BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051C07

Length=541
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602682.1|  PREDICTED: pollen-specific protein SF3-like        221   9e-70   Nicotiana tomentosiformis
gb|KHG27160.1|  Pollen-specific SF3                                     218   3e-68   Gossypium arboreum [tree cotton]
ref|XP_008392904.1|  PREDICTED: pollen-specific protein SF3-like ...    218   3e-68   Malus domestica [apple tree]
ref|XP_006435557.1|  hypothetical protein CICLE_v10032838mg             217   4e-68   Citrus clementina [clementine]
ref|XP_007009106.1|  GATA type zinc finger transcription factor f...    217   5e-68   Theobroma cacao [chocolate]
ref|XP_007218461.1|  hypothetical protein PRUPE_ppa011869mg             217   5e-68   Prunus persica
ref|XP_009344420.1|  PREDICTED: pollen-specific protein SF3-like        217   6e-68   Pyrus x bretschneideri [bai li]
ref|XP_008381875.1|  PREDICTED: pollen-specific protein SF3-like        217   6e-68   Malus domestica [apple tree]
gb|KJB78800.1|  hypothetical protein B456_013G019800                    217   6e-68   Gossypium raimondii
gb|KDP44835.1|  hypothetical protein JCGZ_01335                         217   6e-68   Jatropha curcas
ref|XP_004138434.1|  PREDICTED: pollen-specific protein SF3-like        217   7e-68   Cucumis sativus [cucumbers]
ref|XP_009587504.1|  PREDICTED: pollen-specific protein SF3-like        217   7e-68   Nicotiana tomentosiformis
ref|XP_009772727.1|  PREDICTED: pollen-specific protein SF3-like        214   9e-68   Nicotiana sylvestris
gb|ACX47456.1|  LIM1                                                    214   4e-67   Hevea brasiliensis [jebe]
ref|XP_004307607.1|  PREDICTED: LIM domain-containing protein WLIM2b    215   4e-67   Fragaria vesca subsp. vesca
ref|XP_002279922.1|  PREDICTED: LIM domain-containing protein WLIM2b    214   5e-67   Vitis vinifera
ref|XP_011076748.1|  PREDICTED: LIM domain-containing protein WLIM2b    214   7e-67   Sesamum indicum [beniseed]
ref|XP_002530411.1|  Pollen-specific protein SF3, putative              214   7e-67   Ricinus communis
gb|KJB67594.1|  hypothetical protein B456_010G199200                    213   1e-66   Gossypium raimondii
gb|KHG07853.1|  Pollen-specific SF3                                     213   1e-66   Gossypium arboreum [tree cotton]
ref|XP_008392902.1|  PREDICTED: pollen-specific protein SF3-like ...    213   2e-66   Malus domestica [apple tree]
ref|XP_002315180.1|  LIM domain-containing family protein               213   2e-66   Populus trichocarpa [western balsam poplar]
gb|AGJ83945.1|  lim protein 5                                           213   2e-66   Gossypium hirsutum [American cotton]
gb|ABK58469.1|  LIM domain protein WLIM2a                               212   6e-66   Populus tremula x Populus alba [gray poplar]
ref|XP_010093495.1|  Pollen-specific protein SF3                        211   1e-65   Morus notabilis
ref|XP_002312139.1|  LIM domain-containing family protein               210   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_011040324.1|  PREDICTED: LIM domain-containing protein WLI...    210   3e-65   Populus euphratica
ref|XP_010067487.1|  PREDICTED: pollen-specific protein SF3             209   5e-65   Eucalyptus grandis [rose gum]
ref|XP_004239928.1|  PREDICTED: LIM domain-containing protein WLI...    209   5e-65   Solanum lycopersicum
ref|NP_001241110.1|  uncharacterized protein LOC100809121               209   6e-65   Glycine max [soybeans]
gb|ABK94608.1|  unknown                                                 208   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_004167859.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    208   2e-64   
ref|XP_007163504.1|  hypothetical protein PHAVU_001G239700g             208   2e-64   Phaseolus vulgaris [French bean]
ref|XP_007009108.1|  GATA type zinc finger transcription factor f...    207   4e-64   
gb|KHN17859.1|  Pollen-specific protein SF3                             207   7e-64   Glycine soja [wild soybean]
ref|XP_003538442.1|  PREDICTED: pollen-specific protein SF3-like ...    207   8e-64   
gb|AAL38006.1|AF443117_1  LIM domain protein                            205   2e-63   Gossypium hirsutum [American cotton]
ref|XP_007009110.1|  GATA type zinc finger transcription factor f...    205   2e-63   
ref|XP_004150238.1|  PREDICTED: pollen-specific protein SF3-like ...    205   2e-63   Cucumis sativus [cucumbers]
gb|AFK39062.1|  unknown                                                 205   3e-63   Lotus japonicus
ref|XP_008463203.1|  PREDICTED: pollen-specific protein SF3-like        204   5e-63   Cucumis melo [Oriental melon]
ref|XP_004503222.1|  PREDICTED: pollen-specific protein SF3-like ...    203   1e-62   
gb|ACU17588.1|  unknown                                                 201   1e-62   Glycine max [soybeans]
ref|XP_007009107.1|  GATA type zinc finger transcription factor f...    203   2e-62   
ref|XP_010256708.1|  PREDICTED: LIM domain-containing protein WLI...    202   4e-62   Nelumbo nucifera [Indian lotus]
ref|XP_003544136.1|  PREDICTED: pollen-specific protein SF3 isofo...    201   6e-62   Glycine max [soybeans]
ref|NP_001154680.1|  actin bundler LIM family protein WLIM2b            198   1e-61   
gb|KJB74201.1|  hypothetical protein B456_011G279100                    200   2e-61   Gossypium raimondii
gb|AGJ83942.1|  lim protein 2                                           200   2e-61   Gossypium hirsutum [American cotton]
ref|XP_010554627.1|  PREDICTED: LIM domain-containing protein WLIM2b    200   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_003600847.1|  LIM domain-containing protein                      200   3e-61   Medicago truncatula
gb|AFK34184.1|  unknown                                                 199   4e-61   Medicago truncatula
emb|CDP14069.1|  unnamed protein product                                200   8e-61   Coffea canephora [robusta coffee]
emb|CAA62744.1|  transcription factor L2                                198   8e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928941.1|  PREDICTED: LIM domain-containing protein WLI...    197   2e-60   Elaeis guineensis
ref|XP_006848064.1|  hypothetical protein AMTR_s00029p00199510          197   2e-60   
ref|NP_191136.1|  actin bundler LIM family protein WLIM2b               197   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403418.1|  hypothetical protein EUTSA_v10010740mg             197   3e-60   Eutrema salsugineum [saltwater cress]
ref|XP_002876333.1|  LIM domain-containing protein                      197   5e-60   Arabidopsis lyrata subsp. lyrata
gb|EYU19976.1|  hypothetical protein MIMGU_mgv1a014151mg                197   5e-60   Erythranthe guttata [common monkey flower]
ref|XP_010534537.1|  PREDICTED: LIM domain-containing protein WLI...    196   7e-60   Tarenaya hassleriana [spider flower]
ref|XP_009118149.1|  PREDICTED: pollen-specific protein SF3-like        193   1e-59   Brassica rapa
ref|NP_001190099.1|  actin bundler LIM family protein WLIM2b            197   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798954.1|  PREDICTED: pollen-specific protein SF3-like        195   3e-59   Phoenix dactylifera
dbj|BAH20111.1|  AT3G55770                                              195   3e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24943.1|  BnaC03g22290D                                          194   7e-59   Brassica napus [oilseed rape]
emb|CDY60999.1|  BnaA03g56620D                                          194   7e-59   Brassica napus [oilseed rape]
ref|XP_009133391.1|  PREDICTED: pollen-specific protein SF3-like        194   8e-59   Brassica rapa
emb|CDY20498.1|  BnaC04g05460D                                          194   1e-58   Brassica napus [oilseed rape]
ref|XP_009143273.1|  PREDICTED: pollen-specific protein SF3             193   1e-58   Brassica rapa
ref|XP_009139138.1|  PREDICTED: pollen-specific protein SF3-like        193   2e-58   Brassica rapa
ref|XP_006295906.1|  hypothetical protein CARUB_v10025036mg             192   3e-58   Capsella rubella
emb|CDY02959.1|  BnaC04g25270D                                          194   3e-58   
emb|CDX76073.1|  BnaA04g03370D                                          194   4e-58   
ref|XP_010516165.1|  PREDICTED: LIM domain-containing protein WLI...    192   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010427370.1|  PREDICTED: LIM domain-containing protein WLIM2b    192   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002879831.1|  LIM domain-containing protein                      192   5e-58   
gb|EPS58831.1|  hypothetical protein M569_15983                         191   7e-58   Genlisea aurea
ref|XP_006411232.1|  hypothetical protein EUTSA_v10017249mg             191   1e-57   
ref|XP_010517368.1|  PREDICTED: LIM domain-containing protein WLIM2a    191   1e-57   
ref|XP_010508950.1|  PREDICTED: LIM domain-containing protein WLI...    191   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008785448.1|  PREDICTED: pollen-specific protein SF3-like        190   1e-57   Phoenix dactylifera
ref|XP_009404566.1|  PREDICTED: pollen-specific protein SF3-like        189   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010504446.1|  PREDICTED: LIM domain-containing protein WLI...    190   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010505685.1|  PREDICTED: LIM domain-containing protein WLI...    190   4e-57   Camelina sativa [gold-of-pleasure]
ref|NP_181519.1|  protein WLIM2A                                        189   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116276.1|  PREDICTED: pollen-specific protein SF3             189   1e-56   Brassica rapa
emb|CDX72203.1|  BnaC08g26710D                                          189   1e-56   
emb|CDY27267.1|  BnaA09g35350D                                          189   1e-56   Brassica napus [oilseed rape]
ref|XP_010923152.1|  PREDICTED: LIM domain-containing protein WLI...    188   1e-56   Elaeis guineensis
gb|ABK22125.1|  unknown                                                 188   1e-56   Picea sitchensis
ref|XP_009421306.1|  PREDICTED: pollen-specific protein SF3-like        186   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO36535.1|  hypothetical protein CISIN_1g034188mg                   181   6e-55   Citrus sinensis [apfelsine]
emb|CBL95262.1|  lim domain protein                                     182   3e-54   Pinus pinaster [cluster pine]
ref|XP_006431569.1|  hypothetical protein CICLE_v10003359mg             178   5e-53   
gb|KHN13088.1|  Pollen-specific protein SF3                             176   6e-53   Glycine soja [wild soybean]
ref|XP_006431570.1|  hypothetical protein CICLE_v10003747mg             176   2e-52   
gb|KDO39245.1|  hypothetical protein CISIN_1g040725mg                   176   3e-52   Citrus sinensis [apfelsine]
emb|CBI40313.3|  unnamed protein product                                177   3e-52   Vitis vinifera
ref|XP_006827708.1|  hypothetical protein AMTR_s00009p00259550          176   5e-52   Amborella trichopoda
ref|XP_006438563.1|  hypothetical protein CICLE_v10033840mg             175   6e-52   
ref|XP_002269537.1|  PREDICTED: LIM domain-containing protein PLIM2c    177   8e-52   Vitis vinifera
ref|NP_001049655.1|  Os03g0266100                                       175   2e-51   
dbj|BAM13338.1|  LIM domain-containing protein                          175   2e-51   Oryza punctata
dbj|BAM13339.1|  LIM domain-containing protein                          175   2e-51   Oryza officinalis
dbj|BAM13335.1|  LIM domain-containing protein                          174   3e-51   Oryza sativa f. spontanea
dbj|BAM13341.1|  LIM domain-containing protein                          173   1e-50   Oryza australiensis
dbj|BAM13340.1|  LIM domain-containing protein                          173   1e-50   Oryza latifolia
ref|XP_006649807.1|  PREDICTED: pollen-specific protein SF3-like        172   1e-50   Oryza brachyantha
ref|XP_010690195.1|  PREDICTED: LIM domain-containing protein WLIM2b    171   6e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006291888.1|  hypothetical protein CARUB_v10018065mg             168   6e-49   
ref|XP_006423310.1|  hypothetical protein CICLE_v10030332mg             164   2e-48   
ref|XP_006339787.1|  PREDICTED: pollen-specific protein SF3-like        168   2e-48   Solanum tuberosum [potatoes]
tpg|DAA44554.1|  TPA: putative LIM-type zinc finger domain family...    164   3e-48   
ref|XP_010255661.1|  PREDICTED: LIM domain-containing protein PLI...    166   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009624528.1|  PREDICTED: pollen-specific protein SF3-like ...    166   5e-48   Nicotiana tomentosiformis
ref|XP_011469035.1|  PREDICTED: LIM domain-containing protein PLI...    163   6e-48   Fragaria vesca subsp. vesca
tpg|DAA44552.1|  TPA: putative LIM-type zinc finger domain family...    163   1e-47   
ref|XP_009762122.1|  PREDICTED: pollen-specific protein SF3-like        166   1e-47   Nicotiana sylvestris
ref|XP_002468127.1|  hypothetical protein SORBIDRAFT_01g040050          164   3e-47   Sorghum bicolor [broomcorn]
ref|NP_001288583.1|  uncharacterized protein LOC101266456               165   4e-47   Solanum lycopersicum
ref|XP_004984674.1|  PREDICTED: pollen-specific protein SF3-like        164   5e-47   Setaria italica
ref|NP_001147673.1|  pollen-specific protein SF3                        164   5e-47   Zea mays [maize]
ref|XP_007036740.1|  GATA type zinc finger transcription factor f...    160   9e-47   
ref|XP_011469034.1|  PREDICTED: LIM domain-containing protein PLI...    163   1e-46   Fragaria vesca subsp. vesca
ref|XP_009624529.1|  PREDICTED: pollen-specific protein SF3-like ...    163   1e-46   Nicotiana tomentosiformis
ref|XP_004306805.1|  PREDICTED: LIM domain-containing protein PLI...    163   1e-46   Fragaria vesca subsp. vesca
ref|XP_009397610.1|  PREDICTED: pollen-specific protein SF3-like        162   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009779198.1|  PREDICTED: pollen-specific protein SF3-like        162   3e-46   Nicotiana sylvestris
ref|XP_009762983.1|  PREDICTED: pollen-specific protein SF3-like        161   5e-46   Nicotiana sylvestris
ref|XP_009601147.1|  PREDICTED: pollen-specific protein SF3-like        161   7e-46   Nicotiana tomentosiformis
ref|XP_010273176.1|  PREDICTED: LIM domain-containing protein PLIM2c    160   8e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010474800.1|  PREDICTED: LIM domain-containing protein PLI...    160   1e-45   Camelina sativa [gold-of-pleasure]
ref|NP_182104.1|  protein PLIM2A                                        161   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248581.1|  PREDICTED: LIM domain-containing protein PLI...    160   1e-45   Solanum lycopersicum
ref|XP_006341718.1|  PREDICTED: pollen-specific protein SF3-like        160   1e-45   Solanum tuberosum [potatoes]
emb|CDX71757.1|  BnaC08g31170D                                          160   1e-45   
ref|XP_010479778.1|  PREDICTED: LIM domain-containing protein PLIM2b    160   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002882034.1|  LIM domain-containing protein                      160   2e-45   
ref|XP_010923153.1|  PREDICTED: LIM domain-containing protein WLI...    158   2e-45   Elaeis guineensis
ref|XP_008232792.1|  PREDICTED: pollen-specific protein SF3             160   2e-45   Prunus mume [ume]
ref|XP_009369042.1|  PREDICTED: pollen-specific protein SF3-like        160   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_009629648.1|  PREDICTED: pollen-specific protein SF3-like ...    159   3e-45   Nicotiana tomentosiformis
ref|XP_011093154.1|  PREDICTED: LIM domain-containing protein PLI...    159   3e-45   Sesamum indicum [beniseed]
ref|NP_171683.1|  LIM family protein                                    159   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138785.1|  PREDICTED: pollen-specific protein SF3-like ...    159   4e-45   Brassica rapa
gb|KFK37370.1|  hypothetical protein AALP_AA4G247900                    160   4e-45   Arabis alpina [alpine rockcress]
emb|CDY56926.1|  BnaAnng14450D                                          159   4e-45   Brassica napus [oilseed rape]
ref|XP_009629647.1|  PREDICTED: pollen-specific protein SF3-like ...    159   4e-45   Nicotiana tomentosiformis
ref|XP_004240106.1|  PREDICTED: LIM domain-containing protein WLI...    159   5e-45   Solanum lycopersicum
ref|XP_008796793.1|  PREDICTED: pollen-specific protein SF3-like        159   5e-45   Phoenix dactylifera
ref|XP_006397773.1|  hypothetical protein EUTSA_v10001618mg             159   5e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010905119.1|  PREDICTED: LIM domain-containing protein WLI...    159   5e-45   Elaeis guineensis
ref|XP_010523732.1|  PREDICTED: LIM domain-containing protein PLI...    159   6e-45   Tarenaya hassleriana [spider flower]
ref|XP_009387955.1|  PREDICTED: pollen-specific protein SF3-like        158   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF78411.1|AC009273_17  Contains similarity to mRNA for transc...    160   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402504.1|  hypothetical protein EUTSA_v10006235mg             158   8e-45   Eutrema salsugineum [saltwater cress]
ref|XP_003623892.1|  LIM domain protein 2b                              158   8e-45   Medicago truncatula
ref|XP_008376025.1|  PREDICTED: pollen-specific protein SF3-like        159   9e-45   
gb|EPS71497.1|  hypothetical protein M569_03263                         158   9e-45   Genlisea aurea
ref|XP_009340168.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    159   1e-44   
emb|CDP08845.1|  unnamed protein product                                157   2e-44   Coffea canephora [robusta coffee]
ref|XP_008337059.1|  PREDICTED: pollen-specific protein SF3-like        157   2e-44   Malus domestica [apple tree]
ref|XP_006304383.1|  hypothetical protein CARUB_v10010886mg             157   2e-44   Capsella rubella
ref|XP_009391810.1|  PREDICTED: pollen-specific protein SF3-like        156   2e-44   
ref|XP_002892043.1|  LIM domain-containing protein                      157   2e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_010506557.1|  PREDICTED: LIM domain-containing protein PLIM2a    157   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008374043.1|  PREDICTED: pollen-specific protein SF3-like        157   2e-44   
ref|XP_010508108.1|  PREDICTED: LIM domain-containing protein PLI...    157   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006296425.1|  hypothetical protein CARUB_v10025604mg             157   3e-44   Capsella rubella
gb|KDO39276.1|  hypothetical protein CISIN_1g042895mg                   155   3e-44   Citrus sinensis [apfelsine]
gb|EMS67147.1|  Pollen-specific protein SF3                             155   4e-44   Triticum urartu
ref|XP_009116783.1|  PREDICTED: pollen-specific protein SF3             157   4e-44   Brassica rapa
ref|XP_010518219.1|  PREDICTED: LIM domain-containing protein PLI...    157   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009402055.1|  PREDICTED: pollen-specific protein SF3-like        156   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006418457.1|  hypothetical protein EUTSA_v10008789mg             156   5e-44   Eutrema salsugineum [saltwater cress]
gb|EPS59684.1|  hypothetical protein M569_15118                         155   6e-44   Genlisea aurea
ref|XP_009138786.1|  PREDICTED: pollen-specific protein SF3-like ...    155   8e-44   Brassica rapa
ref|XP_011084964.1|  PREDICTED: LOW QUALITY PROTEIN: LIM domain-c...    155   8e-44   
ref|XP_010544716.1|  PREDICTED: LIM domain-containing protein PLI...    156   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_008777895.1|  PREDICTED: pollen-specific protein SF3-like        155   1e-43   Phoenix dactylifera
ref|XP_003558280.1|  PREDICTED: LIM domain-containing protein WLI...    154   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_008438077.1|  PREDICTED: pollen-specific protein SF3-like ...    155   2e-43   
ref|XP_011023373.1|  PREDICTED: LIM domain-containing protein PLIM2b    154   2e-43   Populus euphratica
ref|XP_008438078.1|  PREDICTED: pollen-specific protein SF3-like ...    155   2e-43   Cucumis melo [Oriental melon]
ref|XP_009143175.1|  PREDICTED: pollen-specific protein SF3-like        155   2e-43   Brassica rapa
gb|EMT25782.1|  Pollen-specific protein SF3                             154   2e-43   
ref|XP_004134333.1|  PREDICTED: pollen-specific protein SF3-like        154   2e-43   
ref|XP_001765937.1|  predicted protein                                  154   2e-43   
emb|CDY18899.1|  BnaC04g04510D                                          155   2e-43   Brassica napus [oilseed rape]
ref|XP_002283482.1|  PREDICTED: LIM domain-containing protein WLIM2a    154   3e-43   Vitis vinifera
gb|KEH18910.1|  GATA type zinc finger transcription factor family...    154   3e-43   Medicago truncatula
ref|NP_001132843.1|  uncharacterized LOC100194335                       154   3e-43   Zea mays [maize]
ref|XP_010107618.1|  Pollen-specific protein SF3                        154   3e-43   
ref|XP_006491462.1|  PREDICTED: pollen-specific protein SF3-like        154   3e-43   
ref|XP_006647592.1|  PREDICTED: pollen-specific protein SF3-like        154   4e-43   Oryza brachyantha
ref|XP_010089139.1|  Pollen-specific protein SF3                        159   4e-43   
ref|XP_003533616.1|  PREDICTED: pollen-specific protein SF3-like        154   4e-43   Glycine max [soybeans]
ref|NP_001047550.1|  Os02g0641000                                       154   4e-43   
gb|KHN29376.1|  Pollen-specific protein SF3                             154   5e-43   Glycine soja [wild soybean]
ref|XP_010671960.1|  PREDICTED: LIM domain-containing protein PLI...    154   5e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU32092.1|  hypothetical protein MIMGU_mgv1a013269mg                154   6e-43   Erythranthe guttata [common monkey flower]
ref|XP_011091917.1|  PREDICTED: LIM domain-containing protein PLI...    154   6e-43   Sesamum indicum [beniseed]
gb|AFK33321.1|  unknown                                                 153   6e-43   Lotus japonicus
ref|XP_008392559.1|  PREDICTED: pollen-specific protein SF3-like        154   7e-43   Malus domestica [apple tree]
ref|XP_002302574.1|  LIM domain-containing family protein               153   7e-43   Populus trichocarpa [western balsam poplar]
ref|XP_001771340.1|  predicted protein                                  152   7e-43   
ref|XP_010907367.1|  PREDICTED: LIM domain-containing protein WLI...    153   7e-43   Elaeis guineensis
ref|XP_004976341.1|  PREDICTED: pollen-specific protein SF3-like ...    153   7e-43   Setaria italica
ref|XP_010523025.1|  PREDICTED: LIM domain-containing protein PLIM2b    153   8e-43   
ref|XP_007139894.1|  hypothetical protein PHAVU_008G067500g             153   8e-43   Phaseolus vulgaris [French bean]
ref|XP_010544715.1|  PREDICTED: LIM domain-containing protein PLI...    154   9e-43   Tarenaya hassleriana [spider flower]
ref|XP_003551659.1|  PREDICTED: pollen-specific protein SF3-like        153   1e-42   Glycine max [soybeans]
ref|NP_001140551.1|  uncharacterized LOC100272616                       152   1e-42   Zea mays [maize]
gb|KGN56538.1|  hypothetical protein Csa_3G122620                       153   1e-42   Cucumis sativus [cucumbers]
emb|CDY27358.1|  BnaC04g50470D                                          153   1e-42   Brassica napus [oilseed rape]
emb|CDX86962.1|  BnaC03g52320D                                          150   1e-42   
ref|XP_004133874.1|  PREDICTED: pollen-specific protein SF3-like        152   1e-42   Cucumis sativus [cucumbers]
dbj|BAK04207.1|  predicted protein                                      152   1e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010512456.1|  PREDICTED: LIM domain-containing protein PLI...    152   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009142366.1|  PREDICTED: pollen-specific protein SF3-like        153   2e-42   Brassica rapa
emb|CDY37066.1|  BnaA04g26440D                                          152   2e-42   Brassica napus [oilseed rape]
ref|XP_003569963.1|  PREDICTED: LIM domain-containing protein WLI...    152   2e-42   
gb|ACN26203.1|  unknown                                                 152   2e-42   Zea mays [maize]
ref|XP_009375790.1|  PREDICTED: pollen-specific protein SF3-like        152   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_010469046.1|  PREDICTED: LIM domain-containing protein PLI...    152   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010413441.1|  PREDICTED: LIM domain-containing protein PLI...    152   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_007051870.1|  GATA type zinc finger transcription factor f...    153   5e-42   
