 P          +  Q  +   ILGKP+ DI   Y L KELGRGQFGVTYLCT+ +
Sbjct  35   QQDFRPTSSRPPALSKQIPQTSQIGPILGKPYVDITTIYDLDKELGRGQFGVTYLCTKKA  94

Query  481  TRRAYACKSI  510
            T R YACKSI
Sbjct  95   TGRKYACKSI  104


 Score = 37.0 bits (84),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV   D ED++REI I+QHL+GQ
Sbjct  107  RKLVYDKDMEDVRREILILQHLTGQ  131



>ref|XP_008786936.1| PREDICTED: calcium-dependent protein kinase 34-like [Phoenix 
dactylifera]
Length=514

 Score = 68.2 bits (165),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+KA YS+GKELGRGQFGVT+LCT   T   +ACK+I
Sbjct  48   VLGRPMEDVKATYSMGKELGRGQFGVTHLCTHKLTGEQFACKTI  91


 Score = 38.1 bits (87),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL +K D ED++RE++IM HLSGQ
Sbjct  94   RKLANKEDIEDVRREVRIMYHLSGQ  118



>ref|XP_006435253.1| hypothetical protein CICLE_v10000897mg [Citrus clementina]
 gb|ESR48493.1| hypothetical protein CICLE_v10000897mg [Citrus clementina]
Length=514

 Score = 69.7 bits (169),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 61/130 (47%), Gaps = 26/130 (20%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF++S+S   D+              P++ S  ++          P   Y P P+  
Sbjct  1    MGLCFTRSRSH--DI--------------PISSSSDES----------PHHRYQPLPRRT  34

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                 P          +  Q  +   ILGKP+ DI   Y L KELGRGQFGVTYLCT+ +
Sbjct  35   QQDFRPTSSRPPALSKQIPQTSQIGPILGKPYVDITTIYDLDKELGRGQFGVTYLCTKKA  94

Query  481  TRRAYACKSI  510
            T R YACKSI
Sbjct  95   TGRKYACKSI  104


 Score = 37.0 bits (84),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV   D ED++REI I+QHL+GQ
Sbjct  107  RKLVYDKDMEDVRREILILQHLTGQ  131



>ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
 gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
Length=544

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 65/134 (49%), Gaps = 12/134 (9%)
 Frame = +1

Query  127  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  291
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  292  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  471
            +  AP   P +               P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQMPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  472  EISTRRAYACKSIL  513
            E ST   YACKSIL
Sbjct  115  ENSTGNTYACKSIL  128


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G  L  +R    LGK  G    G +T +      G   A +    RKLV+K D+EDI
Sbjct  83   TVLGKPLEDIRQFYTLGKELGRGQFG-ITYLCTENSTGNTYACKSILKRKLVNKQDREDI  141

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQHLSGQ
Sbjct  142  KREIQIMQHLSGQ  154



>ref|XP_003563028.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Brachypodium 
distachyon]
Length=532

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCTEI+T R YACKSI
Sbjct  69   PDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEIATGRQYACKSI  115


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKLVSK DKEDI
Sbjct  71   TILGKQYEDVRSVYSLGKELGRGQFG-VTYLCTEIATGRQYACKSISKRKLVSKADKEDI  129

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQHLSGQ
Sbjct  130  RREIQIMQHLSGQ  142



>ref|XP_006473713.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X2 
[Citrus sinensis]
Length=466

 Score = 69.7 bits (169),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+ DI   Y L KELGRGQFGVTYLCT+ +T R YACKSI
Sbjct  61   ILGKPYVDITTIYDLDKELGRGQFGVTYLCTKKATGRKYACKSI  104


 Score = 37.0 bits (84),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV   D ED++REI I+QHL+GQ
Sbjct  107  RKLVYDKDMEDVRREILILQHLTGQ  131



>gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=554

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            NNILGKPFEDI+  Y+LGKELGRGQFGVTY CTE ST   YACKSIL
Sbjct  96   NNILGKPFEDIRKLYTLGKELGRGQFGVTYYCTENSTGNPYACKSIL  142


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 37/70 (53%), Gaps = 3/70 (4%)
 Frame = +2

Query  386  GSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVG--LMLASRF*RKLVSKNDKEDIKRE  559
            G     +R    LGK  G    G +T        G      S   RKLVSKND+ED+KRE
Sbjct  100  GKPFEDIRKLYTLGKELGRGQFG-VTYYCTENSTGNPYACKSILKRKLVSKNDREDMKRE  158