gb|EMT19855.1|  Pollen-specific protein SF3                             151   5e-42   
gb|EYU35073.1|  hypothetical protein MIMGU_mgv1a013171mg                152   5e-42   Erythranthe guttata [common monkey flower]
ref|XP_002452860.1|  hypothetical protein SORBIDRAFT_04g033700          150   7e-42   Sorghum bicolor [broomcorn]
ref|XP_009389159.1|  PREDICTED: pollen-specific protein SF3-like        150   8e-42   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH57141.1|  AT3G55770                                              146   9e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008677533.1|  PREDICTED: uncharacterized LOC100381874 isof...    150   1e-41   
dbj|BAK06966.1|  predicted protein                                      150   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007135026.1|  hypothetical protein PHAVU_010G095700g             150   1e-41   Phaseolus vulgaris [French bean]
emb|CDY38028.1|  BnaCnng08890D                                          150   1e-41   Brassica napus [oilseed rape]
ref|XP_007218397.1|  hypothetical protein PRUPE_ppa011395mg             150   1e-41   
ref|XP_004510816.1|  PREDICTED: pollen-specific protein SF3-like        150   1e-41   Cicer arietinum [garbanzo]
ref|XP_010055180.1|  PREDICTED: pollen-specific protein SF3-like        150   1e-41   Eucalyptus grandis [rose gum]
ref|XP_011035878.1|  PREDICTED: LIM domain-containing protein PLI...    150   1e-41   Populus euphratica
ref|XP_007135027.1|  hypothetical protein PHAVU_010G095700g             150   1e-41   Phaseolus vulgaris [French bean]
ref|XP_009119735.1|  PREDICTED: pollen-specific protein SF3-like        150   1e-41   Brassica rapa
ref|XP_006292212.1|  hypothetical protein CARUB_v10018418mg             150   1e-41   Capsella rubella
emb|CDY15152.1|  BnaC05g00310D                                          150   1e-41   Brassica napus [oilseed rape]
ref|XP_006652565.1|  PREDICTED: pollen-specific protein SF3-like        149   2e-41   Oryza brachyantha
ref|XP_009118834.1|  PREDICTED: pollen-specific protein SF3             149   2e-41   Brassica rapa
ref|XP_002965335.1|  hypothetical protein SELMODRAFT_143123             149   2e-41   Selaginella moellendorffii
ref|NP_001053405.1|  Os04g0532500                                       149   2e-41   
gb|ABK22236.1|  unknown                                                 149   2e-41   Picea sitchensis
gb|ABK58466.1|  LIM domain protein PLIM2a                               149   2e-41   Populus tremula x Populus alba [gray poplar]
ref|XP_002878372.1|  LIM domain-containing protein                      149   2e-41   
ref|XP_004492709.1|  PREDICTED: pollen-specific protein SF3-like        150   3e-41   Cicer arietinum [garbanzo]
emb|CDY01571.1|  BnaC07g35610D                                          149   3e-41   
gb|KFK35321.1|  hypothetical protein AALP_AA5G269200                    149   3e-41   Arabis alpina [alpine rockcress]
ref|NP_001237551.1|  uncharacterized protein LOC100305845               149   4e-41   Glycine max [soybeans]
ref|XP_010512457.1|  PREDICTED: LIM domain-containing protein PLI...    149   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_003521910.2|  PREDICTED: pollen-specific protein SF3-like        148   5e-41   Glycine max [soybeans]
ref|XP_004953255.1|  PREDICTED: pollen-specific protein SF3-like        148   5e-41   Setaria italica
ref|XP_010054850.1|  PREDICTED: pollen-specific protein SF3-like        148   5e-41   Eucalyptus grandis [rose gum]
ref|XP_002320783.2|  LIM domain-containing family protein               148   6e-41   
ref|XP_011022732.1|  PREDICTED: LIM domain-containing protein WLI...    148   6e-41   Populus euphratica
ref|XP_010469047.1|  PREDICTED: LIM domain-containing protein PLI...    148   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002511828.1|  Pollen-specific protein SF3, putative              148   7e-41   Ricinus communis
ref|XP_010413443.1|  PREDICTED: LIM domain-containing protein PLI...    148   7e-41   Camelina sativa [gold-of-pleasure]
gb|ACA33852.1|  LIM2 transcription factor                               145   8e-41   Pinus taeda
gb|KDP28657.1|  hypothetical protein JCGZ_14428                         148   8e-41   Jatropha curcas
gb|KHN27308.1|  K(+) efflux antiporter 2, chloroplastic                 157   1e-40   Glycine soja [wild soybean]
gb|KDP25467.1|  hypothetical protein JCGZ_20623                         147   1e-40   Jatropha curcas
ref|NP_191682.2|  GATA type zinc finger transcription factor fami...    147   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AGJ83944.1|  lim protein 4                                           147   2e-40   Gossypium hirsutum [American cotton]
gb|KHG24611.1|  Pollen-specific SF3                                     147   2e-40   Gossypium arboreum [tree cotton]
ref|XP_003580212.1|  PREDICTED: LIM domain-containing protein PLI...    147   2e-40   Brachypodium distachyon [annual false brome]
gb|KJB41286.1|  hypothetical protein B456_007G097400                    147   2e-40   Gossypium raimondii
ref|XP_008438068.1|  PREDICTED: pollen-specific protein SF3-like        147   2e-40   Cucumis melo [Oriental melon]
gb|KHG00940.1|  Pollen-specific SF3                                     146   3e-40   Gossypium arboreum [tree cotton]
ref|XP_002448228.1|  hypothetical protein SORBIDRAFT_06g023600          146   4e-40   Sorghum bicolor [broomcorn]
ref|XP_006431571.1|  hypothetical protein CICLE_v10003160mg             144   4e-40   
gb|ABL74496.1|  LIM domain protein PLIM2b                               145   5e-40   Populus tremula x Populus alba [gray poplar]
ref|XP_002304483.2|  hypothetical protein POPTR_0003s12440g             145   6e-40   
ref|XP_007210077.1|  hypothetical protein PRUPE_ppa019584mg             146   6e-40   
ref|XP_010053293.1|  PREDICTED: pollen-specific protein SF3-like        146   7e-40   
gb|ABK23670.1|  unknown                                                 145   7e-40   
gb|KFK35322.1|  hypothetical protein AALP_AA5G269200                    145   7e-40   
ref|XP_008238877.1|  PREDICTED: pollen-specific protein SF3-like        146   7e-40   
gb|ACA33841.1|  LIM2 transcription factor                               144   9e-40   
ref|XP_006477522.1|  PREDICTED: pollen-specific protein SF3-like        145   1e-39   
gb|KJB24709.1|  hypothetical protein B456_004G157300                    144   1e-39   
ref|XP_003574155.1|  PREDICTED: LIM domain-containing protein PLI...    144   2e-39   
ref|XP_002509768.1|  Pollen-specific protein SF3, putative              144   2e-39   
ref|XP_011080992.1|  PREDICTED: LIM domain-containing protein WLI...    143   4e-39   
ref|XP_008793825.1|  PREDICTED: pollen-specific protein SF3-like ...    141   5e-39   
ref|XP_003524464.1|  PREDICTED: pollen-specific protein SF3             144   5e-39   
gb|KDO76132.1|  hypothetical protein CISIN_1g041875mg                   142   6e-39   
ref|XP_007040178.1|  GATA type zinc finger transcription factor f...    143   7e-39   
ref|XP_002969252.1|  hypothetical protein SELMODRAFT_146291             142   9e-39   
gb|KJB52067.1|  hypothetical protein B456_008G245300                    142   1e-38   
emb|CAB71053.1|  LIM domain protein                                     142   2e-38   
gb|ACU13968.1|  unknown                                                 141   2e-38   
gb|KJB22346.1|  hypothetical protein B456_004G042300                    141   3e-38   
ref|XP_011029226.1|  PREDICTED: LIM domain-containing protein WLI...    141   3e-38   
ref|XP_002960609.1|  hypothetical protein SELMODRAFT_229974             140   4e-38   
ref|XP_010272036.1|  PREDICTED: LIM domain-containing protein WLI...    140   4e-38   
ref|XP_009610584.1|  PREDICTED: pollen-specific protein SF3-like ...    140   4e-38   
ref|XP_003532407.1|  PREDICTED: pollen-specific protein SF3             141   4e-38   
ref|XP_004503760.1|  PREDICTED: pollen-specific protein SF3-like        141   5e-38   
ref|XP_004982687.1|  PREDICTED: pollen-specific protein SF3-like        140   5e-38   
gb|EAY79118.1|  hypothetical protein OsI_34224                          141   6e-38   
ref|NP_001064995.1|  Os10g0503100                                       141   6e-38   
ref|XP_002283525.1|  PREDICTED: LIM domain-containing protein WLIM1     140   6e-38   
emb|CDY68273.1|  BnaAnng26690D                                          141   6e-38   
gb|EPS67160.1|  hypothetical protein M569_07616                         140   8e-38   
ref|XP_007036121.1|  GATA type zinc finger transcription factor f...    139   8e-38   
ref|XP_009785548.1|  PREDICTED: pollen-specific protein SF3-like        140   8e-38   
ref|XP_006836719.1|  hypothetical protein AMTR_s00088p00121090          139   8e-38   
gb|KDP31140.1|  hypothetical protein JCGZ_11516                         139   8e-38   
emb|CDX95666.1|  BnaC03g25470D                                          140   8e-38   
ref|XP_010037591.1|  PREDICTED: pollen-specific protein SF3-like ...    139   9e-38   
ref|XP_009590601.1|  PREDICTED: pollen-specific protein SF3-like        139   1e-37   
gb|KJB25793.1|  hypothetical protein B456_004G209700                    140   1e-37   
gb|KHG24101.1|  Pollen-specific SF3                                     140   1e-37   
gb|AII80545.1|  LIM-domain protein 11                                   140   1e-37   
ref|XP_010027995.1|  PREDICTED: pollen-specific protein SF3-like        139   2e-37   
gb|EMS55690.1|  Pollen-specific protein SF3                             144   2e-37   
ref|XP_011463839.1|  PREDICTED: LIM domain-containing protein WLI...    139   2e-37   
ref|XP_009803543.1|  PREDICTED: pollen-specific protein SF3-like        138   2e-37   
ref|XP_009627099.1|  PREDICTED: pollen-specific protein SF3-like ...    136   2e-37   
gb|KHN19331.1|  Pollen-specific protein SF3                             138   3e-37   
gb|ABL74498.1|  LIM domain protein BLIM2b                               136   3e-37   
ref|XP_007138113.1|  hypothetical protein PHAVU_009G181200g             138   3e-37   
ref|XP_009133751.1|  PREDICTED: pollen-specific protein SF3-like        140   3e-37   
ref|XP_002511450.1|  Pollen-specific protein SF3, putative              138   3e-37   
emb|CDP17006.1|  unnamed protein product                                138   4e-37   
ref|XP_006661927.1|  PREDICTED: pollen-specific protein SF3-like        139   4e-37   
ref|XP_009786244.1|  PREDICTED: pollen-specific protein SF3-like        138   4e-37   
ref|XP_008793824.1|  PREDICTED: pollen-specific protein SF3-like ...    139   4e-37   
ref|NP_001238190.1|  uncharacterized protein LOC100500444               137   5e-37   
gb|KHN16307.1|  Pollen-specific protein SF3                             137   5e-37   
ref|XP_004299580.1|  PREDICTED: LIM domain-containing protein WLI...    137   6e-37   
ref|XP_009628860.1|  PREDICTED: pollen-specific protein SF3-like        137   6e-37   
ref|XP_011028613.1|  PREDICTED: LIM domain-containing protein WLI...    137   6e-37   
ref|XP_006439752.1|  hypothetical protein CICLE_v10022413mg             137   7e-37   
ref|XP_007209651.1|  hypothetical protein PRUPE_ppa012024mg             137   7e-37   
ref|NP_001235271.1|  uncharacterized protein LOC100500501               137   7e-37   
gb|KHG14633.1|  Pollen-specific SF3                                     137   8e-37   
ref|XP_009610583.1|  PREDICTED: pollen-specific protein SF3-like ...    137   8e-37   
ref|XP_004138126.1|  PREDICTED: pollen-specific protein SF3-like        137   8e-37   
ref|XP_002318024.1|  hypothetical protein POPTR_0012s07870g             137   8e-37   
ref|XP_011044348.1|  PREDICTED: LIM domain-containing protein WLI...    137   8e-37   
gb|AII80542.1|  LIM-domain protein 8                                    137   9e-37   
ref|XP_011072367.1|  PREDICTED: LIM domain-containing protein WLI...    137   1e-36   
gb|KHN04435.1|  Pollen-specific protein SF3                             137   1e-36   
ref|XP_008453121.1|  PREDICTED: pollen-specific protein SF3-like        136   1e-36   
ref|XP_010678700.1|  PREDICTED: LIM domain-containing protein WLI...    137   1e-36   
ref|XP_004976340.1|  PREDICTED: pollen-specific protein SF3-like ...    138   1e-36   
gb|ABK58465.1|  LIM domain protein GLIM1b                               136   2e-36   
gb|EYU29736.1|  hypothetical protein MIMGU_mgv1a014022mg                136   2e-36   
ref|XP_011087164.1|  PREDICTED: LIM domain-containing protein WLI...    136   2e-36   
ref|XP_006345025.1|  PREDICTED: pollen-specific protein SF3-like        136   2e-36   
ref|XP_002321571.1|  hypothetical protein POPTR_0015s08360g             136   2e-36   
ref|XP_009766754.1|  PREDICTED: pollen-specific protein SF3-like        136   2e-36   
ref|XP_006439594.1|  hypothetical protein CICLE_v10023761mg             136   3e-36   
gb|AFW72520.1|  putative LIM-type zinc finger domain family protein     133   3e-36   
ref|XP_006352311.1|  PREDICTED: pollen-specific protein SF3-like        136   3e-36   
ref|XP_007036120.1|  GATA type zinc finger transcription factor f...    136   3e-36   
ref|XP_011074349.1|  PREDICTED: LIM domain-containing protein WLIM1     135   3e-36   
ref|XP_008374471.1|  PREDICTED: pollen-specific protein SF3-like        135   3e-36   
gb|AAX95760.2|  Pollen-specific protein SF3, putative                   135   3e-36   
ref|XP_010928557.1|  PREDICTED: LIM domain-containing protein WLI...    137   3e-36   
ref|XP_004501954.1|  PREDICTED: pollen-specific protein SF3-like        135   3e-36   
gb|ABL74497.1|  LIM domain protein BLIM2a                               132   3e-36   
ref|NP_001168130.1|  uncharacterized LOC100381874                       133   3e-36   
ref|XP_010322559.1|  PREDICTED: LIM domain-containing protein WLIM1     135   4e-36   
ref|NP_001235758.1|  uncharacterized protein LOC100305720               135   4e-36   
ref|NP_001238580.1|  uncharacterized protein LOC100499957               135   4e-36   
ref|XP_008220373.1|  PREDICTED: pollen-specific protein SF3-like        135   5e-36   
ref|XP_009360821.1|  PREDICTED: pollen-specific protein SF3-like        135   5e-36   
ref|XP_009769329.1|  PREDICTED: pollen-specific protein SF3-like        135   5e-36   
ref|XP_006445094.1|  hypothetical protein CICLE_v10022448mg             135   5e-36   
gb|ABK94586.1|  unknown                                                 135   5e-36   
ref|XP_008393720.1|  PREDICTED: pollen-specific protein SF3-like        135   5e-36   
ref|XP_011030325.1|  PREDICTED: LIM domain-containing protein WLI...    135   5e-36   
ref|XP_010544006.1|  PREDICTED: LIM domain-containing protein WLIM1     135   5e-36   
ref|XP_002298780.2|  hypothetical protein POPTR_0001s30020g             135   6e-36   
ref|NP_001237652.1|  uncharacterized protein LOC100527547               135   6e-36   
dbj|BAJ86406.1|  predicted protein                                      135   6e-36   
ref|XP_010913501.1|  PREDICTED: LIM domain-containing protein WLI...    135   6e-36   
ref|XP_009598300.1|  PREDICTED: pollen-specific protein SF3-like        135   6e-36   
gb|KHG08337.1|  Pollen-specific SF3                                     135   6e-36   
ref|XP_003550749.1|  PREDICTED: pollen-specific protein SF3-like        135   7e-36   
ref|XP_004236135.1|  PREDICTED: LIM domain-containing protein WLIM1     134   7e-36   
ref|XP_010061652.1|  PREDICTED: pollen-specific protein SF3-like        134   7e-36   
ref|XP_007225874.1|  hypothetical protein PRUPE_ppa011761mg             135   7e-36   
dbj|BAM05589.1|  LIM transcription factor                               134   7e-36   
ref|XP_008444540.1|  PREDICTED: pollen-specific protein SF3             135   7e-36   
gb|KCW77560.1|  hypothetical protein EUGRSUZ_D01873                     135   8e-36   
ref|XP_010548517.1|  PREDICTED: LIM domain-containing protein WLI...    134   9e-36   
ref|XP_010111544.1|  Pollen-specific protein SF3                        134   1e-35   
ref|XP_011071800.1|  PREDICTED: LIM domain-containing protein WLI...    134   1e-35   
ref|XP_010254782.1|  PREDICTED: LIM domain-containing protein WLI...    134   1e-35   
gb|AAF75284.1|AF116850_1  LIM domain protein PLIM-2                     135   1e-35   
ref|XP_006595535.1|  PREDICTED: uncharacterized protein LOC100527...    134   1e-35   
ref|XP_008347599.1|  PREDICTED: pollen-specific protein SF3-like        134   2e-35   
ref|XP_009418011.1|  PREDICTED: pollen-specific protein SF3-like        134   2e-35   
ref|XP_008393059.1|  PREDICTED: pollen-specific protein SF3-like        133   2e-35   
ref|XP_009623970.1|  PREDICTED: pollen-specific protein SF3-like        134   2e-35   
ref|XP_007160919.1|  hypothetical protein PHAVU_001G028200g             134   2e-35   
ref|XP_009765343.1|  PREDICTED: pollen-specific protein SF3-like        133   2e-35   
gb|EYU25518.1|  hypothetical protein MIMGU_mgv1a014425mg                133   2e-35   
ref|XP_009375152.1|  PREDICTED: pollen-specific protein SF3-like        133   2e-35   
ref|XP_009400630.1|  PREDICTED: pollen-specific protein SF3-like        133   2e-35   
gb|KJB63465.1|  hypothetical protein B456_010G026100                    131   2e-35   
ref|XP_010272870.1|  PREDICTED: LIM domain-containing protein WLI...    133   2e-35   
ref|XP_004252738.1|  PREDICTED: LIM domain-containing protein WLI...    133   3e-35   
ref|XP_002510088.1|  Pollen-specific protein SF3, putative              133   3e-35   
gb|KDP41612.1|  hypothetical protein JCGZ_16019                         133   3e-35   
dbj|BAM05591.1|  LIM transcription factor                               133   3e-35   
ref|XP_007136766.1|  hypothetical protein PHAVU_009G072200g             133   3e-35   
ref|XP_010094354.1|  Pollen-specific protein SF3                        133   3e-35   
ref|XP_006342667.1|  PREDICTED: pollen-specific protein SF3-like        132   4e-35   
gb|KHN36972.1|  Pollen-specific protein SF3                             133   4e-35   
ref|XP_007018479.1|  GATA type zinc finger transcription factor f...    133   4e-35   
ref|XP_004290976.1|  PREDICTED: LIM domain-containing protein WLIM1     132   4e-35   
ref|NP_001238429.1|  uncharacterized protein LOC100499947               133   4e-35   
ref|XP_004141291.1|  PREDICTED: pollen-specific protein SF3-like        132   4e-35   
ref|XP_004238086.1|  PREDICTED: LIM domain-containing protein WLIM1     132   4e-35   
ref|XP_006433641.1|  hypothetical protein CICLE_v10002540mg             133   4e-35   
dbj|BAA82827.1|  transcription factor Ntlim1                            133   5e-35   
ref|XP_011092491.1|  PREDICTED: LIM domain-containing protein WLI...    132   5e-35   
ref|XP_002285355.1|  PREDICTED: LIM domain-containing protein WLIM1     132   5e-35   
ref|XP_008452649.1|  PREDICTED: pollen-specific protein SF3-like ...    132   5e-35   
dbj|BAB84581.1|  transcription factor LIM                               132   6e-35   
ref|XP_002320687.1|  transcription factor LIM family protein            132   6e-35   
ref|XP_010999890.1|  PREDICTED: LIM domain-containing protein WLI...    132   7e-35   
ref|XP_004501516.1|  PREDICTED: pollen-specific protein SF3-like        132   7e-35   
gb|AFK42620.1|  unknown                                                 129   8e-35   
dbj|BAB84584.1|  transcription factor LIM                               132   8e-35   
gb|AFK47041.1|  unknown                                                 132   8e-35   
gb|AFK42495.1|  unknown                                                 132   8e-35   
ref|XP_004142897.1|  PREDICTED: pollen-specific protein SF3-like        132   9e-35   
gb|AGJ83943.1|  lim protein 3                                           132   9e-35   
gb|KJB63466.1|  hypothetical protein B456_010G026100                    131   9e-35   
ref|XP_010676493.1|  PREDICTED: LIM domain-containing protein WLI...    132   1e-34   
ref|XP_010059807.1|  PREDICTED: pollen-specific protein SF3-like        131   1e-34   
ref|XP_002313186.2|  hypothetical protein POPTR_0009s09040g             131   1e-34   
gb|ABK95336.1|  unknown                                                 131   1e-34   
ref|XP_010942770.1|  PREDICTED: LIM domain-containing protein WLI...    131   1e-34   
ref|XP_011002116.1|  PREDICTED: LIM domain-containing protein WLI...    131   2e-34   
gb|AAD56948.1|AF184109_1  LIM domain protein WLIM1                      131   2e-34   
gb|EYU38365.1|  hypothetical protein MIMGU_mgv1a014348mg                131   2e-34   
ref|XP_004508840.1|  PREDICTED: pollen-specific protein SF3-like        131   2e-34   
emb|CDP01275.1|  unnamed protein product                                131   2e-34   
ref|XP_002892554.1|  hypothetical protein ARALYDRAFT_471134             130   2e-34   
gb|AFV60741.1|  LIM domain protein LIM-2                                130   2e-34   
ref|XP_003525489.1|  PREDICTED: pollen-specific protein SF3-like        131   2e-34   
gb|ABK58464.1|  LIM domain protein GLIM1a                               130   2e-34   
gb|AGE09578.1|  LIM-like protein                                        130   2e-34   
ref|XP_011029229.1|  PREDICTED: LIM domain-containing protein WLI...    131   3e-34   
ref|XP_004498991.1|  PREDICTED: pollen-specific protein SF3-like        130   3e-34   
ref|XP_002532425.1|  Cysteine and glycine-rich protein, putative        130   3e-34   
gb|ABK58467.1|  LIM domain protein WLIM1a                               130   3e-34   
ref|XP_002302405.2|  hypothetical protein POPTR_0002s11880g             130   3e-34   
gb|KHG30571.1|  Pollen-specific SF3                                     129   3e-34   
ref|XP_006417487.1|  hypothetical protein EUTSA_v10008856mg             130   3e-34   
ref|XP_008811666.1|  PREDICTED: pollen-specific protein SF3             130   4e-34   
ref|XP_010687903.1|  PREDICTED: LIM domain-containing protein WLIM1     130   4e-34   
gb|AII80544.1|  LIM-domain protein 10                                   130   5e-34   
ref|XP_003589058.1|  Transcription factor lim1                          130   5e-34   
gb|AGE09584.1|  LIM1-like protein                                       130   5e-34   
gb|KJB32232.1|  hypothetical protein B456_005G230900                    130   5e-34   
gb|ABK93551.1|  unknown                                                 130   6e-34   
ref|XP_007155394.1|  hypothetical protein PHAVU_003G197600g             130   6e-34   
ref|XP_010274389.1|  PREDICTED: LIM domain-containing protein WLI...    129   7e-34   
gb|ABY21316.1|  LIM1                                                    129   7e-34   
ref|XP_009766668.1|  PREDICTED: pollen-specific protein SF3-like        129   9e-34   
ref|XP_004245622.1|  PREDICTED: LIM domain-containing protein WLI...    129   9e-34   
emb|CDX94916.1|  BnaC05g07550D                                          129   9e-34   
ref|XP_009148339.1|  PREDICTED: pollen-specific protein SF3             129   1e-33   
ref|XP_009606069.1|  PREDICTED: pollen-specific protein SF3-like        129   1e-33   
ref|XP_009144466.1|  PREDICTED: pollen-specific protein SF3-like        129   1e-33   
ref|XP_011457848.1|  PREDICTED: LIM domain-containing protein WLI...    129   1e-33   
emb|CDY20647.1|  BnaC08g14110D                                          129   1e-33   
ref|XP_010458355.1|  PREDICTED: LIM domain-containing protein WLI...    129   1e-33   
ref|NP_172491.1|  transcription factor lim1                             129   1e-33   
ref|XP_006304225.1|  hypothetical protein CARUB_v10010373mg             129   1e-33   
ref|XP_010490782.1|  PREDICTED: LIM domain-containing protein WLIM1     129   1e-33   
ref|XP_010475882.1|  PREDICTED: LIM domain-containing protein WLI...    129   1e-33   
gb|EYU29934.1|  hypothetical protein MIMGU_mgv1a014656mg                128   1e-33   
gb|KFK43312.1|  hypothetical protein AALP_AA1G108000                    129   1e-33   
gb|AGJ83946.1|  lim protein 6                                           129   2e-33   
ref|XP_002266499.1|  PREDICTED: LIM domain-containing protein WLIM1     129   2e-33   
gb|KJB32231.1|  hypothetical protein B456_005G230900                    129   2e-33   
gb|AAF13231.1|  pollen specific LIM domain protein 1a                   128   2e-33   
ref|XP_006857164.1|  hypothetical protein AMTR_s00065p00168710          128   2e-33   
emb|CDP09772.1|  unnamed protein product                                128   2e-33   
dbj|BAO02514.1|  predicted LIM domain-containing protein ortholog       128   2e-33   
ref|XP_004136935.1|  PREDICTED: pollen-specific protein SF3-like        128   3e-33   
gb|EYU42534.1|  hypothetical protein MIMGU_mgv1a021971mg                127   3e-33   
ref|XP_009415386.1|  PREDICTED: pollen-specific protein SF3-like        128   4e-33   
ref|XP_009408124.1|  PREDICTED: pollen-specific protein SF3-like        127   5e-33   



>ref|XP_009602682.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 ref|XP_009602683.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 ref|XP_009786370.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|AAD56951.1|AF184886_1 LIM domain protein WLIM2 [Nicotiana tabacum]
 emb|CAA71891.1| LIM-domain SF3 protein [Nicotiana tabacum]
Length=189

 Score =   221 bits (564),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/110 (95%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVELLSADG+NYHKSCF+CSHCKGTLKLSN+SSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVNYHKSCFKCSHCKGTLKLSNFSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNFNKNFQSPAKSA+KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCAT  110


 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +  +YHK+CF+CSH   +L  SNY+++ G+LYCKPHF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVENQSYHKTCFKCSHGGCSLSPSNYAALNGILYCKPHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  SQLFKEKGSYNHLIKS  176



>gb|KHG27160.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   218 bits (554),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADGI YHKSCF+CSHCKGTLKL NYSSMEGV+YCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGIPYHKSCFKCSHCKGTLKLGNYSSMEGVVYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188



>ref|XP_008392904.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Malus 
domestica]
 ref|XP_009351067.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Pyrus x bretschneideri]
Length=199

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVE LSADGI+YHKSCF+C+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQ+KCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCAT  110


 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+LYCK HF QLFKE G++N   +S
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKS  176



>ref|XP_006435557.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006435558.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006486459.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR48797.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|ESR48798.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|KDO69271.1| hypothetical protein CISIN_1g029695mg [Citrus sinensis]
Length=189

 Score =   217 bits (553),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCK CEKTVYPVE LSADG+ YHKSCF+CSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKVCEKTVYPVEQLSADGVVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCA+
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAS  110


 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC +C KTVYP+E ++ +   YHK+CF+CSH   ++  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCASCSKTVYPLEKVAVENQAYHKTCFKCSHGGCSISPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKSASMKRAAASVPE  188



>ref|XP_007009106.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009109.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17916.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17919.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=189

 Score =   217 bits (553),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADG+ YHKSCF+CSHCKGTLKL NYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188



>ref|XP_007218461.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_007218462.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_008233707.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 ref|XP_008233708.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 gb|EMJ19660.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 gb|EMJ19661.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
Length=192

 Score =   217 bits (553),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVE LSADG++YHK+CF+C+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGVSYHKACFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+LYCK HF QLFKE G++N   +S
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKS  176



>ref|XP_009344420.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=199

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVE LSADGI+YHKSCF+C+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQ+KCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCAT  110


 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+LYCK HF QLFKE G++N   +S
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKS  176



>ref|XP_008381875.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=199

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVE LSADGI+YHKSCF+C+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQ+KCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCAT  110


 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+LYCK HF QLFKE G++N   +S
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKS  176



>gb|KJB78800.1| hypothetical protein B456_013G019800 [Gossypium raimondii]
 gb|KJB78801.1| hypothetical protein B456_013G019800 [Gossypium raimondii]
 gb|KJB78802.1| hypothetical protein B456_013G019800 [Gossypium raimondii]
Length=189

 Score =   217 bits (552),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADGI YHKSCF+CSHCKGTLKL NYSSMEGV+YCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGIPYHKSCFKCSHCKGTLKLGNYSSMEGVVYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNFNKNFQSPA+SA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKESGNFNKNFQSPARSAEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188



>gb|KDP44835.1| hypothetical protein JCGZ_01335 [Jatropha curcas]
Length=189

 Score =   217 bits (552),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYP+ELLSADGI+YHKSCF+C HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGISYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH   +L  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            GVLYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GVLYCKHHFSQLFKEKGSYNHLIKSASMKRAAASMPE  188



>ref|XP_004138434.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004165359.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_008441430.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441431.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441432.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 gb|KGN45769.1| hypothetical protein Csa_6G009480 [Cucumis sativus]
Length=189

 Score =   217 bits (552),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVE LSADG++YHKSCF+CSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAA MFSGTQ+KCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQDKCAT  110


 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +  +YHKSCF+CSH    L  SNY+++EG+LYCK HF
Sbjct  101  FSGTQDKCATCGKTVYPLEKVTVESQSYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  SQLFKEKGSYNHLIKS  176



>ref|XP_009587504.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=189

 Score =   217 bits (552),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADGI+YHKSCF+C+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQL+KESGNFNKNFQSPAKSA+KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  61   HFEQLYKESGNFNKNFQSPAKSAEKLTPELTRSPSKAARMFSGTQEKCAT  110


 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  207  RMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCK  386
            RM F GTQ+KC  C+KT YP+E ++ +  +YHKSCF+CSH   +L  SNY++++G+LYCK
Sbjct  99   RM-FSGTQEKCATCDKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNPSNYAALDGILYCK  157

Query  387  PHFEQLFKESGNFN  428
            PHF QLFKE G++N
Sbjct  158  PHFSQLFKEKGSYN  171



>ref|XP_009772727.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=138

 Score =   214 bits (546),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADGI+YHKSCF+C+HCKGTLKLS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTHCKGTLKLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQL+KESGNFNKNFQSPAKSA+KLTPELTRSPSKA+ MFSGTQEKCAT
Sbjct  61   HFEQLYKESGNFNKNFQSPAKSAEKLTPELTRSPSKASRMFSGTQEKCAT  110



>gb|ACX47456.1| LIM1 [Hevea brasiliensis]
Length=189

 Score =   214 bits (546),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHKSCF+C HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH   +L  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFN  428
            GVLYCK HF QLFKE G++N
Sbjct  152  GVLYCKHHFSQLFKEKGSYN  171



>ref|XP_004307607.1| PREDICTED: LIM domain-containing protein WLIM2b [Fragaria vesca 
subsp. vesca]
Length=200

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKAC+KTVYPVE LSADGI+YHKSCF+C+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACQKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPE+TRSPSKAA MFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPEMTRSPSKAAGMFSGTQEKCAT  110


 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  SQLFKEKGSYNHLIKS  176



>ref|XP_002279922.1| PREDICTED: LIM domain-containing protein WLIM2b [Vitis vinifera]
 ref|XP_010658484.1| PREDICTED: LIM domain-containing protein WLIM2b [Vitis vinifera]
 emb|CAN81425.1| hypothetical protein VITISV_014590 [Vitis vinifera]
 emb|CBI31546.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   214 bits (546),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKAC KTVYPVE LSADG+ YHKSCF+CSHC GTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPISPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+LYCK HF QLFKE G++N   +S
Sbjct  152  GILYCKHHFAQLFKEKGSYNHLIKS  176



>ref|XP_011076748.1| PREDICTED: LIM domain-containing protein WLIM2b [Sesamum indicum]
Length=189

 Score =   214 bits (545),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVELLSADG++YHKSCF+CSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G+F+KNFQSPAKSA+KLTPELTRSPSKAA MFSGTQ+KCAT
Sbjct  61   HYEQLFKETGSFSKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQDKCAT  110


 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +  +YHKSCF+CSH   +L  SNY++++G+LYCKPHF
Sbjct  101  FSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCSLTPSNYAALDGILYCKPHF  160

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPE  476
             QLFKE G++N   +S + K A  + P+
Sbjct  161  SQLFKEKGSYNHLIKSASMKRATTVVPD  188



>ref|XP_002530411.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF31981.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=189

 Score =   214 bits (545),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHKSCF+C HCKGTLKLSNYSSMEGV+YCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVVYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH   ++  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSISPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            GVLYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GVLYCKHHFSQLFKEKGSYNHLIKSASMKRAAASVPE  188



>gb|KJB67594.1| hypothetical protein B456_010G199200 [Gossypium raimondii]
Length=189

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVELLSADG+ YHKSCF+CSHCKGTLKL+NYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQS AK+A+KLTPELTRSPSKAASMFSGT EKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSSAKAAEKLTPELTRSPSKAASMFSGTVEKCAT  110


 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GT +KC  C KT YP+E ++ +G +YHKSCF+CSH   +L  SNY+++E
Sbjct  92   RSPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCSLSPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188



>gb|KHG07853.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVELLSADG+ YHKSCF+CSHCKGTLKL+NYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQS AK+A+KLTPELTRSPSKAASMFSGT EKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSSAKAAEKLTPELTRSPSKAASMFSGTVEKCAT  110


 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GT +KC  C KT YP+E ++ +G +YHKSCF+CSH   +L  SNY+++E
Sbjct  92   RSPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHSGCSLSPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+LYCK HF QLFKE G++N   +S
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKS  176



>ref|XP_008392902.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_008392903.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_009351060.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Pyrus x bretschneideri]
Length=200

 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 109/111 (98%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVE LSADGI+YHKSCF+C+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSP-AKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSP AKSA+KLTPELTRSPSKAASMFSGTQ+KCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAAKSAEKLTPELTRSPSKAASMFSGTQDKCAT  111


 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  93   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALE  152

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+LYCK HF QLFKE G++N   +S
Sbjct  153  GILYCKHHFSQLFKEKGSYNHLIKS  177



>ref|XP_002315180.1| LIM domain-containing family protein [Populus trichocarpa]
 ref|XP_011036022.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011036023.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 gb|ABK96192.1| unknown [Populus trichocarpa]
 gb|EEF01351.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHK+CF+C HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSA+KL PELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLNPELTRSPSKAASMFSGTQEKCAT  110


 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            GVLYCK HF QLFKE G++N   +S   K A    PE
Sbjct  152  GVLYCKHHFSQLFKEKGSYNHLIKSATMKRAAASVPE  188



>gb|AGJ83945.1| lim protein 5 [Gossypium hirsutum]
Length=189

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVELLSADG+ YHKSCF+CSHCKGTLKL+NYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQS AK+A+KLTPE+TRSPSKAASMFSGT EKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSSAKAAEKLTPEMTRSPSKAASMFSGTVEKCAT  110


 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GT +KC  C KT YP+E ++ +G +YHKSCF+CSH   +L  SNY+++E
Sbjct  92   RSPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCSLSPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188



>gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Populus alba]
Length=189

 Score =   212 bits (539),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHKSCF+C HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HF+QLFKE+GNFNKNFQSPAK+A+KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  61   HFDQLFKETGNFNKNFQSPAKTAEKLTPELTRSPSKAAGMFSGTQEKCAT  110


 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  S+Y+++EGVLYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSSYAALEGVLYCKHHF  160

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPE  476
             QLFKE G++N   +S + K A    PE
Sbjct  161  SQLFKEKGSYNHLIKSASMKRAAAPVPE  188



>ref|XP_010093495.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB54148.1| Pollen-specific protein SF3 [Morus notabilis]
Length=192

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKAC+KTVYPVE LSADG++YHKSCF+CSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACDKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNKNFQSPAKSA+KL PELTRSPSKAASMFSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFNKNFQSPAKSAEKLNPELTRSPSKAASMFSGTQDKCAT  110


 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ KC  C KT YP+E ++ + + YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESLTYHKSCFKCSHGGCAITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  473
            GVLYCK HF QLFKE GN+N   +S +       P
Sbjct  152  GVLYCKHHFAQLFKEKGNYNHVLRSASSKRTAAAP  186



>ref|XP_002312139.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|ABK94456.1| unknown [Populus trichocarpa]
 gb|EEE89506.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYP+ELLS DG+ YHKSCF+C HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HF+QLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  61   HFDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCAT  110


 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++EGVLYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHF  160

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  161  SQLFKEKGSYN  171



>ref|XP_011040324.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011040398.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
Length=189

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYP+ELLSADG+ YHK+CF+C HCKGTLKL NYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLGNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HF+QLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  61   HFDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCAT  110


 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++EGVLYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHF  160

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPE  476
             QLFKE G++N   +S + K A    PE
Sbjct  161  SQLFKEKGSYNHLIKSASMKRAAAPVPE  188



>ref|XP_010067487.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067488.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067489.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 gb|KCW65631.1| hypothetical protein EUGRSUZ_G03023 [Eucalyptus grandis]
Length=189

 Score =   209 bits (533),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKACEKTVYPVE LSADG+ YHKSCF+CSHCKGTLKLS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQVKCKACEKTVYPVEQLSADGVAYHKSCFKCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAKSADKLTPEL RSPSKAA MFSGTQ+KCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSADKLTPELARSPSKAAGMFSGTQDKCAT  110


 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +  +YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPE  476
             QLFKE G++N   +S + K A    PE
Sbjct  161  SQLFKEKGSYNHLIKSASMKRAAASIPE  188



>ref|XP_004239928.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Solanum 
lycopersicum]
 ref|XP_006355670.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=189

 Score =   209 bits (533),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADGI+YHKSCF+C+HCKGTLKLS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTHCKGTLKLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQL+KESGNFNKNFQSP KSA+KLTP LT+SPSKAA MFSGTQEKCAT
Sbjct  61   HFEQLYKESGNFNKNFQSPVKSAEKLTPMLTKSPSKAAGMFSGTQEKCAT  110


 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +  +YHKSCF+CSH   +L  SNY++++G+LYCKPHF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNPSNYAALDGILYCKPHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  SQLFKEKGSYNHLIKS  176



>ref|NP_001241110.1| uncharacterized protein LOC100809121 [Glycine max]
 ref|XP_006601833.1| PREDICTED: uncharacterized protein LOC100809121 isoform X1 [Glycine 
max]
 ref|XP_006601834.1| PREDICTED: uncharacterized protein LOC100809121 isoform X2 [Glycine 
max]
 gb|ACU23614.1| unknown [Glycine max]
 gb|KHN07635.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   209 bits (533),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPV+ LSADG  YHK+CFRCSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKESG+F+KNFQSPAK ADK TPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HYEQLFKESGSFSKNFQSPAKLADKTTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFN  428
            G+LYCK HF QLFKE G++N
Sbjct  152  GILYCKHHFSQLFKEKGSYN  171



>gb|ABK94608.1| unknown [Populus trichocarpa]
Length=189

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYP+ELLS DG+ YHKSCF+C HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H +QLFKE+GNFNKNFQSPAKSA+KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  61   HLDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCAT  110


 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++A+   YHKSCF+CSH    +  SNY+++EGVLYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTAESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHF  160

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  161  SQLFKEKGSYN  171



>ref|XP_004167859.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3-like 
[Cucumis sativus]
Length=195

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKAC+KTVYPV+ LSADG+++HKSCF+CSHCKGTLKLSNYSSM+GVLYCKP
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNF+KNF SPAKS++KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFSKNFLSPAKSSEKLTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH   +L  SNY++++
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALD  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+L CK HF QLFKE G++N   +S
Sbjct  152  GILXCKHHFSQLFKEKGSYNHLIKS  176



>ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 ref|XP_007163505.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|AGV54419.1| pollen-specific protein SF3-like isoform 1 [Phaseolus vulgaris]
 gb|ESW35498.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|ESW35499.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
Length=194

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPV+ LSADG  YHK+CFRCSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G F+KNFQSPAK ADK TPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HYEQLFKETGTFSKNFQSPAKLADKTTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFN  428
            G+LYCK HF QLFKE G++N
Sbjct  152  GILYCKHHFSQLFKEKGSYN  171



>ref|XP_007009108.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOY17918.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
Length=197

 Score =   207 bits (527),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 106/118 (90%), Gaps = 8/118 (7%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADG+ YHKSCF+CSHCKGTLKL NYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQS--------PAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQS         AKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFNKNFQSLSLILLSAAAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  118


 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++E
Sbjct  100  RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALE  159

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  160  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  196



>gb|KHN17859.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   207 bits (526),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPV+ LSADG  YHK+CFRCSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F+KNFQSPAK ADK T ELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKESGSFSKNFQSPAKLADKTTHELTRSPSKAASMFSGTQEKCAT  110


 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFN  428
            G+LYCK HF QLFKE G++N
Sbjct  152  GILYCKHHFSQLFKEKGSYN  171



>ref|XP_003538442.1| PREDICTED: pollen-specific protein SF3-like isoformX1 [Glycine 
max]
 ref|XP_006591370.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Glycine 
max]
 ref|XP_006591371.1| PREDICTED: pollen-specific protein SF3-like isoform X3 [Glycine 
max]
Length=200

 Score =   207 bits (526),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPV+ LSADG  YHK+CFRCSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F+KNFQSPAK ADK T ELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKESGSFSKNFQSPAKLADKTTHELTRSPSKAASMFSGTQEKCAT  110


 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFN  428
            G+LYCK HF QLFKE G++N
Sbjct  152  GILYCKHHFSQLFKEKGSYN  171



>gb|AAL38006.1|AF443117_1 LIM domain protein [Gossypium hirsutum]
 gb|AII80543.1| LIM-domian protein 9 [Gossypium hirsutum]
Length=189

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVELLSADG+ YHKSC +CSHCKGTLKL+NYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCSKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNK+FQ  AK+A+KLTPE+TRSPSKAASMFSGT EKCAT
Sbjct  61   HFEQLFKETGNFNKDFQLSAKAAEKLTPEMTRSPSKAASMFSGTVEKCAT  110


 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GT +KC  C KT YP+E ++ +G +Y KSCF+CSH   +L  SNY+++E
Sbjct  92   RSPSKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYLKSCFKCSHGGCSLSPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  188



>ref|XP_007009110.1| GATA type zinc finger transcription factor family protein isoform 
5, partial [Theobroma cacao]
 gb|EOY17920.1| GATA type zinc finger transcription factor family protein isoform 
5, partial [Theobroma cacao]
Length=182

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +3

Query  231  QKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFK  410
            QKCKACEKTVYPVELLSADG+ YHKSCF+CSHCKGTLKL NYSSMEGVLYCKPHFEQLFK
Sbjct  1    QKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFK  60

Query  411  ESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            E+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   ETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  103


 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++E
Sbjct  85   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALE  144

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  145  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  181



>ref|XP_004150238.1| PREDICTED: pollen-specific protein SF3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004150239.1| PREDICTED: pollen-specific protein SF3-like isoform 2 [Cucumis 
sativus]
 gb|KGN50627.1| hypothetical protein Csa_5G198170 [Cucumis sativus]
Length=195

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKAC+KTVYPV+ LSADG+++HKSCF+CSHCKGTLKLSNYSSM+GVLYCKP
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNF+KNF SPAKS++K TPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFSKNFLSPAKSSEKPTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH   +L  SNY++++
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALD  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            G+LYCK HF QLFKE G++N   +S
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKS  176



>gb|AFK39062.1| unknown [Lotus japonicus]
 gb|AFK48743.1| unknown [Lotus japonicus]
Length=189

 Score =   205 bits (521),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF+GTQQKCKACEKTVYPV+ LSADG +YHK+CFRCSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFLGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G F KNFQSPAK ADK TPELTRSPSKAA MFSGTQEKCAT
Sbjct  61   HYEQLFKETGTFKKNFQSPAKLADKNTPELTRSPSKAAGMFSGTQEKCAT  110


 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPE  476
             QLFKE G++N   +S + K A    PE
Sbjct  161  SQLFKEKGSYNHLIKSASIKRAAASVPE  188



>ref|XP_008463203.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463204.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463205.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=195

 Score =   204 bits (520),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKAC+KTVYPV+ LSADG+++HKSCF+CSHCKGTLKLSNYSSM+GVLYCKP
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNF+KNF SPAKS++K TPELTRSPS+AASMFSGTQEKCAT
Sbjct  61   HFEQLFKETGNFSKNFLSPAKSSEKPTPELTRSPSRAASMFSGTQEKCAT  110


 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH   +L  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAAS  506
             QLFKE G++N   +S +      T +    PSK  S
Sbjct  161  SQLFKEKGSYNHLIKSASMKRQAATSD--SDPSKVES  195



>ref|XP_004503222.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503223.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cicer 
arietinum]
Length=189

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPV+ LSADG +YHK+CFRCSHCKGTLKLS+YSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G F KNF SPAK ADK TPELTRSPSKAASMFSGTQ+KCAT
Sbjct  61   HYEQLFKETGTFKKNFTSPAKLADKTTPELTRSPSKAASMFSGTQDKCAT  110


 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  152  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAATSVPE  188



>gb|ACU17588.1| unknown [Glycine max]
Length=139

 Score =   201 bits (512),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKC+AC+KTVYPV+ LSADG  YHK+CF+CSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G+F KNFQSPAK A K TPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HYEQLFKETGSFKKNFQSPAKQAVKTTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSH  326
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSH  137



>ref|XP_007009107.1| GATA type zinc finger transcription factor family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY17917.1| GATA type zinc finger transcription factor family protein isoform 
2, partial [Theobroma cacao]
Length=191

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +3

Query  231  QKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFK  410
            +KCKACEKTVYPVELLSADG+ YHKSCF+CSHCKGTLKL NYSSMEGVLYCKPHFEQLFK
Sbjct  10   KKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFK  69

Query  411  ESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            E+GNFNKNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  70   ETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  112


 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++E
Sbjct  94   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALE  153

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPE  476
            G+LYCK HF QLFKE G++N   +S + K A    PE
Sbjct  154  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAASVPE  190



>ref|XP_010256708.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256709.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256710.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256711.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256712.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256713.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
Length=192

 Score =   202 bits (514),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCKACEKTVY V+ LSADG+ YHKSCF+CSHCKGTLKLSNYSSMEGVLYCKPHF
Sbjct  4    FGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPHF  63

Query  396  EQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G+F KNFQSPAKSA+KLTPELTRSPSKAASMFSGTQEKCAT
Sbjct  64   EQLFKETGSFKKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCAT  111


 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++E
Sbjct  93   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALE  152