Query  560  IQIMQHLSGQ  589
            IQIMQHLSGQ
Sbjct  159  IQIMQHLSGQ  168



>emb|CDY24863.1| BnaA03g59670D [Brassica napus]
Length=543

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 61/109 (56%), Gaps = 14/109 (13%)
 Frame = +1

Query  187  GVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrp  366
            G +T  QP+ +  Q A   + Q   QP +   P P S+                +     
Sbjct  30   GESTKKQPLRQ-RQTAPRANIQIVVQPHKLPLPVPISHP-------------QEQQKLMH  75

Query  367  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            +P  I GKPFED+K  YSLG+ELGRGQFG+TYLCTEIS+ + +ACKSIL
Sbjct  76   QPEPISGKPFEDVKETYSLGRELGRGQFGITYLCTEISSGKNFACKSIL  124



>emb|CDX82886.1| BnaC01g13360D [Brassica napus]
Length=557

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 73/136 (54%), Gaps = 10/136 (7%)
 Frame = +1

Query  127  GCFS-KSKSRQGDVNGYRQGRGVATGYQPV-----TESHQKASSTHAQTYTQPERPYNPQ  288
            GCFS K +  Q DV      R + T            +H    +  +QT+      +NPQ
Sbjct  2    GCFSSKHRRTQSDVVNGNVQRSIPTNQSQTHVPRDVTAHSSIPTNQSQTHNHH---HNPQ  58

Query  289  PQSYA-PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  465
             Q  + PV+ P +   V +P++P+   E   ILGKPFE IK  Y+LG ELGRGQFG+TY 
Sbjct  59   EQQESKPVNQPIEEYQVFKPLKPIALLETETILGKPFEQIKRLYTLGHELGRGQFGITYT  118

Query  466  CTEISTRRAYACKSIL  513
            C E ST   YACKSIL
Sbjct  119  CKENSTGNTYACKSIL  134



>gb|KDO84959.1| hypothetical protein CISIN_1g010263mg [Citrus sinensis]
Length=366

 Score = 68.9 bits (167),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 61/130 (47%), Gaps = 26/130 (20%)
 Frame = +1

Query  121  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  300
            MG CF++S+S   D+              P++ S  ++          P   Y P P+  
Sbjct  1    MGLCFTRSRSH--DI--------------PISSSSDES----------PHHRYQPLPRRT  34

Query  301  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  480
                 P          +  Q  +   ILGKP+ DI   Y L KELGRGQFGVTYLCT+ +
Sbjct  35   QQDFRPTSSRPPALSKQIPQTSQIGPILGKPYVDITTIYDLDKELGRGQFGVTYLCTKKA  94

Query  481  TRRAYACKSI  510
            T R YACKSI
Sbjct  95   TGRKYACKSI  104


 Score = 37.0 bits (84),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV   D ED++REI I+QHL+GQ
Sbjct  107  RKLVYDKDMEDVRREILILQHLTGQ  131



>ref|XP_009412989.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=523

 Score = 67.0 bits (162),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+ A YSLGKELGRGQFGVT+LCT  +T    ACK+I
Sbjct  57   VLGRPMEDVGATYSLGKELGRGQFGVTHLCTHKATDEKLACKTI  100


 Score = 39.3 bits (90),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL +K D ED++RE+QIM HL+GQ
Sbjct  103  RKLANKEDIEDVRREVQIMYHLAGQ  127



>emb|CDX91224.1| BnaC02g26350D [Brassica napus]
Length=434

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            + ILGKPFEDI+  YSLGKELGRGQFG+TY C EIST   YACKSIL
Sbjct  60   DTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSIL  106


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T   R    G   A +    RKL+SK DKED+
Sbjct  61   TILGKPFEDIRKFYSLGKELGRGQFG-ITYRCREISTGNTYACKSILKRKLISKQDKEDV  119

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQ+LSGQ
Sbjct  120  KREIQIMQYLSGQ  132



>gb|KHG10851.1| Calcium-dependent protein kinase 21 [Gossypium arboreum]
Length=552

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +1

Query  205  QPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNIL  384
             P T   Q+   T   +  + + P   QPQ+   V VP KPS              + +L
Sbjct  31   MPQTRRPQQQVQTQKVSVPEAQVPQTRQPQA---VSVPLKPSPASTRPIQTME---DTVL  84

Query  385  GKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            GKP EDIK +Y LGKELGRGQFG+TYLCTE ST   YACKSIL
Sbjct  85   GKPLEDIKQYYKLGKELGRGQFGITYLCTENSTGNTYACKSIL  127



>gb|KJB31959.1| hypothetical protein B456_005G216500 [Gossypium raimondii]
 gb|KJB31962.1| hypothetical protein B456_005G216500 [Gossypium raimondii]
Length=543