Query  369  GVLYCKPHFEQLFKESGNFNK-----NFQSPAKSADKLTP  473
            G+LYCK HF QLFKE G++N      + + PA S     P
Sbjct  153  GILYCKHHFSQLFKEKGSYNHLIKCASIKRPAASVPDARP  192



>ref|XP_003544136.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Glycine max]
 ref|XP_006595876.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Glycine max]
 ref|XP_006595877.1| PREDICTED: pollen-specific protein SF3 isoform X3 [Glycine max]
 gb|KHN20876.1| Pollen-specific protein SF3 [Glycine soja]
Length=189

 Score =   201 bits (512),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKC+AC+KTVYPV+ LSADG  YHK+CF+CSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G+F KNFQSPAK A K TPELTRSPSKAASMFSGTQEKCAT
Sbjct  61   HYEQLFKETGSFKKNFQSPAKQAVKTTPELTRSPSKAASMFSGTQEKCAT  110


 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++E
Sbjct  92   RSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGSCPITPSNYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFNKNFQS  443
            GVLYCK HF QLFKE G++N   +S
Sbjct  152  GVLYCKHHFSQLFKEKGSYNHLIKS  176



>ref|NP_001154680.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79439.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
Length=127

 Score =   198 bits (504),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAKSADK TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCAT  110



>gb|KJB74201.1| hypothetical protein B456_011G279100 [Gossypium raimondii]
 gb|KJB74202.1| hypothetical protein B456_011G279100 [Gossypium raimondii]
Length=188

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 1/110 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVEL+S DG+ +HKSCF+CSHCKGTLK  NYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVELVSVDGVPFHKSCFKCSHCKGTLKWGNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GN+NKNFQSPAKSA+KLT +LTRSPSKAA MFSGTQ+KCAT
Sbjct  61   HFEQLFKEAGNYNKNFQSPAKSAEKLT-QLTRSPSKAAGMFSGTQDKCAT  109


 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  100  FSGTQDKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  159

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  160  SQLFKEKGSYNHLIKS  175



>gb|AGJ83942.1| lim protein 2 [Gossypium hirsutum]
 gb|KHG28834.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 1/110 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPVEL+S DG+ +HKSCF+CSHCKGTLK  NYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVELVSVDGVPFHKSCFKCSHCKGTLKWGNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GN+NKNFQSPAKSA+KLT +LTRSPSKAA MFSGTQ+KCAT
Sbjct  61   HFEQLFKEAGNYNKNFQSPAKSAEKLT-QLTRSPSKAAGMFSGTQDKCAT  109


 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  100  FSGTQDKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  159

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  160  SQLFKEKGSYNHLIKS  175



>ref|XP_010554627.1| PREDICTED: LIM domain-containing protein WLIM2b [Tarenaya hassleriana]
 ref|XP_010554628.1| PREDICTED: LIM domain-containing protein WLIM2b [Tarenaya hassleriana]
Length=196

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCK C+KTVYPVELLSADG+ YHKSCF+C+HCK  L+LSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKTCDKTVYPVELLSADGVGYHKSCFKCTHCKSRLQLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSPAK A+K TPELTR+PSK ASMFSGTQ+KCAT
Sbjct  61   HFEQLFKETGNFNKNFQSPAKPAEKPTPELTRTPSKFASMFSGTQDKCAT  110


 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +  +YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQDKCATCSKTVYPLEKVTVESQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  SQLFKEKGSYNHLIKS  176



>ref|XP_003600847.1| LIM domain-containing protein [Medicago truncatula]
 gb|ACJ85930.1| unknown [Medicago truncatula]
 gb|ACJ86074.1| unknown [Medicago truncatula]
 gb|AES71098.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
 gb|AFK39027.1| unknown [Medicago truncatula]
 gb|AFK39398.1| unknown [Medicago truncatula]
Length=191

 Score =   200 bits (508),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPV+ LSADG +YHK+CFRCSHCKGTLKLS+YSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNF--NKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE GNF  NKNFQSPAK AD  TP LTR+PSKAA MFSGTQEKCAT
Sbjct  61   HFEQLFKEHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMFSGTQEKCAT  112


 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHF  162

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPE  476
             QLFKE G++N   +S + K A    PE
Sbjct  163  SQLFKEKGSYNHLIKSASIKRAAASVPE  190



>gb|AFK34184.1| unknown [Medicago truncatula]
Length=191

 Score =   199 bits (507),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKACEKTVYPV+ LSADG +YHK+CFRCSHCKGTLKLS+YSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNF--NKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE GNF  NKNFQSPAK AD  TP LTR+PSKAA MFSGTQEKCAT
Sbjct  61   HFEQLFKEHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMFSGTQEKCAT  112


 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHF  162

Query  396  EQLFKESGNFNKNFQ-SPAKSADKLTPEL  479
             QLFKE G++N   + +  K A    PE 
Sbjct  163  SQLFKEKGSYNHFIKFASIKRAAASVPEF  191



>emb|CDP14069.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   200 bits (509),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 106/115 (92%), Gaps = 5/115 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKAC KTVYPVELLSADG++YHKSCF+CSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKACVKTVYPVELLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTR-----SPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G+FNK+FQSPAKSA+KLTPEL       SPSKAA MFSGTQ+KCAT
Sbjct  61   HYEQLFKETGSFNKSFQSPAKSAEKLTPELASFPPYLSPSKAAGMFSGTQDKCAT  115


 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 56/112 (50%), Gaps = 36/112 (32%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVE------------------------------------LLSAD  287
            F GTQ KC  C KT YP+E                                     ++ +
Sbjct  106  FSGTQDKCATCGKTAYPLEKTINILVFNFLSRQPPLALHCTTIYFKKNDIGYNDLPVTVE  165

Query  288  GINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  443
              +YHKSCF+CSH   +L  SNY++++G+LYCKPHF QLFKE G++N   +S
Sbjct  166  NQSYHKSCFKCSHGGCSLSPSNYAALDGILYCKPHFSQLFKEKGSYNHLIKS  217



>emb|CAA62744.1| transcription factor L2 [Arabidopsis thaliana]
Length=172

 Score =   198 bits (503),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAKSADK TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCAT  110


 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFK  410
             QL +
Sbjct  161  AQLLR  165



>ref|XP_010928941.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=189

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKAC KTVY ++ LSADGI YHKSCF+C+HCKGTLKLSNYSS+EGVLYCKP
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNK+FQSPAKSA+KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCAT  110


 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQ-SPAKSADKLTPEL  479
             QLFKE G++N   + +  K     TP+L
Sbjct  161  SQLFKEKGSYNHLIKCASIKRTAASTPDL  189



>ref|XP_006848064.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
 gb|ERN09645.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
Length=189

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKACEKTVY ++ LSADG+ YHKSCF+C+HCKGTLKL NYSSMEGVLYCKP
Sbjct  1    MAFSGTQQKCKACEKTVYVMDQLSADGVLYHKSCFKCNHCKGTLKLGNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNK+FQSPAKS +KLTPELTRSPSKAASMFSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSVEKLTPELTRSPSKAASMFSGTQDKCAT  110


 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ KC  C KT YP+E ++ +  +YHKSCF+CSH    +  S Y+++E
Sbjct  92   RSPSKAASMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPSTYAALE  151

Query  369  GVLYCKPHFEQLFKESGNFN  428
            G+LYCK HF QLFKE G++N
Sbjct  152  GILYCKHHFSQLFKEKGSYN  171



>ref|NP_191136.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030868.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030869.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030870.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_680133.2| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 sp|Q9M047.1|WLI2B_ARATH RecName: Full=LIM domain-containing protein WLIM2b; AltName: 
Full=Widely-expressed LIM protein 2B [Arabidopsis thaliana]
 emb|CAB81602.1| transcription factor L2 [Arabidopsis thaliana]
 gb|AAL36280.1| putative transcription factor L2 [Arabidopsis thaliana]
 gb|AAM14188.1| putative transcription factor L2 [Arabidopsis thaliana]
 gb|AAM60942.1| transcription factor L2 [Arabidopsis thaliana]
 dbj|BAH19816.1| AT3G55770 [Arabidopsis thaliana]
 dbj|BAH20021.1| AT3G55770 [Arabidopsis thaliana]
 gb|AEE79434.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79435.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79436.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79437.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79438.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
Length=199

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAKSADK TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCAT  110


 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  AQLFKEKGSYNHLIKS  176



>ref|XP_006403418.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403419.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403420.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403421.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44871.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44872.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44873.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44874.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
Length=199

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADG++YH+SCF+C+HCK  L+LS YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVSYHRSCFKCTHCKSRLQLSRYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAK A+K +PELTR+PS+ A MFSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCAT  110


 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    L  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKITVESQTYHKSCFKCSHGGCPLSPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  AQLFKEKGSYNHLIKS  176



>ref|XP_002876333.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52592.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=199

 Score =   197 bits (501),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAK ADK TPELTR+PS+ AS FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPADKSTPELTRTPSRVASRFSGTQEKCAT  110


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  AQLFKEKGSYNHLIKS  176



>gb|EYU19976.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
 gb|EYU19977.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
Length=199

 Score =   197 bits (501),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF+GT QKCKACEKTVY VELLSADGI++HKSCFRCSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFLGTTQKCKACEKTVYHVELLSADGISFHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADK-LTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G+F KNF SPAKSA+K  TPE+TRSPSKAA MFSGTQ+KCAT
Sbjct  61   HYEQLFKETGSFTKNFTSPAKSAEKSSTPEMTRSPSKAAGMFSGTQDKCAT  111


 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +  +YHKSCF+CSH   +L  SNY++++G+LYCKPHF
Sbjct  102  FSGTQDKCATCAKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPSNYAALDGILYCKPHF  161

Query  396  EQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAAS  506
             QLFKE G++N   +S +         +  SP+  A+
Sbjct  162  SQLFKEKGSYNHVLKSASMKRPTAVVAVPDSPTHQAT  198



>ref|XP_010534537.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534538.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534539.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534540.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
Length=199

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVYPVELLSADG++YHKSCF+C+HCK  L+LSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F+KNFQSPAK A+K TPELTR+PSK A MFSGTQ+KC T
Sbjct  61   HFEQLFKETGSFHKNFQSPAKPAEKPTPELTRTPSKVAGMFSGTQDKCTT  110


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +  +YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQDKCTTCGKTVYPLEKVTVESQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  SQLFKEKGSYNHLIKS  176



>ref|XP_009118149.1| PREDICTED: pollen-specific protein SF3-like, partial [Brassica 
rapa]
Length=120

 Score =   193 bits (491),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SF GTQQKCKACEKTVYPVELLSADG++YHKSCF+C+HCK  L+LS YSSMEGVLYCKPH
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSRYSSMEGVLYCKPH  62

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            +EQLFKESG+F KNFQSPAK A+K +PELTR+PS+ A MFSGTQEKCAT
Sbjct  63   YEQLFKESGSFTKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCAT  111



>ref|NP_001190099.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79440.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
Length=233

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAKSADK TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCAT  110


 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 55/110 (50%), Gaps = 34/110 (31%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELL----------------------------------SADGI  293
            F GTQ+KC  C KTVYP+E +                                  + +  
Sbjct  101  FSGTQEKCATCSKTVYPIEKIHNPLSYRELARKPNVLHRCIDPGDIGSCYFNLHVTVESQ  160

Query  294  NYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQS  443
             YHKSCF+CSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S
Sbjct  161  TYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKS  210



>ref|XP_008798954.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKAC KTVY ++ LSADG++YHKSCF+C+HCKGTLKLSNYSS+EGVLYCKP
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGVSYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNK+FQSPAKSA+KLTPELTRSPSKAA MFSGTQEKC  
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCVA  110


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC AC KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCVACGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  161  SQLFKEKGSYN  171



>dbj|BAH20111.1| AT3G55770 [Arabidopsis thaliana]
Length=199

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKAC KTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACGKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAKSADK TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCAT  110


 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  161  AQLFKEKGSYNHLIKS  176



>emb|CDY24943.1| BnaC03g22290D [Brassica napus]
Length=197

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYP+ELLSADG+++HKSCF+CSHCK TL+LSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNKNFQSPAK   DK TPELTR+PS+ A MFSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCAT  111


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>emb|CDY60999.1| BnaA03g56620D [Brassica napus]
Length=200

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYP+ELLSADG+++HKSCF+CSHCK TL+LSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNKNFQSPAK   DK TPELTR+PS+ A MFSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCAT  111


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|XP_009133391.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 gb|AID61745.1| LIM domain-containing protein [Brassica rapa subsp. pekinensis]
Length=200

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYP+ELLSADG+++HKSCF+CSHCK TL+LSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNKNFQSPAK   DK TPELTR+PS+ A MFSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCAT  111


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>emb|CDY20498.1| BnaC04g05460D [Brassica napus]
 emb|CDX74822.1| BnaA05g05680D [Brassica napus]
Length=200

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYP+ELLSADG+ +HKSCF+CSHCK TL+LSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSTLQLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNKNFQSPAK   DK TPELTR+PS+ A MFSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCAT  111


 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|XP_009143273.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=199

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYP+ELLSADG+ +HKSCF+CSHCK TL+LSNYSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSTLQLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNKNFQSPAK   DK TPELTR+PS+ A MFSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCAT  111


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|XP_009139138.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 gb|AID61744.1| LIM domain-containing protein [Brassica rapa subsp. pekinensis]
Length=200

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SF GTQQKCKACEKTVYPVELLSADG++YHKSCF+C+HCK  L+LS YSSMEGVLYCKPH
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSRYSSMEGVLYCKPH  62

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            +EQLFKESG+F KNFQSPAK A+K +PELTR+PS+ A MFSGTQEKCAT
Sbjct  63   YEQLFKESGSFTKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCAT  111


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|XP_006295906.1| hypothetical protein CARUB_v10025036mg [Capsella rubella]
 gb|EOA28804.1| hypothetical protein CARUB_v10025036mg [Capsella rubella]
Length=200

 Score =   192 bits (488),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYPVELLSADG++YHKSCF+CSHCK  L+LSNYSSMEGV+YC+P
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F+KNFQSPAK  +DK TPELTR+PS+ A MFSGTQ+KCAT
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLSDKPTPELTRTPSRVAGMFSGTQDKCAT  111


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCNKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>emb|CDY02959.1| BnaC04g25270D [Brassica napus]
Length=269

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            +  + RMS F GTQQKCKACEKTVYPVELLSADG++YHKSCF+CSHCK  L+LS YSSME
Sbjct  64   KGVEGRMSSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSME  123

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            GVLYCKPH+EQLFKESG+F KNFQSPAK A+K  PELTR+PS+ A MFSGTQEKCAT
Sbjct  124  GVLYCKPHYEQLFKESGSFTKNFQSPAKPAEKSNPELTRTPSRVAGMFSGTQEKCAT  180


 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  171  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  230

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  231  AQLFKEKGSYNHLIKS  246



>emb|CDX76073.1| BnaA04g03370D [Brassica napus]
Length=270

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            +  + RMS F GTQQKCKACEKTVYPVELLSADG+ YHKSCF+C+HCK  L+LS YSSME
Sbjct  65   KGVEGRMSSFTGTQQKCKACEKTVYPVELLSADGVTYHKSCFKCTHCKSRLQLSRYSSME  124

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            GVLYCKPH+EQLFKESG+F KNFQSPAK A+K +PELTR+PS+ A MFSGTQEKCAT
Sbjct  125  GVLYCKPHYEQLFKESGSFTKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCAT  181


 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  172  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  231

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  232  AQLFKEKGSYNHLIKS  247



>ref|XP_010516165.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
Length=197

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADK-LTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAK ADK  TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPADKSTTPELTRTPSRVAGRFSGTQEKCAT  111


 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    L  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|XP_010427370.1| PREDICTED: LIM domain-containing protein WLIM2b [Camelina sativa]
Length=200

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADK-LTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAK ADK  TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPADKSATPELTRTPSRVAGRFSGTQEKCAT  111


 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    L  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|XP_002879831.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56090.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYPVELLSADGI+YHKSCF+CSHCK  L+LSNYSSMEGV+YC+P
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGISYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F+KNFQSPAK   DK TPELTR+PS+ A MFSGTQ+KCAT
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLTDKPTPELTRTPSRLAGMFSGTQDKCAT  111


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>gb|EPS58831.1| hypothetical protein M569_15983, partial [Genlisea aurea]
Length=189

 Score =   191 bits (485),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCK CEKTVYPVELLSADG++YHK CF+C+ CKGTLKLSNYSSM+GVLYCKP
Sbjct  1    MSFIGTQQKCKVCEKTVYPVELLSADGVDYHKHCFKCTFCKGTLKLSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            H+EQLFKE+G+F KNFQSP+KSA+K +P LT+SPSKAA MFSGT +KCA 
Sbjct  61   HYEQLFKETGSFTKNFQSPSKSAEKPSPTLTKSPSKAAGMFSGTVDKCAV  110


 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC  C KT YP+E +S +  +YHKSCF+CSH   +L  SNY++++G+LYCKPHF
Sbjct  101  FSGTVDKCAVCGKTAYPLEKVSVENQSYHKSCFKCSHGGCSLTPSNYAALDGILYCKPHF  160

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPE  476
             QLFKE G++N    SP+ K +  + P+
Sbjct  161  SQLFKEKGSYNHLKNSPSVKRSTAIVPD  188



>ref|XP_006411232.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 ref|XP_006411233.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 ref|XP_006411234.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52685.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52686.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52687.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
Length=203

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYP+ELLSADG+ +HKSCF+CSHCK  L+LSNYSSMEGVLYCKP
Sbjct  2    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSRLQLSNYSSMEGVLYCKP  61

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNKNFQSPAK   DK TPELTR+PS+ A MFSGTQ+KCAT
Sbjct  62   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCAT  112


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  163  AQLFKEKGSYNHLIKS  178



>ref|XP_010517368.1| PREDICTED: LIM domain-containing protein WLIM2a [Camelina sativa]
Length=201

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYPVELLSADG++YHKSCF+CSHCK  L+LSNYSSMEGV+YC+P
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F+KNFQSPAK  +DK TPELTR+PS+ A +FSGTQ+KCAT
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLSDKPTPELTRTPSRVAGLFSGTQDKCAT  111


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|XP_010508950.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
Length=199

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYPVELLSADG++YHKSCF+CSHCK  L+LSNYSSMEGV+YC+P
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F+KNFQSPAK  +DK TPELTR+PS+ A +FSGTQ+KCAT
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLSDKPTPELTRTPSRVAGLFSGTQDKCAT  111


 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  162  AQLFKEKGSYN  172



>ref|XP_008785448.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKAC+KTVY ++ LSADGI YHKSCF+C+HCKGTLKLSNYSS+EGVLYCKP
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNK+FQSPAK A+K TPELTRS SKAA MFSGTQEKCAT
Sbjct  61   HFEQLFKETGSFNKSFQSPAKPAEKPTPELTRSRSKAAGMFSGTQEKCAT  110


 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KT YP+E ++ +G  YHK CFRCSH   ++  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHKFCFRCSHGGCSISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPEL  479
             QLFKE G++N   +S + K     TP+L
Sbjct  161  SQLFKEKGSYNHLIKSASIKRTAASTPDL  189



>ref|XP_009404566.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   189 bits (481),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
             +F GTQQKCKAC+KTVY ++ L+ADG+ +HKSCF+C+HCKGTL LS YSSMEGVLYCKP
Sbjct  3    FNFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKP  62

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNFNKNFQSPAKSA+K  PELTRSPSKAASMFSGTQEKCAT
Sbjct  63   HFEQLFKESGNFNKNFQSPAKSAEK-APELTRSPSKAASMFSGTQEKCAT  111


 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RS  K  S F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH   ++  SNY+++E
Sbjct  93   RSPSKAASMFSGTQEKCATCAKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALE  152

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPEL  479
            G+LYCK HF QLFKE G++N   +S + K +    P+L
Sbjct  153  GILYCKHHFSQLFKEKGSYNHLIKSASIKRSAATAPDL  190



>ref|XP_010504446.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
 ref|XP_010504447.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
Length=200

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADK-LTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+FNKNFQSPAK  DK  TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPTDKSATPELTRTPSRVAGRFSGTQEKCAT  111


 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    L  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|XP_010505685.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
 ref|XP_010505686.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
Length=207

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYPVELLSADG++YHKSCF+CSHCK  L+LSNYSSMEGV+YC+P
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F+KNFQSPAK  ++K TPELTR+PS+ A +FSGTQ+KCAT
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLSEKATPELTRTPSRVAGLFSGTQDKCAT  111


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  162  AQLFKEKGSYNHLIKS  177



>ref|NP_181519.1| protein WLIM2A [Arabidopsis thaliana]
 sp|O04193.1|WLI2A_ARATH RecName: Full=LIM domain-containing protein WLIM2a; AltName: 
Full=Widely-expressed LIM protein 2; Short=AtWLIM2 [Arabidopsis 
thaliana]
 gb|AAB95275.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AAM19819.1| At2g39900/T28M21.6 [Arabidopsis thaliana]
 gb|AAM67434.1| At2g39900/T28M21.6 [Arabidopsis thaliana]
 gb|AEC09747.1| protein WLIM2A [Arabidopsis thaliana]
Length=200

 Score =   189 bits (479),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKC+ACEKTVYPVELLSADGI+YHK+CF+CSHCK  L+LSNYSSMEGV+YC+P
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  390  HFEQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F+KNFQSPAK   DK TPEL R+PS+ A MFSGTQ+KCAT
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLTDKPTPELNRTPSRLAGMFSGTQDKCAT  111


 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +3

Query  186  DFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYS  359
            +   T  R++  F GTQ KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+
Sbjct  90   ELNRTPSRLAGMFSGTQDKCATCTKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYA  149

Query  360  SMEGVLYCKPHFEQLFKESGNFNKNFQS  443
            ++EG+LYCK HF QLFKE G++N   +S
Sbjct  150  ALEGILYCKHHFAQLFKEKGSYNHLIKS  177



>ref|XP_009116276.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=201

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SF GTQQKCKACEKTVYPVELLSADG++YHKSCF+CSHCK  L+LS YSSMEGVLYCKPH
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKPH  62

Query  393  FEQLFKESGNFNKNFQSPAK-SADKLTPELTRSPSKAASMFSGTQEKCAT  539
            +EQLFKESG+F KNFQSP K +A+K +PELTR+PS+ A MFSGTQEKCAT
Sbjct  63   YEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCAT  112


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  163  AQLFKEKGSYNHLIKS  178



>emb|CDX72203.1| BnaC08g26710D [Brassica napus]
Length=201

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SF GTQQKCKACEKTVYPVELLSADG++YHKSCF+CSHCK  L+LS YSSMEGVLYCKPH
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKPH  62

Query  393  FEQLFKESGNFNKNFQSPAK-SADKLTPELTRSPSKAASMFSGTQEKCAT  539
            +EQLFKESG+F KNFQSP K +A+K +PELTR+PS+ A MFSGTQEKCAT
Sbjct  63   YEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCAT  112


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  163  AQLFKEKGSYNHLIKS  178



>emb|CDY27267.1| BnaA09g35350D [Brassica napus]
Length=201

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SF GTQQKCKACEKTVYPVELLSADG++YHKSCF+CSHCK  L+LS YSSMEGVLYCKPH
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKPH  62

Query  393  FEQLFKESGNFNKNFQSPAK-SADKLTPELTRSPSKAASMFSGTQEKCAT  539
            +EQLFKESG+F KNFQSP K +A+K +PELTR+PS+ A MFSGTQEKCAT
Sbjct  63   YEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCAT  112


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  163  AQLFKEKGSYNHLIKS  178



>ref|XP_010923152.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Elaeis 
guineensis]
Length=189

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKAC+KTVY ++ LSADGI YHKSCF+C+HCKGTLKLSNYSS+EGVLYCKP
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNK+FQSPAKSA+K  PELTRS SKAA MFSGT EKCAT
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKSNPELTRSRSKAAGMFSGTLEKCAT  110


 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT +KC  C KT YP+E ++ +G  YHKSCFRCSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTLEKCATCGKTAYPLEKVTVEGQAYHKSCFRCSHGGCPISPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPEL  479
             QLFKE G++N   +S + K     TP+L
Sbjct  161  SQLFKEKGSYNHLIKSASIKRTAASTPDL  189



>gb|ABK22125.1| unknown [Picea sitchensis]
Length=197

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKAC+KTVY V+ LSADG++YHKSCFRC+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKSCFRCNHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQS--PAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HF+QLF+ESGNFNKNFQS   +K  D L+PELTRSPSK + MFSGTQ+KCAT
Sbjct  61   HFDQLFRESGNFNKNFQSQRSSKVIDGLSPELTRSPSKVSMMFSGTQDKCAT  112


 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K  M F GTQ KC  C KT YP+E ++ + ++YHKSCF+CSH   ++  SNY+++EG+L
Sbjct  97   SKVSMMFSGTQDKCATCGKTAYPLEKVTVESLSYHKSCFKCSHGGCSISPSNYAALEGIL  156

Query  378  YCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRS  488
            YCK HF QLFKE G++N   ++         PE+  +
Sbjct  157  YCKHHFSQLFKEKGSYNHLIKTATMKRAAAVPEVASA  193



>ref|XP_009421306.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
             +F GTQQKCKAC+KTVY ++ L+ADG+ +HKSCF+C+HCKGTL LS YSSMEGVLYCKP
Sbjct  3    FNFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKP  62

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNFNKNFQSPAKSA+K  PELTRS SKAASMFSGTQEKCAT
Sbjct  63   HFEQLFKESGNFNKNFQSPAKSAEK-APELTRSTSKAASMFSGTQEKCAT  111


 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +3

Query  192  RSTKKRMS-FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            RST K  S F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH   ++  SNY+++E
Sbjct  93   RSTSKAASMFSGTQEKCATCTKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALE  152

Query  369  GVLYCKPHFEQLFKESGNFNKNFQSPA-KSADKLTPEL  479
            G+LYCK HF QLFKE G++N   +S + K A    P+L
Sbjct  153  GILYCKHHFSQLFKEKGSYNHLIKSASIKRAAATAPDL  190



>gb|KDO36535.1| hypothetical protein CISIN_1g034188mg [Citrus sinensis]
Length=102

 Score =   181 bits (458),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCK CEKTVYPVE LSADGI YHKSCF+CSHCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MSFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTR  485
            HFEQLFKESGNFNKNFQSPAKSA+KLTPEL  
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELVN  92



>emb|CBL95262.1| lim domain protein [Pinus pinaster]
Length=197

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKAC+KTVY V+ LSADG++YHK+CFRC+HCKGTLKLSNYSSMEGVLYCKP
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKACFRCNHCKGTLKLSNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQS--PAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HF+QLF+ESGNFNKNFQS   +K+ D L PE+TRSPSK + MF GTQ+KC T
Sbjct  61   HFDQLFRESGNFNKNFQSQRSSKAIDGLQPEMTRSPSKVSMMFFGTQDKCGT  112


 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K  M F GTQ KC  C KT YP+E ++   +++HKSCFRCSH   ++  SNY+++EG+L
Sbjct  97   SKVSMMFFGTQDKCGTCGKTAYPLEKVTVGNLSFHKSCFRCSHGGCSISPSNYAALEGIL  156

Query  378  YCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRS  488
            YCK HF QLFKE G++N   ++ +       PE+  +
Sbjct  157  YCKHHFSQLFKEKGSYNHLIKTASMKRAAAVPEVASA  193



>ref|XP_006431569.1| hypothetical protein CICLE_v10003359mg [Citrus clementina]
 gb|ESR44809.1| hypothetical protein CICLE_v10003359mg [Citrus clementina]
Length=167

 Score =   178 bits (451),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCK CEKTV PVE LS DG+ YHKSCF+CSHCKGTLKLSNYSS+EGVLYCKP
Sbjct  1    MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSHCKGTLKLSNYSSLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASM  509
            HFEQL KES NFNKNFQ PAKSA+KLTPEL RSPSK AS+
Sbjct  61   HFEQLLKESSNFNKNFQLPAKSAEKLTPELRRSPSKVASI  100


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  252  KTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  428
            KTV P E ++A+    HK+CF+CSH   ++  SNY+++EG+LYCK +F QLFKE G++N
Sbjct  101  KTVCPWEKVAAENQASHKTCFKCSHGGYSISPSNYAALEGILYCKHNFSQLFKEKGSYN  159



>gb|KHN13088.1| Pollen-specific protein SF3 [Glycine soja]
Length=116

 Score =   176 bits (446),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 95/106 (90%), Gaps = 4/106 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCKAC KTVYPV+ LSA    YHK+CF+CSHC+GTLKLSNYSSME VLYCKP
Sbjct  1    MSFIGTQQKCKACGKTVYPVDQLSA----YHKACFKCSHCEGTLKLSNYSSMESVLYCKP  56

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQE  527
            H EQLFKE+G+F KNFQSP+K ADK TPELTRSPSKAASMFSGT++
Sbjct  57   HNEQLFKETGSFKKNFQSPSKQADKTTPELTRSPSKAASMFSGTKK  102



>ref|XP_006431570.1| hypothetical protein CICLE_v10003747mg [Citrus clementina]
 gb|ESR44810.1| hypothetical protein CICLE_v10003747mg [Citrus clementina]
Length=162

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCK CEKTV PVE LS DG+ YHKSCF+CSHCKGTLKLSNYSS+EG LYCKP
Sbjct  1    MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSHCKGTLKLSNYSSLEGALYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASM  509
            HFEQL KES NFNKNFQ PAKSA+KLTPEL RSPSK AS+
Sbjct  61   HFEQLLKESSNFNKNFQLPAKSAEKLTPELRRSPSKVASI  100


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  252  KTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  428
            KTV P E ++A+    HK+CF+CSH   ++  SNY+++EG+LYCK +F QLFKE G++N
Sbjct  101  KTVCPWENVAAENQASHKTCFKCSHGGYSISPSNYAALEGILYCKHNFSQLFKEKGSYN  159



>gb|KDO39245.1| hypothetical protein CISIN_1g040725mg, partial [Citrus sinensis]
Length=164

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  KRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYC  383
            K  SFIGTQQK K  EKTVYPVE LS DG+ YHKSCF+CSHCKGTLKLSNYSSMEGVLYC
Sbjct  2    KAKSFIGTQQKYKVYEKTVYPVEQLSDDGVVYHKSCFKCSHCKGTLKLSNYSSMEGVLYC  61

Query  384  KPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASM  509
            KPHFEQLFKESGN NKNFQSPA+  +K TPELTRSPSKAAS+
Sbjct  62   KPHFEQLFKESGNINKNFQSPARLVEKSTPELTRSPSKAASI  103



>emb|CBI40313.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   177 bits (448),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LLSADG +YHK+CF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+ AK ADKL  EL+R+PSK +SMFSGTQ+KC+
Sbjct  61   HFEQLFKESGNFSKNFQTSAKPADKLN-ELSRAPSKLSSMFSGTQDKCS  108


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSS  362
            F GTQ KC AC KTVYP+E ++ +G +YHKSCF+C+H    L  S+Y++
Sbjct  100  FSGTQDKCSACRKTVYPLEKVTLEGESYHKSCFKCAHGGCPLTHSSYAA  148



>ref|XP_006827708.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
 gb|ERM95124.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
Length=195

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT QKCK C+KTVY V+LLSADG+NYHKSCF+CSHCKGTL +SNYSS+EGVLYCKP
Sbjct  1    MAFSGTLQKCKMCDKTVYVVDLLSADGVNYHKSCFKCSHCKGTLSISNYSSLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+FNK+FQ P KSADK   +L R+PSK +S+FSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFNKSFQLPPKSADK-QHDLARAPSKLSSLFSGTQDKCAT  109


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +G +YHKSCF+CSH    L  S Y++++G+LYCK HF
Sbjct  100  FSGTQDKCATCYKTAYPLEKVTVEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHF  159

Query  396  EQLFKESGNFN  428
             QLFKE GN+N
Sbjct  160  AQLFKEKGNYN  170



>ref|XP_006438563.1| hypothetical protein CICLE_v10033840mg, partial [Citrus clementina]
 gb|ESR51803.1| hypothetical protein CICLE_v10033840mg, partial [Citrus clementina]
Length=160

 Score =   175 bits (444),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SFIGTQQK K  EKTVYPVE LS DG+ YHKSCF+CSHCKGTLKLSNYSSMEGVLYCKPH
Sbjct  1    SFIGTQQKYKVYEKTVYPVEQLSDDGVVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH  60

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASM  509
            FEQLFKESGN NKNFQSPA+  +K TPELTRSPSKAAS+
Sbjct  61   FEQLFKESGNINKNFQSPARLVEKSTPELTRSPSKAASI  99



>ref|XP_002269537.1| PREDICTED: LIM domain-containing protein PLIM2c [Vitis vinifera]
 emb|CAN74803.1| hypothetical protein VITISV_006290 [Vitis vinifera]
Length=220

 Score =   177 bits (448),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LLSADG +YHK+CF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+ AK ADKL  EL+R+PSK +SMFSGTQ+KC+
Sbjct  61   HFEQLFKESGNFSKNFQTSAKPADKLN-ELSRAPSKLSSMFSGTQDKCS  108


 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G +YHKSCF+C+H    L  S+Y+++ GVLYCK HF
Sbjct  100  FSGTQDKCSACRKTVYPLEKVTLEGESYHKSCFKCAHGGCPLTHSSYAALNGVLYCKHHF  159

Query  396  EQLFKESGNFNKNFQS  443
             QLF E GN++   ++
Sbjct  160  SQLFMEKGNYSHVLEA  175



>ref|NP_001049655.1| Os03g0266100 [Oryza sativa Japonica Group]
 gb|AAP06876.1| putative LIM-domain protein [Oryza sativa Japonica Group]
 gb|ABF95147.1| Pollen-specific protein SF3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11569.1| Os03g0266100 [Oryza sativa Japonica Group]
 gb|EAY89369.1| hypothetical protein OsI_10876 [Oryza sativa Indica Group]
 gb|EAZ26370.1| hypothetical protein OsJ_10253 [Oryza sativa Japonica Group]
 dbj|BAG86715.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAM13336.1| LIM domain-containing protein [Oryza rufipogon]
 dbj|BAM13337.1| LIM domain-containing protein [Oryza barthii]
 gb|AFI80892.1| LIM-domain protein [Oryza sativa Japonica Group]
Length=196

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL L NYSS+EGV YCKPHF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHF  61

Query  396  EQLFKESGNFNKNFQSPAKSA-DKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+FQSPAK A +KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  62   EQLFKETGSYNKSFQSPAKPASEKLTPELTRSPSKAARMFSGTQEKCAT  110


 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  207  RMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCK  386
            RM F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++EG+LYCK
Sbjct  99   RM-FSGTQEKCATCSKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPSNYAALEGILYCK  157

Query  387  PHFEQLFKESGNFN  428
             HF QLFKE G++N
Sbjct  158  HHFSQLFKEKGSYN  171



>dbj|BAM13338.1| LIM domain-containing protein [Oryza punctata]
Length=196

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL L NYSS+EGV YCKPHF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHF  61

Query  396  EQLFKESGNFNKNFQSPAKSA-DKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+FQSPAK A +KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  62   EQLFKETGSYNKSFQSPAKPASEKLTPELTRSPSKAARMFSGTQEKCAT  110


 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  195  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGV  374
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++EG+
Sbjct  95   SKAARM-FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPSNYAALEGI  153

Query  375  LYCKPHFEQLFKESGNFN  428
            LYCK HF QLFKE G++N
Sbjct  154  LYCKHHFSQLFKEKGSYN  171



>dbj|BAM13339.1| LIM domain-containing protein [Oryza officinalis]
Length=196

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL L NYSS+EGV YCKPHF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHF  61

Query  396  EQLFKESGNFNKNFQSPAKSA-DKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+FQSPAK A +KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  62   EQLFKETGSYNKSFQSPAKPASEKLTPELTRSPSKAARMFSGTQEKCAT  110


 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  195  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGV  374
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++EG+
Sbjct  95   SKAARM-FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPSNYAALEGI  153

Query  375  LYCKPHFEQLFKESGNFN  428
            LYCK HF QLFKE G++N
Sbjct  154  LYCKHHFSQLFKEKGSYN  171



>dbj|BAM13335.1| LIM domain-containing protein [Oryza nivara]
Length=196

 Score =   174 bits (442),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL L NYSS+EGV YC+PHF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCRPHF  61

Query  396  EQLFKESGNFNKNFQSPAKSA-DKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+FQSPAK A +KLTPELTRSPSKAA MFSGTQEKCAT
Sbjct  62   EQLFKETGSYNKSFQSPAKPASEKLTPELTRSPSKAARMFSGTQEKCAT  110


 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  195  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGV  374
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++EG+
Sbjct  95   SKAARM-FSGTQEKCATCSKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPSNYAALEGI  153

Query  375  LYCKPHFEQLFKESGNFN  428
            LYCK HF QLFKE G++N
Sbjct  154  LYCKHHFSQLFKEKGSYN  171



>dbj|BAM13341.1| LIM domain-containing protein [Oryza australiensis]
Length=196

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL L NYSS+EGV YCKPHF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHF  61

Query  396  EQLFKESGNFNKNFQSPAKSA-DKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+FQSPAK A +KL PELTRSPSKAA MFSGTQEKCAT
Sbjct  62   EQLFKETGSYNKSFQSPAKPASEKLIPELTRSPSKAARMFSGTQEKCAT  110


 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  195  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGV  374
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++EG+
Sbjct  95   SKAARM-FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPSNYAALEGI  153

Query  375  LYCKPHFEQLFKESGNFN  428
            LYCK HF QLFKE G++N
Sbjct  154  LYCKHHFSQLFKEKGSYN  171



>dbj|BAM13340.1| LIM domain-containing protein [Oryza latifolia]
Length=196

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL L NYSS+EGV YCKPHF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHF  61

Query  396  EQLFKESGNFNKNFQSPAKSA-DKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+FQSPAK A +KL PELTRSPSKAA MFSGTQEKCAT
Sbjct  62   EQLFKETGSYNKSFQSPAKPASEKLIPELTRSPSKAARMFSGTQEKCAT  110


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  195  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGV  374
            S   RM F GTQ+KC  C KT YP+E ++ +G  YHKSCF+CSH    +  SNY+++EG+
Sbjct  95   SKAARM-FSGTQEKCATCFKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPSNYAALEGI  153

Query  375  LYCKPHFEQLFKESGNFN  428
            LYCK HF QLFKE G++N
Sbjct  154  LYCKHHFSQLFKEKGSYN  171



>ref|XP_006649807.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
 dbj|BAM13342.1| LIM domain-containing protein [Oryza brachyantha]
Length=195

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL L NYSS+EGV YCKPHF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLGNYSSIEGVPYCKPHF  61

Query  396  EQLFKESGNFNKNFQSPAKS-ADKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+FQSPAK  ++KLTP+LTRSPSKAA MFSGTQEKCAT
Sbjct  62   EQLFKETGSYNKSFQSPAKPISEKLTPDLTRSPSKAARMFSGTQEKCAT  110


 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +3

Query  195  STKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGV  374
            S   RM F GTQ+KC  C KT YP+E ++ +G +YHKSCF+CSH    +  SNY+++EG+
Sbjct  95   SKAARM-FSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCAISPSNYAALEGI  153

Query  375  LYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPE  476
            LYCK HF QLFKE G++N   +  +    +  PE
Sbjct  154  LYCKHHFSQLFKEKGSYNHLIKCASVKRSEAQPE  187



>ref|XP_010690195.1| PREDICTED: LIM domain-containing protein WLIM2b [Beta vulgaris 
subsp. vulgaris]
Length=203

 Score =   171 bits (433),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCK C+KTVY ++ LSADG+ YHKSCF+C+HCK  L+L ++SSM+G LYCKP
Sbjct  1    MSFTGTQQKCKVCDKTVYLMDQLSADGVAYHKSCFKCNHCKNKLQLHSFSSMDGALYCKP  60

Query  390  HFEQLFKESGNFNKNFQSP----AKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNFNKNFQSP    A+ +  + PELTRSPSKAA MFSGTQEKC T
Sbjct  61   HFEQLFKETGNFNKNFQSPTRLLAEKSPDVKPELTRSPSKAARMFSGTQEKCTT  114


 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  207  RMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCK  386
            RM F GTQ+KC  C KTVYP+E ++ + + YHK CF+CSH   ++  SNY++++G+LYCK
Sbjct  103  RM-FSGTQEKCTTCSKTVYPIEKVTVENLFYHKFCFKCSHGGCSITPSNYAALDGILYCK  161

Query  387  PHFEQLFKESGNF  425
             HF QLF+E G++
Sbjct  162  HHFSQLFREKGSY  174



>ref|XP_006291888.1| hypothetical protein CARUB_v10018065mg [Capsella rubella]
 gb|EOA24786.1| hypothetical protein CARUB_v10018065mg [Capsella rubella]
Length=190

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 90/110 (82%), Gaps = 9/110 (8%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKES          AK ADK TPELTR+PS+ A  FSGTQEKCAT
Sbjct  61   HFEQLFKESA---------AKPADKSTPELTRTPSRVAGRFSGTQEKCAT  101


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ+KC  C KTVYP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  92   FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  151

Query  396  EQLFKESGNFNKNFQS  443
             QLFKE G++N   +S
Sbjct  152  AQLFKEKGSYNHLIKS  167



>ref|XP_006423310.1| hypothetical protein CICLE_v10030332mg, partial [Citrus clementina]
 gb|ESR36550.1| hypothetical protein CICLE_v10030332mg, partial [Citrus clementina]
Length=108

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCK CEKTVYPVE LSADGI YHKSCF+CSHCKGTLKLSNYSSMEGVLY KP
Sbjct  1    MSFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYFKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLT  470
            HFEQLFKESGNFNKNFQSPAK  +KLT
Sbjct  61   HFEQLFKESGNFNKNFQSPAKLIEKLT  87



>ref|XP_006339787.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=221

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KC AC+KTVY V+LLSADG+ YHKSCF+CSHC+GTL +SNYSSM+G+LYCK 
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCRGTLVMSNYSSMDGILYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+PAKS  +    LTR+PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQNPAKSERQ--NSLTRAPSKLSAMFSGTQDKCA  107


 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++G LYCK HF
Sbjct  99   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCALTHATYASLDGNLYCKHHF  158

Query  396  EQLFKESGNFNKNFQSP--AKSADKLTP  473
             QLF E GN+    ++    K++  +TP
Sbjct  159  AQLFMEKGNYQHVLKAANNKKNSAAITP  186



>tpg|DAA44554.1| TPA: putative LIM-type zinc finger domain family protein, partial 
[Zea mays]
Length=127

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL LSNYSS EGV YCK HF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLSNYSSFEGVPYCKTHF  61

Query  396  EQLFKESGNFNKNF--QSPAK-SADKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+F  QSPAK + +KL PELTRSPSKAA MFSGTQ+KCAT
Sbjct  62   EQLFKETGSYNKSFQSQSPAKITPEKLAPELTRSPSKAARMFSGTQDKCAT  112



>ref|XP_010255661.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Nelumbo 
nucifera]
Length=199

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT QKCKAC+KTVY V+LLSADG+ YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MSFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F+KNFQ+    ++K   +L R+PSK +SMFSGTQ+KCA 
Sbjct  61   HFEQLFKETGSFSKNFQT--GKSEKQNDQLARAPSKLSSMFSGTQDKCAA  108


 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KT YP+E ++ +G +YHKSCF+CSH    L  S Y++++G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTAYPLEKVTLEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHF  158

Query  396  EQLFKESGNFN  428
             QLFKE GN+N
Sbjct  159  AQLFKEKGNYN  169



>ref|XP_009624528.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=207

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 10/113 (9%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LL+ADGI YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPE----LTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE GNF+KNFQ+ AK      PE    LTR+PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKECGNFSKNFQTTAK------PEREHALTRTPSKLSAMFSGTQDKCA  107


 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++GVLYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHF  158

Query  396  EQLFKESGNFNKNFQSPAKSADKLTPELTR  485
             QLF E G +    +  A +  K+  E T 
Sbjct  159  AQLFMEKGTYQHVLE--AANHKKINNEATN  186



>ref|XP_011469035.1| PREDICTED: LIM domain-containing protein PLIM2a-like isoform 
X3 [Fragaria vesca subsp. vesca]
Length=119

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKACEKTVY V++LS +G+ YHKSCF+CSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACEKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKSA+K    L R+PSK +SMFSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNF--AAKSAEKQNEVLNRAPSKLSSMFSGTQDKCAT  108



>tpg|DAA44552.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
Length=141

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL LSNYSS EGV YCK HF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLSNYSSFEGVPYCKTHF  61

Query  396  EQLFKESGNFNKNF--QSPAK-SADKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+F  QSPAK + +KL PELTRSPSKAA MFSGTQ+KCAT
Sbjct  62   EQLFKETGSYNKSFQSQSPAKITPEKLAPELTRSPSKAARMFSGTQDKCAT  112



>ref|XP_009762122.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|ACB05475.1| LIM domain protein 2b [Nicotiana tabacum]
Length=216

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LL+ADGI YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE GNF+KNFQ+ AK   +    LTR+PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKECGNFSKNFQTSAKPEREHA--LTRTPSKLSAMFSGTQDKCA  107


 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++GVLYCK HF
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHF  158

Query  396  EQLFKESGNF  425
             QLF E G +
Sbjct  159  AQLFMEKGTY  168



>ref|XP_002468127.1| hypothetical protein SORBIDRAFT_01g040050 [Sorghum bicolor]
 gb|EER95125.1| hypothetical protein SORBIDRAFT_01g040050 [Sorghum bicolor]
Length=197

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL LSNYSS EGV YCK HF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVAFHRSCFKCQHCKSTLSLSNYSSFEGVPYCKAHF  61

Query  396  EQLFKESGNFNKNF--QSPAK-SADKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+F  QSPAK + +KL PELTRSPSKAA MFSGTQ+KCAT
Sbjct  62   EQLFKETGSYNKSFQSQSPAKITPEKLAPELTRSPSKAARMFSGTQDKCAT  112


 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  207  RMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCK  386
            RM F GTQ KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++EG+LYCK
Sbjct  101  RM-FSGTQDKCATCGKTAYPLEKVTVEEKAYHKSCFKCSHGGCAITPSNYAALEGILYCK  159

Query  387  PHFEQLFKESGNFNKNFQ-SPAKSADKLTPELTRSPS  494
             HF QLFKE G++N   + +  K A +  PE   S S
Sbjct  160  HHFSQLFKEKGSYNHLIKCASVKRAAEAQPEQPASDS  196



>ref|NP_001288583.1| uncharacterized protein LOC101266456 [Solanum lycopersicum]
 gb|AGV29549.1| PLIM2a [Solanum lycopersicum]
Length=223

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KC AC+KTVY V+LLSADG+ YHKSCF+CSHCKGTL +SNYSSM+G+LYCK 
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMDGILYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+ AKS  +    LTR+PSK +++FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQNSAKS--ERQNSLTRAPSKLSALFSGTQDKCA  107


 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++G LYCK HF
Sbjct  99   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCALTHATYASLDGNLYCKHHF  158

Query  396  EQLFKESGNF  425
             QLF E GN+
Sbjct  159  AQLFMEKGNY  168



>ref|XP_004984674.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=199

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL LSNYSS EGV YCK HF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLSNYSSFEGVPYCKAHF  61

Query  396  EQLFKESGNFNKNF--QSPAK-SADKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+F  QSPAK + +KL PELTRSPSKAA MFSGTQ+KCAT
Sbjct  62   EQLFKETGSYNKSFQSQSPAKLTPEKLAPELTRSPSKAARMFSGTQDKCAT  112


 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 1/100 (1%)
 Frame = +3

Query  207  RMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCK  386
            RM F GTQ KC  C KT YP+E ++ +   YHKSCF+CSH    +  SNY+++EG LYCK
Sbjct  101  RM-FSGTQDKCATCGKTAYPLEKVTVEEKAYHKSCFKCSHGGCAITPSNYAALEGTLYCK  159

Query  387  PHFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAAS  506
             HF QLFKE G++N   +  +    +  PE    P+  +S
Sbjct  160  HHFSQLFKEKGSYNHLIKCASVKRAEAQPEQPAQPAADSS  199