 Score = 66.6 bits (161),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 58/116 (50%), Gaps = 8/116 (7%)
 Frame = +1

Query  166  NGYRQGRGV-ATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpq  342
            N    GR   AT Y P T + Q       Q   Q       Q +++ PV  P K  +   
Sbjct  28   NNTSSGRSTTATDYSPSTLNSQ-------QLIAQEFSKETNQKETHLPVINPTKKDNNNN  80

Query  343  pvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
             +R     +   +LG    +I+  Y+LG++LG+GQFG TYLCTEIST   YACKSI
Sbjct  81   TMRRGIDHQAYYVLGHKTTNIRDLYTLGRKLGQGQFGTTYLCTEISTGTEYACKSI  136


 Score = 38.9 bits (89),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+S  D ED++REIQIM HL+G 
Sbjct  139  RKLISNEDVEDVRREIQIMHHLAGH  163



>gb|KJB31957.1| hypothetical protein B456_005G216500 [Gossypium raimondii]
 gb|KJB31958.1| hypothetical protein B456_005G216500 [Gossypium raimondii]
 gb|KJB31961.1| hypothetical protein B456_005G216500 [Gossypium raimondii]
Length=568

 Score = 67.0 bits (162),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 58/116 (50%), Gaps = 8/116 (7%)
 Frame = +1

Query  166  NGYRQGRGV-ATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpq  342
            N    GR   AT Y P T + Q       Q   Q       Q +++ PV  P K  +   
Sbjct  28   NNTSSGRSTTATDYSPSTLNSQ-------QLIAQEFSKETNQKETHLPVINPTKKDNNNN  80

Query  343  pvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
             +R     +   +LG    +I+  Y+LG++LG+GQFG TYLCTEIST   YACKSI
Sbjct  81   TMRRGIDHQAYYVLGHKTTNIRDLYTLGRKLGQGQFGTTYLCTEISTGTEYACKSI  136


 Score = 38.9 bits (89),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+S  D ED++REIQIM HL+G 
Sbjct  139  RKLISNEDVEDVRREIQIMHHLAGH  163



>ref|XP_002510594.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF52781.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=529

 Score = 68.6 bits (166),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+ DI + Y L KELGRGQFG+TYLCTE +T   YACKSI
Sbjct  69   ILGKPYVDIASIYDLDKELGRGQFGITYLCTEKTTGLKYACKSI  112


 Score = 37.4 bits (85),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+  D ED++REI I+QHL+GQ
Sbjct  115  RKLVNDKDVEDVRREILILQHLTGQ  139



>gb|KJB31960.1| hypothetical protein B456_005G216500 [Gossypium raimondii]
Length=542

 Score = 66.6 bits (161),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 58/116 (50%), Gaps = 8/116 (7%)
 Frame = +1

Query  166  NGYRQGRGV-ATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpq  342
            N    GR   AT Y P T + Q       Q   Q       Q +++ PV  P K  +   
Sbjct  28   NNTSSGRSTTATDYSPSTLNSQ-------QLIAQEFSKETNQKETHLPVINPTKKDNNNN  80

Query  343  pvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
             +R     +   +LG    +I+  Y+LG++LG+GQFG TYLCTEIST   YACKSI
Sbjct  81   TMRRGIDHQAYYVLGHKTTNIRDLYTLGRKLGQGQFGTTYLCTEISTGTEYACKSI  136


 Score = 38.9 bits (89),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL+S  D ED++REIQIM HL+G 
Sbjct  139  RKLISNEDVEDVRREIQIMHHLAGH  163



>gb|EMS56466.1| Calcium-dependent protein kinase 34 [Triticum urartu]
Length=554

 Score = 65.5 bits (158),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LG+P ED+K+ Y++GKELGRGQFGVT LCT+ +T +  ACK+I
Sbjct  49   VLGRPMEDVKSIYNVGKELGRGQFGVTSLCTQKATGQKLACKTI  92


 Score = 40.4 bits (93),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKL +K D ED++RE+QIM HLSGQ
Sbjct  133  RKLANKEDVEDVRREVQIMYHLSGQ  157



>ref|XP_010266896.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X2 
[Nelumbo nucifera]
Length=530

 Score = 65.9 bits (159),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LGK   D+ + Y L  ELGRGQFG+TYLCTE +TRR YACKSI
Sbjct  69   VLGKLTCDLSSTYDLDNELGRGQFGITYLCTEKATRRKYACKSI  112