>ref|NP_001147673.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG28333.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG44688.1| pollen-specific protein SF3 [Zea mays]
 gb|ACN35331.1| unknown [Zea mays]
 tpg|DAA44553.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB05137.1| LIM transcription factor, partial [Zea mays]
Length=198

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG+ +H+SCF+C HCK TL LSNYSS EGV YCK HF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGVVFHRSCFKCQHCKSTLSLSNYSSFEGVPYCKTHF  61

Query  396  EQLFKESGNFNKNF--QSPAK-SADKLTPELTRSPSKAASMFSGTQEKCAT  539
            EQLFKE+G++NK+F  QSPAK + +KL PELTRSPSKAA MFSGTQ+KCAT
Sbjct  62   EQLFKETGSYNKSFQSQSPAKITPEKLAPELTRSPSKAARMFSGTQDKCAT  112


 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = +3

Query  207  RMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCK  386
            RM F GTQ KC  C KT YP+E ++ +  +YHKSCF+CSH    +  SNY+++EG+LYCK
Sbjct  101  RM-FSGTQDKCATCGKTAYPLEKVTVEEKSYHKSCFKCSHGGCAITPSNYAALEGILYCK  159

Query  387  PHFEQLFKESGNFNKNFQ-SPAKSADKLTPELTRSPS  494
             HF QLFKE G++N   + +  K A +  PE   S S
Sbjct  160  HHFSQLFKEKGSYNHLIKCASVKRAAEAQPEQPASDS  196



>ref|XP_007036740.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOY21241.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=101

 Score =   160 bits (404),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  231  QKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFK  410
            +KCKACEKTVYPVELLSADG+ YHKSCF+CSHCKGTLKL NYSSMEGVLYCKPHFEQLFK
Sbjct  2    KKCKACEKTVYPVELLSADGLPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFK  61

Query  411  ESGNFNKNFQSPAKSADKLTPELTRSPSKAASMF  512
            E+GNFNKNFQSP +SA+KLT EL  + + A+S+ 
Sbjct  62   ETGNFNKNFQSPVESAEKLTSELHFAFANASSLI  95



>ref|XP_011469034.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=217

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKACEKTVY V++LS +G+ YHKSCF+CSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACEKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKSA+K    L R+PSK +SMFSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNF--AAKSAEKQNEVLNRAPSKLSSMFSGTQDKCAT  108


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G +YHKSCFRC+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHSSYAALDGILYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPAKSADK  464
             QLF E GN++   Q+  K   K
Sbjct  159  AQLFMEKGNYSHVLQAAKKHQPK  181



>ref|XP_009624529.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=206

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LL+ADGI YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE GNF+KNFQ+     +     LTR+PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKECGNFSKNFQTTKPEREH---ALTRTPSKLSAMFSGTQDKCA  106


 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++GVLYCK HF
Sbjct  98   FSGTQDKCAACKKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHF  157

Query  396  EQLFKESGNFNKNFQSPAKSADKLTPELTR  485
             QLF E G +    +  A +  K+  E T 
Sbjct  158  AQLFMEKGTYQHVLE--AANHKKINNEATN  185



>ref|XP_004306805.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=216

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKACEKTVY V++LS +G+ YHKSCF+CSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACEKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKSA+K    L R+PSK +SMFSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNF---AKSAEKQNEVLNRAPSKLSSMFSGTQDKCAT  107


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G +YHKSCFRC+H    L  S+Y++++G+LYCK HF
Sbjct  98   FSGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHSSYAALDGILYCKVHF  157

Query  396  EQLFKESGNFNKNFQSPAKSADK  464
             QLF E GN++   Q+  K   K
Sbjct  158  AQLFMEKGNYSHVLQAAKKHQPK  180



>ref|XP_009397610.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+CF+CSHCKGTL + NYSSM+G+LYCKP
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGTLSMCNYSSMDGILYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F+K F + +KS +K   EL+R+PSK +SMFSGTQ+KCA+
Sbjct  61   HFEQLFKETGSFSKKFPTSSKSGEK---ELSRTPSKVSSMFSGTQDKCAS  107


 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C+KT YP+E L+ +G +YHK+CF+CSH   TL  S+Y++++G+LYCK HF
Sbjct  98   FSGTQDKCASCKKTAYPLEKLTVEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHF  157

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  158  AQLFKEKGSYN  168



>ref|XP_009779198.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=217

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LLSADG  +HKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+ +K   + +  LTR+PSK +++FSGTQ+KCA 
Sbjct  61   HFEQLFKESGNFSKNFQTASKPERENS--LTRAPSKLSALFSGTQDKCAA  108


 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G  +HKSCF+C+H    L  + Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHF  158

Query  396  EQLFKESGNF  425
             QLF E GN+
Sbjct  159  AQLFMEKGNY  168



>ref|XP_009762983.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=212

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 90/109 (83%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KC AC+KTVY V+LLSADG+ YHKSCF+CSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF KNFQ+   S  +    LTR+PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKESGNFTKNFQN---SKAERQNSLTRAPSKLSAMFSGTQDKCA  106


 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++G LYCK HF
Sbjct  98   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGNLYCKHHF  157

Query  396  EQLFKESGNFNKNFQSP--AKSADKLTP  473
             QLF E GN+    ++    KS+  +TP
Sbjct  158  AQLFMEKGNYQHVLKAVNNKKSSAAVTP  185



>ref|XP_009601147.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AAF75828.1|AF116851_1 LIM domain protein PLIM-2 [Nicotiana tabacum]
Length=212

 Score =   161 bits (407),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 90/109 (83%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KC AC+KTVY V+LLSADG+ YHKSCF+CSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKH  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF KNFQ+   S  +    LTR+PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKESGNFTKNFQN---SKAERQNSLTRAPSKLSAMFSGTQDKCA  106


 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++G LYCK HF
Sbjct  98   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGNLYCKHHF  157

Query  396  EQLFKESGNFNKNFQSP--AKSADKLTP  473
             QLF E GN+    ++    KS+  +TP
Sbjct  158  AQLFMEKGNYQHVLKAANNKKSSAAVTP  185



>ref|XP_010273176.1| PREDICTED: LIM domain-containing protein PLIM2c [Nelumbo nucifera]
Length=200

 Score =   160 bits (406),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 93/110 (85%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT QKCKAC+KTVY V+LLSADG+ YHKSCF+CSHCKGTL +SNYSS++GVLYCKP
Sbjct  1    MAFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSLDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+      +   + +++PSK +SMF GTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNFQT---GKSEKPSDGSKAPSKLSSMFCGTQDKCAT  107


 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +G +YHKSCF+CSH   +L  SNY++++G+LYCK HF
Sbjct  98   FCGTQDKCATCHKTAYPLEKVTVEGESYHKSCFKCSHGGCSLTPSNYAALDGILYCKHHF  157

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  158  AQLFKEKGSYN  168



>ref|XP_010474800.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Camelina 
sativa]
 ref|XP_010474801.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Camelina 
sativa]
Length=205

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC AC+KTVY V++LS +G+ YHKSCFRC+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K+     PELTR+PSK +S+F GTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQ-PGKTEK---PELTRTPSKISSIFCGTQDKCA  105


 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++ VLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQS  443
             QLF E GN+    Q+
Sbjct  157  NQLFMEKGNYAHVLQA  172



>ref|NP_182104.1| protein PLIM2A [Arabidopsis thaliana]
 sp|O80839.1|PLI2A_ARATH RecName: Full=LIM domain-containing protein PLIM2a; AltName: 
Full=Pollen-expressed LIM protein 2; Short=AtPLIM2 [Arabidopsis 
thaliana]
 gb|AAC28544.1| putative LIM-domain protein [Arabidopsis thaliana]
 dbj|BAC42675.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AAO64006.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AEC10602.1| protein PLIM2A [Arabidopsis thaliana]
Length=226

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCFRC+HCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGN++KNFQ  A   +K    LTR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNYSKNFQ--AGKTEKPNDHLTRTPSKLSSFFSGTQDKCAT  108


 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 6/104 (6%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCATCKKTVYPLEKVTMEGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNK------NFQSPAKSADKLTPELTRSPSKAASM  509
             QLF E G++N       N +  A S     P     P   AS+
Sbjct  159  NQLFLEKGSYNHVHQAAANHRRSASSGGASPPSDDHKPDDTASI  202



>ref|XP_004248581.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Solanum 
lycopersicum]
Length=212

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LLSADGI YHKSCF+C+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLSADGITYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE GNF+KNFQ+  K  DK    L R+PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKECGNFSKNFQTSPK-PDKENA-LARTPSKLSAMFSGTQDKCA  107


 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++G+LYCK HF
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGILYCKHHF  158

Query  396  EQLFKESGNFNKNFQSP--AKSADK  464
             QLF E G +    ++    K+AD+
Sbjct  159  AQLFMEKGTYQHVLEAANNKKNADQ  183



>ref|XP_006341718.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=212

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LLSADGI YHKSCF+C+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLSADGITYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE GNF+KNFQ+  K  DK    L R+PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKECGNFSKNFQTSPK-PDKENA-LARTPSKLSAMFSGTQDKCA  107


 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G ++HKSCF+C+H    L  + Y+S++G+LYCK HF
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGILYCKHHF  158

Query  396  EQLFKESGNFNKNFQSP--AKSADK  464
             QLF E G +    ++    K+AD+
Sbjct  159  AQLFMEKGTYQHVLEAANNKKNADQ  183



>emb|CDX71757.1| BnaC08g31170D [Brassica napus]
Length=216

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+ DK + E+TR+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTAGKT-DK-SNEMTRAPSKLSSFFSGTQDKCA  107


 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKITMEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHF  158

Query  396  EQLFKESGNF  425
             QLF E GN+
Sbjct  159  NQLFLEKGNY  168



>ref|XP_010479778.1| PREDICTED: LIM domain-containing protein PLIM2b [Camelina sativa]
 ref|XP_010457082.1| PREDICTED: LIM domain-containing protein PLIM2b [Camelina sativa]
Length=205

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC AC+KTVY V++LS +G+ YHKSCFRC+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K+     PELTR+PSK +S+F GTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQ-PGKTEK---PELTRTPSKISSIFCGTQDKCA  105


 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 4/94 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++ VLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTR  485
             QLF E GN+    Q+       S + L PE T 
Sbjct  157  NQLFMEKGNYAHVLQAANHRRTASGNTLPPEATE  190



>ref|XP_002882034.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58293.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCFRCSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCKGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGN++KNFQ+     +K    LTR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNYSKNFQT--GKTEKPNDHLTRTPSKLSSFFSGTQDKCAT  108


 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C+KTVYP+E ++ +G +YHK+CFRCSH    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCATCKKTVYPLEKVTMEGESYHKTCFRCSHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNK------NFQSPAKSADKLTPELTRSPSKAASMFSGTQEK  530
             QLF E G++N       N +  A S     P     P  +AS+  G +++
Sbjct  159  NQLFLEKGSYNHVHQAAANHRRSASSGGASPPSDDHKPEDSASIPEGKEDE  209



>ref|XP_010923153.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X2 [Elaeis 
guineensis]
Length=159

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKAC+KTVY ++ LSADGI YHKSCF+C+HCKGTLKLSNYSS+EGVLYCKP
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKA  500
            HFEQLFKE+G+FNK+FQSPAKSA+K  PEL     +A
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKSNPELVTVEGQA  97


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  270  ELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  449
            EL++ +G  YHKSCFRCSH    +  SNY+++EG+LYCK HF QLFKE G++N   +S +
Sbjct  89   ELVTVEGQAYHKSCFRCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSAS  148

Query  450  -KSADKLTPEL  479
             K     TP+L
Sbjct  149  IKRTAASTPDL  159



>ref|XP_008232792.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
Length=217

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V++LS +G+ YHKSCF+CSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ   KSA+K   +L R+PSK +SMFSGT +KCAT
Sbjct  61   HFEQLFKESGNFSKNFQ--PKSAEKQNEQLNRAPSKLSSMFSGTLDKCAT  108


 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC  C KTVYP+E ++ +G +YHKSCFRC+H    L  S+Y++++GVLYCK HF
Sbjct  99   FSGTLDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHF  158

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF E GN++   Q+ A
Sbjct  159  SQLFLEKGNYSHVLQAAA  176



>ref|XP_009369042.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
 ref|XP_009350652.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=219

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKAC+KTV+ ++ LSADGI YHK+CF+CSHC G L +S+YSSM+GVLYCKP
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+GNF+K FQ+  KS +    ELTR+PSK +SMFSGT +KCA 
Sbjct  61   HFEQLFKETGNFSKKFQTSGKSQN----ELTRTPSKLSSMFSGTVDKCAV  106


 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC  C KTVYP+E ++ +G  YHKSCFRC+H    L  SN ++++G+LYCK HF
Sbjct  97   FSGTVDKCAVCNKTVYPLEKVTMEGDFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHF  156

Query  396  EQLFKESGNFN  428
             QLFKE G+++
Sbjct  157  AQLFKEKGSYS  167



>ref|XP_009629648.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=217

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LLSADG  +HKSCF+CSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+ +K   + +  LTR+PSK +++FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTASKPERENS--LTRAPSKLSALFSGTQDKCA  107


 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G  +HKSCF+C+H    L  + Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHF  158

Query  396  EQLFKESGNF  425
             QLF E GN+
Sbjct  159  AQLFMEKGNY  168



>ref|XP_011093154.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=218

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SF GT  KCKAC+KTVY V+LLSADG  +H+SCF+CSHCKGTL +SNYSSM+GVLYCKPH
Sbjct  3    SFTGTLDKCKACDKTVYFVDLLSADGAIFHRSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  62

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            FEQLFKESGNF+KNFQ+ AKS  + +  LTR+PSK +++FSGTQ+KC
Sbjct  63   FEQLFKESGNFSKNFQTGAKSERENS--LTRTPSKLSALFSGTQDKC  107


 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G ++H+SCF+C+H    L  S+Y++++G+LYCK HF
Sbjct  100  FSGTQDKCPACNKTVYPLEKVTMEGESFHRSCFKCAHGGCPLTHSSYAALDGILYCKHHF  159

Query  396  EQLFKESGNFNKNFQSPAKSADKLTP  473
            +QLF E GN+    ++     + + P
Sbjct  160  QQLFMEKGNYQHVLKAANNKKNAVEP  185



>ref|NP_171683.1| LIM family protein [Arabidopsis thaliana]
 sp|Q1ECF5.1|PLI2B_ARATH RecName: Full=LIM domain-containing protein PLIM2b; AltName: 
Full=Pollen-expressed LIM protein 2B [Arabidopsis thaliana]
 gb|ABF83669.1| At1g01780 [Arabidopsis thaliana]
 dbj|BAH20039.1| AT1G01780 [Arabidopsis thaliana]
 gb|AEE27334.1| LIM domain-containing protein [Arabidopsis thaliana]
Length=205

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC  C+KTVY V++LS +G+ YHKSCFRC+HCKGTL++SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K+     PELTR+PSK +S+F GTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQ-PGKTEK---PELTRTPSKISSIFCGTQDKCA  105


 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 4/108 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++ VLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTRSPSKAASMFSGTQE  527
             QLF E GN+    Q+       S + L PE T   +  A   +G  E
Sbjct  157  NQLFMEKGNYAHVLQAANHRRTASGNTLPPEPTEDVAVEAKEENGVSE  204



>ref|XP_009138785.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Brassica 
rapa]
 emb|CDX89105.1| BnaA04g00810D [Brassica napus]
Length=211

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQS  K+  + + ++TR+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQSAGKT--EKSNDVTRAPSKLSSFFSGTQDKCA  107


 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMAMEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHF  158

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTRSPSK  497
             QLF E GN+N   ++         DK+ P +  +  K
Sbjct  159  SQLFLEKGNYNHVLEAANHRRTSEEDKIEPNVNDASPK  196



>gb|KFK37370.1| hypothetical protein AALP_AA4G247900 [Arabis alpina]
Length=232

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++LL+ +G  YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLNLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+     +K   +LTR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNFQN--GKTEKTNDQLTRAPSKLSSFFSGTQDKCAT  108


 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCATCHKTVYPLEKVTMEGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF E G++N   Q+ A
Sbjct  159  NQLFLEKGSYNHVHQAAA  176



>emb|CDY56926.1| BnaAnng14450D [Brassica napus]
Length=212

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMRYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            HFEQLFKESGNF+KNFQS  K+  + T ++TR+PSK +S FSGTQ+KC
Sbjct  61   HFEQLFKESGNFSKNFQSAGKT--EKTNDVTRAPSKLSSFFSGTQDKC  106


 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+++ GVLYCK HF
Sbjct  99   FSGTQDKCPACKKTVYPLEKITMEGESYHKTCFRCAHGGCPLTHSSYAALNGVLYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPAKSADKLTPE  476
             QLF E GN+N   Q+   + ++ TPE
Sbjct  159  SQLFLEKGNYNHVLQA---ANNRRTPE  182



>ref|XP_009629647.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=218

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LLSADG  +HKSCF+CSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+ +   ++    LTR+PSK +++FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTASAKPERENS-LTRAPSKLSALFSGTQDKCA  108


 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G  +HKSCF+C+H    L  + Y++++GVLYCK HF
Sbjct  100  FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHF  159

Query  396  EQLFKESGNF  425
             QLF E GN+
Sbjct  160  AQLFMEKGNY  169



>ref|XP_004240106.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Solanum 
lycopersicum]
Length=228

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LLSADG  +HKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+ +KS       L ++PSK ++MFSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTSSKSE--KESSLAKAPSKVSAMFSGTQDKCA  107


 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E +  +G  +HKSCF+C+H    L  + Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACSKTVYPLEKVILEGEAFHKSCFKCAHGGCALTHATYAALDGVLYCKHHF  158

Query  396  EQLFKESGNFNKNFQSPAKSADKLTP  473
             QLF E G++    ++       +TP
Sbjct  159  AQLFMEKGSYQHVLKATTNKKSTVTP  184



>ref|XP_008796793.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=205

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+CF+CSHCKG L + +YSSM+GVLYCKP
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCSYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F K F + AKS DK   EL R+PSK + MFSGTQ+KCA+
Sbjct  61   HFEQLFKETGSFTKKFPTGAKSGDK--NELNRTPSKVSYMFSGTQDKCAS  108


 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C KT YP+E ++ +G +YHK+CF+CSH   TL  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCASCNKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHF  158

Query  396  EQLFKESGNFNK-NFQSPAKSADKLTPELTRSPSKAASMFSGTQEK  530
             QLFKE G++N  N  +  K +  +  E  ++ ++ A      QE+
Sbjct  159  AQLFKEKGSYNHLNKAASMKRSAAIEQEQEQALAETAPELEQDQEQ  204



>ref|XP_006397773.1| hypothetical protein EUTSA_v10001618mg [Eutrema salsugineum]
 gb|ESQ39226.1| hypothetical protein EUTSA_v10001618mg [Eutrema salsugineum]
Length=228

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++LL+ +G  YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+     +K    LTR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNFQT--GKTEKPNDHLTRAPSKLSSFFSGTQDKCAT  108


 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCATCHKTVYPLEKVTMEGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF E G++N   Q+ A
Sbjct  159  NQLFLEKGSYNHVHQAAA  176



>ref|XP_010905119.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=208

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+CF+CSHCKG L + +YSSM+GVLYCKP
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCSYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F K F + AKS DK   EL R+PSK + MFSGTQ+KCA+
Sbjct  61   HFEQLFKETGSFTKKFPTGAKSGDK--NELNRTPSKVSYMFSGTQDKCAS  108


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C+KT YP+E ++ +G +YHK+CF+CSH   TL  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCASCKKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAAIDGILYCKHHF  158

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  159  AQLFKEKGSYN  169



>ref|XP_010523732.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Tarenaya 
hassleriana]
Length=234

 Score =   159 bits (403),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++LL+ +G+ YHKSCFRCSHC GTL +SNYSSMEGVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLTLEGMPYHKSCFRCSHCNGTLVISNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+        TR+P++ +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTAGKTEKSSDAPQTRAPNRLSSFFSGTQDKCA  109


 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  101  FSGTQDKCAACQKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHF  160

Query  396  EQLFKESGNFNKNFQSP-----AKSADKLTPELT  482
             QLF E G++N   QS      A S+    PELT
Sbjct  161  NQLFLEKGSYNHVLQSANHRRTASSSSTPPPELT  194



>ref|XP_009387955.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=186

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKACEKTV+ ++LLSADG+ YHKSCFRCSHC GTL + NYSSMEGVLYCKP
Sbjct  1    MSFSGTLDKCKACEKTVHFIDLLSADGVIYHKSCFRCSHCNGTLSMCNYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G F K F +  K+ ++   EL+++PSK +SMFSGTQ+KCA+
Sbjct  61   HFEQLFKETGTFTKKFPTGIKAGER--NELSKTPSKFSSMFSGTQDKCAS  108


 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C+KT YP+E L+ +G +YHK+CF+CS    TL  S+ +++ G+LYCK HF
Sbjct  99   FSGTQDKCASCKKTAYPLETLTMEGESYHKTCFKCSVGGCTLTPSSCAALNGILYCKHHF  158

Query  396  EQLFKESGNFNKNFQS  443
             +LF E G+++   Q+
Sbjct  159  ARLFMEKGSYSHVIQA  174



>gb|AAF78411.1|AC009273_17 Contains similarity to mRNA for transcription factor L2 from 
Arabidopsis thaliana gb|X91398. It contains LIM domain containing 
proteins PF|00412. ESTs gb|T13084 and gb|T42925 come from 
this gene [Arabidopsis thaliana]
Length=261

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC  C+KTVY V++LS +G+ YHKSCFRC+HCKGTL++SNYSSM+GVLYCK 
Sbjct  57   MSFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKT  116

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K+     PELTR+PSK +S+F GTQ+KCA
Sbjct  117  HFEQLFKESGNFSKNFQ-PGKTEK---PELTRTPSKISSIFCGTQDKCA  161


 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 4/108 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++ VLYC+ HF
Sbjct  153  FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  212

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTRSPSKAASMFSGTQE  527
             QLF E GN+    Q+       S + L PE T   +  A   +G  E
Sbjct  213  NQLFMEKGNYAHVLQAANHRRTASGNTLPPEPTEDVAVEAKEENGVSE  260



>ref|XP_006402504.1| hypothetical protein EUTSA_v10006235mg [Eutrema salsugineum]
 gb|ESQ43957.1| hypothetical protein EUTSA_v10006235mg [Eutrema salsugineum]
Length=214

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+  +   E+TR+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTAGKT--EKPNEMTRAPSKLSSFFSGTQDKCA  107


 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALNGILYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPAKS-----ADKLTP  473
             QLF E GN+N   Q+ A        DK+ P
Sbjct  159  SQLFLEKGNYNHVLQAAANQRRTPVEDKIEP  189



>ref|XP_003623892.1| LIM domain protein 2b [Medicago truncatula]
 gb|AES80110.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=212

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LL+ +GI YHKSC +C+HCKG L +S YSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKSCLKCTHCKGNLTMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ  AKS++K+   + R+PS+ +SMFSGT +KCA 
Sbjct  61   HFEQLFKESGNFSKNFQ--AKSSEKINELMNRTPSRLSSMFSGTLDKCAV  108


 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query  198  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEG  371
            T  R+S  F GT  KC  C KTVYP+E +S +G  YHK+CFRC+H    L  S+Y++++G
Sbjct  91   TPSRLSSMFSGTLDKCAVCTKTVYPLEKMSLEGECYHKNCFRCAHGGCHLTHSSYAALDG  150

Query  372  VLYCKPHFEQLFKESGNFNKNFQSPA  449
            VLYCK HF+QLF E GN+N   Q+ A
Sbjct  151  VLYCKHHFQQLFMEKGNYNHVLQAAA  176



>ref|XP_008376025.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=221

 Score =   159 bits (401),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY  E+LS +G+ YHKSCF+CSHCKG L +S YSSM+G+LYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGILYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKSA+K   +L R PSK +++FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNF---AKSAEKQGEQLNRVPSKLSALFSGTQDKCAT  107


 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G +YHKSCFRC H    L  S+Y++++GVLYCK HF
Sbjct  98   FSGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCXHGGCALTHSSYAALDGVLYCKHHF  157

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF E GN++   Q+ A
Sbjct  158  SQLFLEKGNYSHVLQAAA  175