 Score = 39.7 bits (91),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D ED++RE+ ++QHL+GQ
Sbjct  115  RKLVSKKDIEDVQREVAVLQHLTGQ  139



>ref|XP_002278179.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=536

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            P+ ILGK FED+K HY++GKELGRGQFGVTYLCTE ST   YACKSI
Sbjct  73   PDTILGKSFEDVKLHYTIGKELGRGQFGVTYLCTENSTGLQYACKSI  119


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     ++    +GK  G    G +T +      GL  A +    RKLV+KNDKEDI
Sbjct  75   TILGKSFEDVKLHYTIGKELGRGQFG-VTYLCTENSTGLQYACKSISKRKLVTKNDKEDI  133

Query  551  KREIQIMQHLSGQ  589
            +REIQIMQ LSGQ
Sbjct  134  RREIQIMQDLSGQ  146



>ref|XP_010923910.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Elaeis guineensis]
Length=503

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  370  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            P+ ILGK FED+++ Y+LGKELGRGQFGVTYLCTE++T + YACKSI
Sbjct  88   PDTILGKAFEDVRSFYTLGKELGRGQFGVTYLCTEMATGKRYACKSI  134


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASRF*--RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T +      G   A +    RKL S ND+EDI
Sbjct  90   TILGKAFEDVRSFYTLGKELGRGQFG-VTYLCTEMATGKRYACKSISKRKLSSANDREDI  148

Query  551  KREIQIMQHLSGQ  589
            +RE+QIMQHL+GQ
Sbjct  149  RREVQIMQHLTGQ  161



>gb|AGG35970.1| calcium-dependent protein kinase 21 [Brassica napus]
Length=525

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  373  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSIL  513
            + ILGKPFEDI+  YSLGKELGRGQFG+TY C EIST   YACKSIL
Sbjct  60   DTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSIL  106


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query  377  TYWGSLLRTLRHTTVLGKNWGGASLG*LTCVLRFPPVGLMLASR--F*RKLVSKNDKEDI  550
            T  G     +R    LGK  G    G +T   R    G   A +    RKL+SK DKED+
Sbjct  61   TILGKPFEDIRKFYSLGKELGRGQFG-ITYRCREISTGNTYACKSILKRKLISKQDKEDV  119

Query  551  KREIQIMQHLSGQ  589
            KREIQIMQ+LSGQ
Sbjct  120  KREIQIMQYLSGQ  132



>ref|XP_010266895.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X1 
[Nelumbo nucifera]
Length=538

 Score = 65.9 bits (159),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            +LGK   D+ + Y L  ELGRGQFG+TYLCTE +TRR YACKSI
Sbjct  69   VLGKLTCDLSSTYDLDNELGRGQFGITYLCTEKATRRKYACKSI  112


 Score = 39.7 bits (91),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLVSK D ED++RE+ ++QHL+GQ
Sbjct  115  RKLVSKKDIEDVQREVAVLQHLTGQ  139



>ref|XP_011459094.1| PREDICTED: calcium-dependent protein kinase 29 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=485

 Score = 69.7 bits (169),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+ D+ + Y+L KELGRGQFGVT LCTE ST R YACKSI
Sbjct  66   ILGKPYSDVNSVYTLEKELGRGQFGVTRLCTEKSTGRKYACKSI  109


 Score = 35.8 bits (81),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+  D ED++REI I++HL+GQ
Sbjct  112  RKLVTNKDIEDLRREILILEHLTGQ  136



>ref|XP_004291330.1| PREDICTED: calcium-dependent protein kinase 29 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=533

 Score = 69.3 bits (168),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+ D+ + Y+L KELGRGQFGVT LCTE ST R YACKSI
Sbjct  66   ILGKPYSDVNSVYTLEKELGRGQFGVTRLCTEKSTGRKYACKSI  109


 Score = 36.2 bits (82),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV+  D ED++REI I++HL+GQ
Sbjct  112  RKLVTNKDIEDLRREILILEHLTGQ  136



>ref|XP_004238385.1| PREDICTED: calcium-dependent protein kinase 29 [Solanum lycopersicum]
Length=521

 Score = 68.2 bits (165),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  379  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSI  510
            ILGKP+ DIK  Y L KELGRGQFG+TYLC++ S+   YACKSI
Sbjct  61   ILGKPYVDIKTLYDLDKELGRGQFGITYLCSDKSSGLKYACKSI  104


 Score = 37.4 bits (85),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  515  RKLVSKNDKEDIKREIQIMQHLSGQ  589
            RKLV++ D ED++RE+ I+Q+LSGQ
Sbjct  107  RKLVTQKDIEDVRREVTILQYLSGQ  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925