>gb|EPS71497.1| hypothetical protein M569_03263, partial [Genlisea aurea]
Length=215

 Score =   158 bits (400),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            +F GT  KCKAC+KTVY V+LLSADG  YHKSCF+CSHCKGTL +SNYSSM+GVLYCKPH
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            FEQLFKESGNF+KNFQ+     DK     +++P+K ++MFSGTQ+KCA
Sbjct  62   FEQLFKESGNFSKNFQTSKHVVDKEN-YGSKAPNKVSAMFSGTQDKCA  108


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G +YHKSCF+C+H    L  S+Y++++G+LYCK HF
Sbjct  100  FSGTQDKCAACSKTVYPLEKMTMEGESYHKSCFKCAHGGCPLTHSSYAALDGILYCKVHF  159

Query  396  EQLFKESGNF  425
            +QLF E GN+
Sbjct  160  QQLFMEKGNY  169



>ref|XP_009340168.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3 [Pyrus 
x bretschneideri]
Length=243

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY  E+LS +G+ YHKSCF+CSHCKG L +S YSSM+G+LYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGILYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKSA+K   +L R PSK +++FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNF---AKSAEKQGEQLNRVPSKLSALFSGTQDKCAT  107


 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 22/100 (22%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVE----------------------LLSADGINYHKSCFRCSHC  329
            F GTQ KC  C KTVYP+E                      +++ +G +YHKSCFRC+H 
Sbjct  98   FSGTQDKCATCSKTVYPLEKVSNIIKGINLISMSPCFSXQTIVTLEGESYHKSCFRCAHG  157

Query  330  KGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  449
               L  S+Y++++GVLYCK HF QLF E GN++   Q+ A
Sbjct  158  GCALTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAA  197



>emb|CDP08845.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 90/109 (83%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LLSADG  +H+SCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHRSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNF +     +     LTR+PSK +++FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFNTGKHEREN---SLTRAPSKLSALFSGTQDKCA  106


 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G +YHKSCF+C+H    L  S+Y++++G+LYCK HF
Sbjct  98   FSGTQDKCAACSKTVYPLEKVTMEGESYHKSCFKCAHGGCPLTHSSYAALDGILYCKHHF  157

Query  396  EQLFKESGNFNKNFQSPAKSADKLTP  473
             QLF E GN+    ++       + P
Sbjct  158  AQLFMEKGNYQHVLKAATHKKSAVAP  183



>ref|XP_008337059.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008343387.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=219

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KC AC+KTVY  E+LS +G+ YHKSCF+CSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCSACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF KNF   AKSA+K   +L R+PSK +SMF GTQ+KCAT
Sbjct  61   HFEQLFKESGNFGKNF---AKSAEKQGEQLNRAPSKLSSMFCGTQDKCAT  107


 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G +YHKSCFRC+H    L  S+Y++++GVLYCK HF
Sbjct  98   FCGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHF  157

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF E GN++   Q+ A
Sbjct  158  SQLFLEKGNYSHVLQAAA  175



>ref|XP_006304383.1| hypothetical protein CARUB_v10010886mg [Capsella rubella]
 gb|EOA37281.1| hypothetical protein CARUB_v10010886mg [Capsella rubella]
Length=205

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC AC+KTVY V++LS +G+ YHKSCFRC+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K      PELT++PSK +S+F GTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQ-PGKIEK---PELTKTPSKISSIFCGTQDKCA  105


 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 65/105 (62%), Gaps = 4/105 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTRSPSKAASMFSG  518
             QLF E GN+    Q+       S + L PE T   +  A   +G
Sbjct  157  NQLFMEKGNYAHVLQAANHRRTASGNTLPPEATEEIAVEAKEENG  201



>ref|XP_009391810.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+CF+CSHCKG+L + NYSSM+G+LYCKP
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGSLSMCNYSSMDGILYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESG+F K F + AKS ++   EL++SPSK + MF+GTQ+KC +
Sbjct  61   HFEQLFKESGSFTKKFPTGAKSGER--NELSKSPSKISYMFTGTQDKCVS  108


 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C+KT YP+E L+ +G +YHK+CF+CSH   TL  S+Y+++EG++YCK HF
Sbjct  99   FTGTQDKCVSCKKTAYPLEKLTVEGESYHKTCFKCSHGGCTLTPSSYAALEGIIYCKHHF  158

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  159  AQLFKEKGSYN  169



>ref|XP_002892043.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68302.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC  C+KTVY V++LS +G+ YHKSCFRC+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K+     PELT++PSK +S+F GTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQ-PGKTEK---PELTKTPSKISSIFCGTQDKCA  105


 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++ VLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTRSPSKAASMFSGTQE  527
             QLF E GN+    Q+       S + LTPE T   +  A   +G  +
Sbjct  157  NQLFLEKGNYAHVLQAANHRRTASGNTLTPEPTEDIAVEAKEENGVSQ  204



>ref|XP_010506557.1| PREDICTED: LIM domain-containing protein PLIM2a [Camelina sativa]
Length=228

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGN++KNFQ+     DK   +LTR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNYSKNFQT--GKTDKPN-DLTRTPSKLSSFFSGTQDKCAT  107


 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 2/91 (2%)
 Frame = +3

Query  183  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNY  356
             D   T  ++S  F GTQ KC  C+KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y
Sbjct  85   NDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGCPLTHSSY  144

Query  357  SSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  449
            +S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  145  ASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  175



>ref|XP_008374043.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=213

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 92/110 (84%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKAC+KTV+ ++ LSADGI YHK+CF+CSHC G L +S+YSSM+GVLYCKP
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F+K FQ+  KS +    ELTR+PSK +SMFSGT +KCA 
Sbjct  61   HFEQLFKETGSFSKKFQTSGKSQN----ELTRTPSKLSSMFSGTVDKCAV  106


 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC  C KTVYP+E ++ +G  YHKSCFRC+H    L  SN ++++G+LYCK HF
Sbjct  97   FSGTVDKCAVCTKTVYPLEKVTMEGDFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHF  156

Query  396  EQLFKESGNFN  428
             QLFKE G+++
Sbjct  157  AQLFKEKGSYS  167



>ref|XP_010508108.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Camelina 
sativa]
Length=230

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGN++KNFQ+     DK   +LTR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNYSKNFQT--GKTDKPN-DLTRTPSKLSSFFSGTQDKCAT  107


 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 2/91 (2%)
 Frame = +3

Query  183  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNY  356
             D   T  ++S  F GTQ KC  C+KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y
Sbjct  85   NDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGCPLTHSSY  144

Query  357  SSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  449
            +S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  145  ASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  175



>ref|XP_006296425.1| hypothetical protein CARUB_v10025604mg [Capsella rubella]
 gb|EOA29323.1| hypothetical protein CARUB_v10025604mg [Capsella rubella]
Length=225

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCF+C+HCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCTHCKGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGN++KNFQ+     +K    LTR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNYSKNFQN--GKTEKPNDHLTRTPSKLSSFFSGTQDKCAT  108


 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C+KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCTHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNK------NFQSPAKSADKLTPELTRSPSKAASMFSGTQEK  530
             QLF E G++N       N +  A S     P   + PS +AS+  G  E+
Sbjct  159  NQLFLEKGSYNHVHQAAANHRRSASSGGASPPSDDQKPSDSASIPEGKDEE  209



>gb|KDO39276.1| hypothetical protein CISIN_1g042895mg, partial [Citrus sinensis]
Length=150

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 81/103 (79%), Gaps = 11/103 (11%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCK CEKTV PVE LS DG+ YHKSCF+CS CKGTLKLSNYSS+EGV YCKP
Sbjct  1    MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSG  518
            HFEQL KES NFNKNFQ PAK           SPSK ASMFSG
Sbjct  61   HFEQLLKESSNFNKNFQLPAK-----------SPSKVASMFSG  92


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  264  PVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQ  401
            P E ++A+    HK+CF+CS+   ++  SNY+++EG+LYCK +F Q
Sbjct  105  PWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ  150



>gb|EMS67147.1| Pollen-specific protein SF3 [Triticum urartu]
Length=178

 Score =   155 bits (393),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 90/109 (83%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCK C+KTV+ ++LL+ADG++YHK+CF+CSHCKGTL + NYSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+GNF+KNF    KSA+K      ++PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGNFSKNFTPGGKSAEK---SEAKAPSKMSSAFSGTQDKCA  106



>ref|XP_009116783.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
 emb|CDY48936.1| BnaA09g39010D [Brassica napus]
Length=218

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNF +  K+  + + ++TR+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFHTAGKT--EKSNDVTRAPSKLSSFFSGTQDKCA  107


 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKITMEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHF  158

Query  396  EQLFKESGNFN  428
             QLF E GN+N
Sbjct  159  NQLFLEKGNYN  169



>ref|XP_010518219.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Camelina 
sativa]
Length=229

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGN++KNFQ+     DK   +LTR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNYSKNFQN--GKTDKPN-DLTRTPSKLSSFFSGTQDKCAT  107


 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 2/91 (2%)
 Frame = +3

Query  183  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNY  356
             D   T  ++S  F GTQ KC  C+KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y
Sbjct  85   NDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGCPLTHSSY  144

Query  357  SSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  449
            +S+ GVLYCK HF QLF E G++N   Q+ A
Sbjct  145  ASLNGVLYCKVHFNQLFLEKGSYNHVHQAAA  175



>ref|XP_009402055.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score =   156 bits (394),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKACEKTV+ ++LL+ADG+ YHK+CF+CSHCKGTL + NYSSM+GVLYCKP
Sbjct  1    MSFSGTQDKCKACEKTVHFIDLLTADGVTYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G F + F +  KS ++   E +++P+K +SMF GTQ+KCAT
Sbjct  61   HFEQLFKETGTFTRKFPTGTKSGER--NEQSKAPTKISSMFCGTQDKCAT  108


 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            TK    F GTQ KC  C+KT YP+E ++ +G +YHK+CF+CS     L  S+Y++++G+L
Sbjct  93   TKISSMFCGTQDKCATCKKTAYPLETMTMEGESYHKTCFKCSVGGCMLTPSSYAALDGIL  152

Query  378  YCKPHFEQLFKESGNFNKNFQS  443
            YCK HF QLF E G++N   Q+
Sbjct  153  YCKHHFAQLFMEKGSYNHVIQA  174



>ref|XP_006418457.1| hypothetical protein EUTSA_v10008789mg [Eutrema salsugineum]
 gb|ESQ36810.1| hypothetical protein EUTSA_v10008789mg [Eutrema salsugineum]
Length=205

 Score =   156 bits (394),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC AC+KTVY V++LS +G+ YHKSCFRC+HC GTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCNGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K+     PELT++PSK +S+F GTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQ-PGKTEK---PELTKTPSKISSIFCGTQDKCA  105


 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 4/95 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTRS  488
             QLF E GN+    Q+       S + L PE T  
Sbjct  157  NQLFLEKGNYAHVLQAANHRRTASGNTLPPEPTED  191



>gb|EPS59684.1| hypothetical protein M569_15118, partial [Genlisea aurea]
Length=180

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LL+ADG  +HKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLTADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            HFEQLFKESGNF+KNFQ  A  A+K       +P++ ++MFSGTQ+KC
Sbjct  61   HFEQLFKESGNFSKNFQPSA--ANKENSASKAAPNRMSAMFSGTQDKC  106


 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query  192  RSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSM  365
            ++   RMS  F GTQ KC AC K VYP+E ++ +G + H+SCF+C+H    L  S+Y+++
Sbjct  89   KAAPNRMSAMFSGTQDKCPACNKIVYPLEKVTMEGESVHRSCFKCAHGGCPLTHSSYAAL  148

Query  366  EGVLYCKPHFEQLFKESGNFNKNFQS  443
            +G+LYCK HF+QLF E GN+    Q+
Sbjct  149  DGILYCKVHFQQLFMEKGNYQHVLQA  174



>ref|XP_009138786.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Brassica 
rapa]
Length=210

 Score =   155 bits (393),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQS      + + ++TR+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQS---GKTEKSNDVTRAPSKLSSFFSGTQDKCA  106


 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y+++ G+LYCK HF
Sbjct  98   FSGTQDKCAACKKTVYPLEKMAMEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHF  157

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTRSPSK  497
             QLF E GN+N   ++         DK+ P +  +  K
Sbjct  158  SQLFLEKGNYNHVLEAANHRRTSEEDKIEPNVNDASPK  195



>ref|XP_011084964.1| PREDICTED: LOW QUALITY PROTEIN: LIM domain-containing protein 
WLIM2a [Sesamum indicum]
Length=209

 Score =   155 bits (393),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 93/116 (80%), Gaps = 11/116 (9%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSFIGTQQKCK CEKTVYP    SAD ++YHKSCF+CSHCKGTLKLSNYSSMEG+ +   
Sbjct  1    MSFIGTQQKCKTCEKTVYPX---SADRVSYHKSCFKCSHCKGTLKLSNYSSMEGMPWL--  55

Query  390  HFEQ------LFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HF +       FKES +F+KNFQSPAK A+K TPELTRSPSKAA M SGTQ+KCAT
Sbjct  56   HFHEKRFLFNFFKESRSFSKNFQSPAKVAEKKTPELTRSPSKAAGMCSGTQDKCAT  111



>ref|XP_010544716.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Tarenaya hassleriana]
Length=234

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY +++L+ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+        TR+P++ +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQASGKTDKPNDAPPTRAPNRLSSFFSGTQDKCA  109


 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H   +L  S+Y+++ GVLYCK HF
Sbjct  101  FSGTQDKCAACQKTVYPLEKMTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHF  160

Query  396  EQLFKESGNFNKNFQS  443
             QLF E G++N   QS
Sbjct  161  SQLFLEKGSYNHVLQS  176



>ref|XP_008777895.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=204

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 90/110 (82%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+CF+CSHCKG L + NYSSM+GVLYCKP
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F K F + AK  +    EL R+PSK + MFSGTQ+KCA+
Sbjct  61   HFEQLFKETGSFTKKFPTGAKDKN----ELNRTPSKVSYMFSGTQDKCAS  106


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C+KT YP+E ++ +G +YHK+CF+CSH   TL  S+Y++++G+LYCK HF
Sbjct  97   FSGTQDKCASCKKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHF  156

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  157  AQLFKEKGSYN  167



>ref|XP_003558280.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Brachypodium 
distachyon]
Length=195

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQQKCK C KTVYP++ LS DG  +H++CF+C HCK TL  S+YSS EGV YCKPHF
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGAVFHRACFKCHHCKSTLSFSSYSSFEGVPYCKPHF  61

Query  396  EQLFKESGNFNKNFQSPAKSA-DKLTPELTRSPSKAASMFSGTQEKCAT  539
             QLFKE+G++NK+FQSPAKSA +KLTPELTRSPSKAA MFSGTQ+KCAT
Sbjct  62   AQLFKETGSYNKSFQSPAKSALEKLTPELTRSPSKAAGMFSGTQDKCAT  110


 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +  +YHKSCF+CSH    L  SNY+++EG+LYCK HF
Sbjct  101  FSGTQDKCATCGKTAYPLEKVTVEEKSYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  160

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  161  SQLFKEKGSYN  171



>ref|XP_008438077.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cucumis 
melo]
Length=209

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY VELLS +G  YHKSCF+CSHCKGTL +S+YS M+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+ AK ++K     +R+PSK +SMFSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQN-AKPSEKQNDLQSRAPSKLSSMFSGTQDKCA  108


 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  100  FSGTQDKCAACTKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  159

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF   GN+N   ++ A
Sbjct  160  AQLFMIKGNYNHVLEAAA  177



>ref|XP_011023373.1| PREDICTED: LIM domain-containing protein PLIM2b [Populus euphratica]
Length=203

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+++S +G+ YHKSCF+CSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE G+F+KNFQ   K   + T ELTR+PSK +S+F GTQ+KC+T
Sbjct  61   HFEQLFKEGGDFSKNFQ---KGKPERTHELTRTPSKLSSVFCGTQDKCST  107


 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  98   FCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHF  157

Query  396  EQLFKESGNFNKNFQSPA--KSADKLTPELTRSPSKAAS  506
             QLF E G ++         +S     PEL    ++ A+
Sbjct  158  AQLFMEKGTYSHVLAGATHKRSTSTPPPELAEPNTEEAA  196



>ref|XP_008438078.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cucumis 
melo]
Length=208

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY VELLS +G  YHKSCF+CSHCKGTL +S+YS M+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+ AK ++K   +L+R+PSK +SMFSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQN-AKPSEKQN-DLSRAPSKLSSMFSGTQDKCA  107


 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  158

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF   GN+N   ++ A
Sbjct  159  AQLFMIKGNYNHVLEAAA  176



>ref|XP_009143175.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDX74767.1| BnaA05g05130D [Brassica napus]
Length=229

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++LL+ +G  YHKSCFRCSHC GTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+     +K    +TR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNFQTG--KTEKSNDHMTRAPSKLSSFFSGTQDKCAT  108


 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G  YHK+CF+C+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCATCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPAK  452
             QLF E G++N   Q+ AK
Sbjct  159  NQLFLEKGSYNNVHQAAAK  177



>gb|EMT25782.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=213

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 90/109 (83%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCK C+KTV+ ++LL+ADG++YHK+CF+CSHCKGTL + NYSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+GNF+KNF    KSA+K      ++PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGNFSKNFTPGGKSAEKGEA---KAPSKMSSAFSGTQDKCA  106


 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K   +F GTQ KC AC+KTVYP+E L+ +G  YHKSCF+CSH    L  S+Y+++ G+L
Sbjct  92   SKMSSAFSGTQDKCAACQKTVYPLEKLTLEGECYHKSCFKCSHGGCILTTSSYAALNGIL  151

Query  378  YCKPHFEQLFKESGNFN  428
            YCK HF QLFKE G++N
Sbjct  152  YCKIHFSQLFKEKGSYN  168



>ref|XP_004134333.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155874.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
Length=210

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY VELLS +G  YHKSCF+CSHCKGTL +S+YS M+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+ AK ++K     +R+PSK +SMFSGTQ+KCA 
Sbjct  61   HFEQLFKESGNFSKNFQN-AKPSEKQNDLQSRAPSKLSSMFSGTQDKCAA  109


 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  100  FSGTQDKCAACSKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  159

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF   GN+N   ++ A
Sbjct  160  AQLFMIKGNYNHVLEAAA  177



>ref|XP_001765937.1| predicted protein [Physcomitrella patens]
 gb|EDQ69258.1| predicted protein [Physcomitrella patens]
Length=191

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT QKCKACEKTVY VE L+ADG+ YHKSCFRC+HCKGTLKL+NY+S+EGVLYCKP
Sbjct  1    MAFSGTTQKCKACEKTVYLVEQLTADGVVYHKSCFRCNHCKGTLKLANYASLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQ-SPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            HFEQL K +G+F+K+F+  P++   K      ++PSKA+ MFSGTQEKC
Sbjct  61   HFEQLLKVTGSFDKSFEHKPSEGLKKAEKGENKAPSKASLMFSGTQEKC  109


 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K  + F GTQ+KC AC KTVYP+E  + +G+ YHK CF+C H   T+  SNY+++EG L
Sbjct  96   SKASLMFSGTQEKCIACSKTVYPIEKTTVEGLPYHKQCFKCVHGGCTISPSNYAALEGRL  155

Query  378  YCKPHFEQLFKESGNFNKNFQSPA  449
            YCKPH+ QLFKE GN+++  ++PA
Sbjct  156  YCKPHYSQLFKEKGNYSQLTKAPA  179



>emb|CDY18899.1| BnaC04g04510D [Brassica napus]
Length=227

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++LL+ +G  YHKSCFRCSHC GTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+     +K   ++TR+PSK +S FSGTQ+KCAT
Sbjct  61   HFEQLFKESGNFSKNFQT--GKTEKSNDQMTRAPSKLSSFFSGTQDKCAT  108


 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G  YHK+CF+C+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCATCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPAK  452
             QLF E G++N   Q+ AK
Sbjct  159  NQLFLEKGSYNNVHQAAAK  177



>ref|XP_002283482.1| PREDICTED: LIM domain-containing protein WLIM2a [Vitis vinifera]
 emb|CBI34710.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 90/109 (83%), Gaps = 6/109 (6%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT QKCKAC+KTV+ ++ +SADGI YHK+CFRCSHC G L +SNYSSM+GVLYCKP
Sbjct  1    MSFSGTTQKCKACDKTVHIIDTISADGIAYHKTCFRCSHCNGPLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLF+ESG+ +K FQS  K+      +L+R+PSK +SMFSGTQ+KC+
Sbjct  61   HFEQLFRESGSLSKKFQSSGKA------DLSRTPSKLSSMFSGTQDKCS  103


 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = +3

Query  186  DFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYS  359
            D   T  ++S  F GTQ KC  C+KTVYP+E ++ +G  YHKSCFRCSH    L  S+Y+
Sbjct  83   DLSRTPSKLSSMFSGTQDKCSLCKKTVYPLEKVTVEGEFYHKSCFRCSHGGCFLTPSSYA  142

Query  360  SMEGVLYCKPHFEQLFKESGNFN  428
            +++G+LYCKPHF QLF+E G+++
Sbjct  143  ALDGILYCKPHFTQLFRERGSYS  165



>gb|KEH18910.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=205

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LL+ + I YHKSCF+CSHCKG L +S YSSM+G+LYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLENIPYHKSCFKCSHCKGNLTMSTYSSMDGILYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKS+DK   EL R+PS+ +SMFSGT +KCAT
Sbjct  61   HFEQLFKESGNFSKNF---AKSSDKAN-ELNRTPSRLSSMFSGTLDKCAT  106


 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +3

Query  186  DFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYS  359
            +   T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  SNY+
Sbjct  85   ELNRTPSRLSSMFSGTLDKCATCSKTVYPLEKVTLEGEIYHKTCFRCAHAGCPLTHSNYA  144

Query  360  SMEGVLYCKPHFEQLFKESGNFNKNFQSPAK  452
            +++GVLYC+ HF QLF E GN++   +S  K
Sbjct  145  ALDGVLYCRVHFAQLFMEKGNYSHVLKSAHK  175



>ref|NP_001132843.1| uncharacterized LOC100194335 [Zea mays]
 gb|ACF81859.1| unknown [Zea mays]
 tpg|DAA36695.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB04292.1| LIM transcription factor, partial [Zea mays]
Length=204

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KC AC+KTV+ ++LL+ADG  YHK+CF+CSHCKG L + +YSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGAIYHKTCFKCSHCKGVLSMCSYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+KNF    KS+DK   ELTR+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKNFTPGGKSSDK--GELTRAPSKLSSAFSGTQDKCA  107


 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKSCF+CSH    L  S+Y+++ GVL
Sbjct  93   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVL  152

Query  378  YCKPHFEQLFKESGNFNK-NFQSPAK  452
            YCK HF QLF E G++N  N +SP++
Sbjct  153  YCKIHFAQLFMEKGSYNHMNKKSPSQ  178



>ref|XP_010107618.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXC16357.1| Pollen-specific protein SF3 [Morus notabilis]
Length=213

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 95/129 (74%), Gaps = 19/129 (15%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC KTVY V+++S +G+ YHKSCF+CSHCKGTL +S+YS M+GVLYCKP
Sbjct  1    MAFTGTLDKCKACNKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQS-------------------PAKSADKLTPELTRSPSKAASMF  512
            HFEQLFKESGNF+KNFQ+                    AKS+++   +L R+PSK +S+F
Sbjct  61   HFEQLFKESGNFSKNFQTVFLLGLFANNNKRVGEKFVTAKSSERQNDQLARAPSKLSSLF  120

Query  513  SGTQEKCAT  539
            SGTQ+KCAT
Sbjct  121  SGTQDKCAT  129


 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E +S +G  YHKSCFRC+H    L  S+Y++++GVLYCK HF
Sbjct  120  FSGTQDKCATCSKTVYPLEKVSLEGECYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHF  179

Query  396  EQLFKESGNFNKNFQSPAKSADKLTPELTRSPS  494
            +QLF E GN++   ++ A   +   P  T   S
Sbjct  180  QQLFMEKGNYSHVLKAAANKKNATPPPETADQS  212



>ref|XP_006491462.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|KDO86087.1| hypothetical protein CISIN_1g040947mg [Citrus sinensis]
Length=210

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 93/112 (83%), Gaps = 8/112 (7%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V++LS +G+ YHKSCF+CSHCKGTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQS---PAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+   P+  +++      R+PSK +S+FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTGKNPSSCSNQ-----NRTPSKLSSLFSGTQDKCA  107


 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E ++ +G  +HK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACEKTVYPLEKVTMEGDCFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHF  158

Query  396  EQLFKESGNFN  428
             QLF E GN++
Sbjct  159  AQLFMEKGNYS  169



>ref|XP_006647592.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=206

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG++YHK+CF+CSHCKGTL + NYSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+K F    KS+DK   +  ++PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKKFSQGGKSSDK--NDQGKAPSKLSSAFSGTQDKCA  107


 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            +F GTQ KC AC+KTVYP+E L+ +G +YHKSCF+CSH    L  S+Y+++ G+LYCK H
Sbjct  98   AFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIH  157

Query  393  FEQLFKESGNFNKNFQS  443
            F QLFKE G++N   Q+
Sbjct  158  FSQLFKEKGSYNHLIQT  174



>ref|XP_010089139.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB37386.1| Pollen-specific protein SF3 [Morus notabilis]
Length=421

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 5/121 (4%)
 Frame = +3

Query  177  LLRDFRSTKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNY  356
            LLR F   +++MSF GTQQKCKAC+KTV+ ++ LSADG+ YHK+CF+CSHC G L +S+Y
Sbjct  208  LLRCF-GQERKMSFSGTQQKCKACDKTVHFIDALSADGVVYHKTCFKCSHCNGLLVISSY  266

Query  357  SSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            SSM+GVLYCKPHFEQLFKE+G+F K FQS     D    +LTR+PSK +S+FSGTQ+KCA
Sbjct  267  SSMDGVLYCKPHFEQLFKETGSFTKKFQSGKPQND----QLTRAPSKLSSLFSGTQDKCA  322

Query  537  T  539
             
Sbjct  323  V  323


 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G  YHKSCFRCSH    L  S+Y+++EG+LYCK HF
Sbjct  314  FSGTQDKCAVCTKTVYPLEKVTVEGEFYHKSCFRCSHGGCFLTPSSYAALEGILYCKHHF  373

Query  396  EQLFKESGNFN  428
             QLF E G++N
Sbjct  374  AQLFMEKGSYN  384



>ref|XP_003533616.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
Length=219

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V++L+ +GI YHK+CFRCSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+ AKS+DK   E  ++P++ +SMFSGT +KC+ 
Sbjct  61   HFEQLFKESGNFSKNFQT-AKSSDKQN-ETHKTPNRLSSMFSGTLDKCSV  108


 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +3

Query  198  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEG  371
            T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++G
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHSSYAALDG  150

Query  372  VLYCKPHFEQLFKESGNFNKNFQS  443
            VLYC+ HF+QLF E GN++   QS
Sbjct  151  VLYCRHHFQQLFMEKGNYHHVLQS  174



>ref|NP_001047550.1| Os02g0641000 [Oryza sativa Japonica Group]
 dbj|BAD25223.1| putative LIM domain protein PLIM-2 [Oryza sativa Japonica Group]
 dbj|BAD25371.1| putative LIM domain protein PLIM-2 [Oryza sativa Japonica Group]
 dbj|BAF09464.1| Os02g0641000 [Oryza sativa Japonica Group]
 gb|EAY86851.1| hypothetical protein OsI_08235 [Oryza sativa Indica Group]
 gb|EAZ23959.1| hypothetical protein OsJ_07685 [Oryza sativa Japonica Group]
 gb|AEJ08684.1| PLIM [Oryza sativa]
Length=206

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG++YHK+CF+CSHCKGTL + NYSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+K F    KS++K   +  R+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKKFSQGGKSSEK--SDQGRAPSKLSSAFSGTQDKCA  107


 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            +F GTQ KC AC+KTVYP+E L+ +G +YHKSCF+CSH    L  S+Y+++ G+LYCK H
Sbjct  98   AFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIH  157

Query  393  FEQLFKESGNFN---KNFQSPAKSADKLTP  473
            F QLFKE G++N   +  QS  K +++  P
Sbjct  158  FSQLFKEKGSYNHLIQTAQSKQKESEEAAP  187



>gb|KHN29376.1| Pollen-specific protein SF3 [Glycine soja]
Length=219

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V++L+ +GI YHK+CFRCSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+ AKS+DK   E  ++P++ +SMFSGT +KC+ 
Sbjct  61   HFEQLFKESGNFSKNFQT-AKSSDKQN-ETHKTPNRLSSMFSGTLDKCSV  108


 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +3

Query  198  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEG  371
            T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++G
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHSSYAALDG  150

Query  372  VLYCKPHFEQLFKESGNFNKNFQS  443
            VLYC+ HF+QLF E GN++   QS
Sbjct  151  VLYCRHHFQQLFMEKGNYHHVLQS  174



>ref|XP_010671960.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LLSADG  +HKSCFRCSHC GTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGAIFHKSCFRCSHCNGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            HFEQLFKESGNF KNFQS  K+      E  R+P+K +S FSGTQEKC
Sbjct  61   HFEQLFKESGNFRKNFQSGQKTDRPY--EQNRAPNKLSSFFSGTQEKC  106


 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 8/98 (8%)
 Frame = +3

Query  192  RSTKKRMSFI-GTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSME  368
            R+  K  SF  GTQ+KC  C KTVYP+E ++ +G +YHKSCF+C+     L  S+Y++++
Sbjct  90   RAPNKLSSFFSGTQEKCPGCHKTVYPLEKITMEGESYHKSCFKCAVGGCPLTHSSYAALD  149

Query  369  GVLYCKPHFEQLFKESGNFN-------KNFQSPAKSAD  461
            G+LYCK HF+QLF E G++N       KN  S A++ D
Sbjct  150  GILYCKHHFQQLFMEKGSYNHVKNAAKKNASSSAEAGD  187



>gb|EYU32092.1| hypothetical protein MIMGU_mgv1a013269mg [Erythranthe guttata]
Length=225

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SF GT  KCKAC+KTVY V+LLSADG  +HKSCF+CSHCKGTL +S+YSSM+GVLYCKPH
Sbjct  3    SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSSYSSMDGVLYCKPH  62

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            FEQLFKESGNF+KNFQ+  +  D       R PSK ++MF GTQ+KC
Sbjct  63   FEQLFKESGNFSKNFQASKQERDHNNNLQARGPSKHSAMFCGTQDKC  109


 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K    F GTQ KC AC KTVYP+E ++ +G ++HKSCF+C+H    L  S+Y++++G+L
Sbjct  96   SKHSAMFCGTQDKCPACNKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHSSYAALDGIL  155

Query  378  YCKPHFEQLFKESGNF  425
            YCK HF+QLF E GN+
Sbjct  156  YCKVHFQQLFMEKGNY  171



>ref|XP_011091917.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=223

 Score =   154 bits (388),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            +F GT  KCKAC+KTVY V+LLSADG  YHKSCF+CSHCKGTL +SNYSSM+GVLYCKPH
Sbjct  3    AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  62

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            FEQLFKESGNF+KNFQ+     +  +    ++P+K ++MFSGTQ+KC
Sbjct  63   FEQLFKESGNFSKNFQTTKHDKENSS---NKAPNKLSAMFSGTQDKC  106


 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 69/108 (64%), Gaps = 3/108 (3%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E +  +G ++HKSCF+C+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCPACHKTVYPLEKVIMEGESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPA--KSA-DKLTPELTRSPSKAASMFSGTQEK  530
            +QLF E GN+    ++    KSA +   PE  ++  KA      T+E+
Sbjct  159  QQLFMEKGNYQHVLEAATNRKSAVETPEPESDQAEEKADDDQEKTEEE  206



>gb|AFK33321.1| unknown [Lotus japonicus]
Length=208

 Score =   153 bits (387),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC AC+KTVY V+LL+ +GI YHKSCF+CSHCKG L +S YSSM+GVLYC+ 
Sbjct  1    MSFTGTLDKCAACDKTVYVVDLLTLEGIPYHKSCFKCSHCKGNLTMSTYSSMDGVLYCRT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+ AKS++K   EL R+PS+ +SMFSGT +KCA 
Sbjct  61   HFEQLFKESGNFSKNFQN-AKSSEK-QGELNRTPSRLSSMFSGTLDKCAV  108


 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = +3

Query  186  DFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYS  359
            +   T  R+S  F GT  KC  C KTVY +E ++ +G  YHK+CFRC+H    L  SNY+
Sbjct  87   ELNRTPSRLSSMFSGTLDKCAVCTKTVYSLEKVTLEGECYHKTCFRCAHAGCPLTHSNYA  146

Query  360  SMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  473
            +++G LYC+ HF QLF E G+++   ++  +     TP
Sbjct  147  ALDGNLYCRVHFAQLFMEKGSYSHVLKAAHRRTGSSTP  184



>ref|XP_008392559.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=222

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKAC+KTV+ ++ LSADGI YHK+CF+CSHC G L +S+YSSM+ VLYCKP
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDEVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F+K FQ+  KS      ELTR+PSK +SMFSGT +KCA 
Sbjct  61   HFEQLFKETGSFSKKFQTSGKSQT----ELTRTPSKLSSMFSGTVDKCAV  106


 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC  C KTVYP+E ++ +G  YHKSCFRC+H    L  SN ++++G+LYCK HF
Sbjct  97   FSGTVDKCAVCTKTVYPLEKVTMEGAFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHF  156

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  157  AQLFKEKGSYN  167



>ref|XP_002302574.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|EEE81847.1| LIM domain-containing family protein [Populus trichocarpa]
Length=206

 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 90/110 (82%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+++S +G+ YHKSCF+CSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE G+F+KNFQ   K   + T EL R+PSK +S+F GTQ+KC+T
Sbjct  61   HFEQLFKEGGDFSKNFQ---KGKPERTHELIRTPSKLSSVFCGTQDKCST  107


 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  98   FCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHF  157

Query  396  EQLFKESGNFNKNFQSPA--KSADKLTPELTRSPSKAAS  506
             QLF E G ++         +S     PEL  S ++ A+
Sbjct  158  AQLFMEKGTYSHVLAGATHKRSTSTPPPELAESNTEEAA  196



>ref|XP_001771340.1| predicted protein [Physcomitrella patens]
 gb|EDQ63900.1| predicted protein [Physcomitrella patens]
Length=185

 Score =   152 bits (385),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKAC+KTVY VE L+ADG+ YHKSCFRC+HCKGTLKL++Y+S+EGVLYCKP
Sbjct  1    MAFSGTQQKCKACDKTVYLVEQLTADGVVYHKSCFRCNHCKGTLKLASYASLEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQ-SPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            HFEQL K +G+F+K+F+  P++   KL  +  + PSKA+ MFSGTQ+KC
Sbjct  61   HFEQLLKLTGSFDKSFEHKPSEGLKKLPEKGEKVPSKASLMFSGTQDKC  109


 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K  + F GTQ KC AC KTVYP++  + +G+ YHK CF+C H   T+  SNY+++EG L
Sbjct  96   SKASLMFSGTQDKCIACSKTVYPIDKTTVEGLPYHKHCFKCVHGGCTISPSNYAALEGRL  155

Query  378  YCKPHFEQLFKESGNFNK  431
            YCKPH+ QLFKE GN+++
Sbjct  156  YCKPHYSQLFKEKGNYSQ  173



>ref|XP_010907367.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=200

 Score =   153 bits (386),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ YHK+CF+CSHCKG L + NYSSM+GVLYCKP
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F K F + AK  +    EL R+PSK + MF GTQ+KCA+
Sbjct  61   HFEQLFKETGSFTKKFPTGAKDKN----ELNRTPSKVSYMFCGTQDKCAS  106


 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C KT YP+E ++ +G +YHK+CF+CSH   TL  S+Y++++G+LYCK HF
Sbjct  97   FCGTQDKCASCNKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHF  156

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  157  AQLFKEKGSYN  167



>ref|XP_004976341.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Setaria 
italica]
Length=204

 Score =   153 bits (386),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KC AC+KTV+ ++LL+ADG+ YHK+CF+CSHCKG L + +YSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+K F    KSADK   EL R+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKKFTPGGKSADK--GELARAPSKLSSAFSGTQDKCA  107


 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            +F GTQ KC AC+KTVYP+E L+ +G +YHKSCF+CSH    L  S+Y+++ GVLYCK H
Sbjct  98   AFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIH  157

Query  393  FEQLFKESGNFN  428
            F QLF E G++N
Sbjct  158  FGQLFMEKGSYN  169



>ref|XP_010523025.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
 ref|XP_010523026.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
 ref|XP_010523027.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
Length=208

 Score =   153 bits (387),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC AC+KTVY V++L+ +G+ YHKSCF+CSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLTLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  KS     PEL R+PSK +S+FSGT +KCA
Sbjct  61   HFEQLFKESGNFSKNFQT-GKSE---KPELNRTPSKLSSLFSGTLDKCA  105


 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC ACEKTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYC+ HF
Sbjct  97   FSGTLDKCAACEKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQS  443
             QLF E GN++   QS
Sbjct  157  NQLFLEKGNYSHVLQS  172



>ref|XP_007139894.1| hypothetical protein PHAVU_008G067500g [Phaseolus vulgaris]
 gb|ESW11888.1| hypothetical protein PHAVU_008G067500g [Phaseolus vulgaris]
Length=208

 Score =   153 bits (386),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LL+ +G  YHK+CFRCSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGTPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+ A+S+DK   E+ ++P++ +SMFSGT +KC+ 
Sbjct  61   HFEQLFKESGNFSKNFQT-ARSSDK-QNEVNKTPNRLSSMFSGTLDKCSV  108


 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query  198  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEG  371
            T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++G
Sbjct  91   TPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHSSYAALDG  150

Query  372  VLYCKPHFEQLFKESGNFNKNFQSPA  449
            VLYC+ HF+QLF E GN++   Q+ A
Sbjct  151  VLYCRHHFQQLFMEKGNYHHVLQAAA  176



>ref|XP_010544715.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Tarenaya hassleriana]
Length=235

 Score =   154 bits (388),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY +++L+ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSA---DKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+    D   P  TR+P++ +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQASGKTDKPNDAQPP--TRAPNRLSSFFSGTQDKCA  110


 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H   +L  S+Y+++ GVLYCK HF
Sbjct  102  FSGTQDKCAACQKTVYPLEKMTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHF  161

Query  396  EQLFKESGNFNKNFQS  443
             QLF E G++N   QS
Sbjct  162  SQLFLEKGSYNHVLQS  177



>ref|XP_003551659.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHM99398.1| Pollen-specific protein SF3 [Glycine soja]
Length=216

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V++L+ +GI YHK+CFRCSHCKG L ++ YSSM+GVLYCKP
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGYLTMNTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+ AKS+DK   E  ++P++ +SMFSGT +KC+ 
Sbjct  61   HFEQLFKESGNFSKNFQT-AKSSDKQN-ETNKAPNRLSSMFSGTLDKCSV  108


 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYC+ HF
Sbjct  99   FSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHF  158

Query  396  EQLFKESGNFNKNFQSPAKSADKLTPE  476
            +QLF E GN++   QS A     +TPE
Sbjct  159  QQLFMEKGNYHHVLQS-ANHKKNVTPE  184



>ref|NP_001140551.1| uncharacterized LOC100272616 [Zea mays]
 gb|ACF84061.1| unknown [Zea mays]
 gb|AFW58965.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB05143.1| LIM transcription factor, partial [Zea mays]
Length=205

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            SF GTQ KC  C+KTV+ ++LL+ADG+ YHK+CF+CSHCKG L + +YSSM+GVLYCK H
Sbjct  3    SFTGTQDKCAECDKTVHFIDLLTADGVTYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTH  62

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            FEQLFKE+G+F+KNF    KS+DK   ELTR+PSK +S FSGTQ+KCA
Sbjct  63   FEQLFKETGSFSKNFTPGGKSSDK--GELTRAPSKLSSAFSGTQDKCA  108


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKSCF+CSH    L  S+Y+++ GVL
Sbjct  94   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVL  153

Query  378  YCKPHFEQLFKESGNFN  428
            YCK HF QLF E G+++
Sbjct  154  YCKIHFAQLFMEKGSYS  170



>gb|KGN56538.1| hypothetical protein Csa_3G122620 [Cucumis sativus]
Length=209

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY VELLS +G  YHKSC +CSHCKGTL +S+YS M+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCLKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+ AK ++K   +L+R+PSK +SMFSGTQ+KCA 
Sbjct  61   HFEQLFKESGNFSKNFQN-AKPSEKQN-DLSRAPSKLSSMFSGTQDKCAA  108


 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACSKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  158

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF   GN+N   ++ A
Sbjct  159  AQLFMIKGNYNHVLEAAA  176



>emb|CDY27358.1| BnaC04g50470D [Brassica napus]
Length=230

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCFRCSHC GTL++S YSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMSTYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+     +K   ++TR+PSK +S FSGTQ+KCA+
Sbjct  61   HFEQLFKESGNFSKNFQT--GKTEKSNDQMTRAPSKLSSFFSGTQDKCAS  108


 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C KTVYP+E ++ +G  YHK+CF+C+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF E G++N   Q+ A
Sbjct  159  NQLFLEKGSYNHVHQAAA  176



>emb|CDX86962.1| BnaC03g52320D [Brassica napus]
Length=137

 Score =   150 bits (379),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC  C+KTVY +++LS +G+ YHKSCF+C+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HF+QLFKESGNF+KNFQ P K+     PE +++PSK +S+F GTQ+KCA
Sbjct  61   HFDQLFKESGNFSKNFQ-PGKTEK---PEQSKTPSKISSIFCGTQDKCA  105



>ref|XP_004133874.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155817.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN56534.1| hypothetical protein Csa_3G122580 [Cucumis sativus]
Length=205

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+LL+ +G  YHK+CF+CSHCKGTL +S+YS M+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLTLEGNPYHKNCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+  KS+DK   +LTR+PSK +SMFSGTQ+KC+ 
Sbjct  61   HFEQLFKESGNFSKNFQT--KSSDKPN-DLTRTPSKLSSMFSGTQDKCSV  107


 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 2/116 (2%)
 Frame = +3

Query  183  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNY  356
             D   T  ++S  F GTQ KC  C KTVYP+E +S +G  YHK CFRC+H    L   +Y
Sbjct  85   NDLTRTPSKLSSMFSGTQDKCSVCTKTVYPLEKVSLEGECYHKKCFRCAHGGCHLTHCSY  144

Query  357  SSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQ  524
            ++++GVLYCK HF QLF   GN+N   ++ A       P          S  SG Q
Sbjct  145  AALDGVLYCKHHFAQLFMVKGNYNHVLEAAANKKTTTPPADHTDEDAEPSPRSGEQ  200



>dbj|BAK04207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=203

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KC ACEKTV+ ++LL+ADG+ YHK+CF+CSHCKG L + +YSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCSACEKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+K F    KS DK   ELTR+PSK ++ FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKKFTPGNKSGDK--SELTRAPSKLSAAFSGTQDKCA  107


 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K   +F GTQ KC AC KTVYP+E ++ +G  YHKSCF+CSH    L  S+Y+++ GVL
Sbjct  93   SKLSAAFSGTQDKCAACTKTVYPLEKMTLEGDAYHKSCFKCSHGGCILTTSSYAALNGVL  152

Query  378  YCKPHFEQLFKESGNFN  428
            YCK HF QLF E G+++
Sbjct  153  YCKIHFGQLFMERGSYS  169



>ref|XP_010512456.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Camelina sativa]
Length=219

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+  + + E +R+P++ +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTAGKT--EKSNETSRAPNRLSSFFSGTQDKCA  107


 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPAKS  455
             QLF E GN++   Q+ A +
Sbjct  159  SQLFLEKGNYSHVLQAAANN  178



>ref|XP_009142366.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
Length=229

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCFRCSHC GTL+++ YSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMTTYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+     +K   ++TR+PSK +S FSGTQ+KCA+
Sbjct  61   HFEQLFKESGNFSKNFQT--GKTEKSNDQMTRAPSKLSSFFSGTQDKCAS  108


 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C KTVYP+E ++ +G  YHK+CF+C+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF E G++N   Q+ A
Sbjct  159  NQLFLEKGSYNHVHQAAA  176



>emb|CDY37066.1| BnaA04g26440D [Brassica napus]
Length=229

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY ++LL+ +G  YHKSCFRCSHC GTL+++ YSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMTTYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNFQ+     +K   ++TR+PSK +S FSGTQ+KCA+
Sbjct  61   HFEQLFKESGNFSKNFQT--GKTEKSNDQMTRAPSKLSSFFSGTQDKCAS  108


 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC +C KTVYP+E ++ +G  YHK+CF+C+H    L  S+Y+S+ GVLYCK HF
Sbjct  99   FSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHF  158

Query  396  EQLFKESGNFNK------NFQSPAKSADKLTPELTRSPSKAASMFSG  518
             QLF E G++N       N +  A S     P     P   A++  G
Sbjct  159  NQLFLEKGSYNHVHQAAANHRRTASSGASTPPSDDHKPEDNAAIPEG  205



>ref|XP_003569963.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Brachypodium 
distachyon]
Length=210

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCK C+KTV+ ++LLSADGI+YHK+CF+CSHCKGTL + NYSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLSADGISYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+K F    KS+DK   +  ++P+K +S+FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKKFTPGGKSSDK--NDQAKAPNKLSSVFSGTQDKCA  107


 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E L+ +G  YHKSCF+CSH   TL  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACQKTVYPLEKLTLEGECYHKSCFKCSHGGCTLTTSSYAALNGILYCKIHF  158

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  159  SQLFKEKGSYN  169



>gb|ACN26203.1| unknown [Zea mays]
 gb|ADX60140.1| LIM transcription factor [Zea mays]
 gb|AFW72521.1| putative LIM-type zinc finger domain family protein [Zea mays]
Length=204

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG++YHK+CF+CSHCKG L +S+YSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKACDKTVHIIDLLTADGVSYHKTCFKCSHCKGVLSISSYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G F+KNFQ  A S      +  ++PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGTFSKNFQGGASSNKN---DQAKAPSKLSSAFSGTQDKCA  106


 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K   +F GTQ KC AC+KTVYP+E ++ +G +YHKSCF+CSH    L  S+Y+++ GVL
Sbjct  92   SKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCILTTSSYAALNGVL  151

Query  378  YCKPHFEQLFKESGNFN---KNFQSPAKSADKLTPE  476
            YCK HF QLFKE G++N   +  Q+    A +  PE
Sbjct  152  YCKIHFSQLFKEKGSYNHLIETAQTKKNEAAEAGPE  187



>ref|XP_009375790.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=222

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKAC+KTV+ ++ LSADGI YHK+CF+CSHC G L +S+YSSM+ VLYCKP
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDEVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F+K FQ     + KL  ELTR+PSK +SMFSGT +KCA 
Sbjct  61   HFEQLFKETGSFSKKFQ----ISGKLQTELTRTPSKLSSMFSGTVDKCAV  106


 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = +3

Query  153  LKGQIWTLLLRDFRSTKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCK  332
            + G++ T L R    +K    F GT  KC  C KTVYP+E ++ +G  YHKSCFRC+H  
Sbjct  78   ISGKLQTELTR--TPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGAFYHKSCFRCNHGG  135

Query  333  GTLKLSNYSSMEGVLYCKPHFEQLFKESGNFN  428
              L  SN ++++G+LYCK HF QLFKE G++N
Sbjct  136  CFLSPSNCAALDGILYCKHHFAQLFKEKGSYN  167



>ref|XP_010469046.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Camelina sativa]
Length=217

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+  + + E +R+P++ +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTAGKT--EKSNETSRAPNRLSSFFSGTQDKCA  107


 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPAKS  455
             QLF E GN++   Q+ A +
Sbjct  159  SQLFLEKGNYSHVLQAAANN  178



>ref|XP_010413441.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X1 [Camelina 
sativa]
 ref|XP_010413442.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X2 [Camelina 
sativa]
Length=217

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+  + + E +R+P++ +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTAGKT--EKSNETSRAPNRLSSFFSGTQDKCA  107


 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPAKS  455
             QLF E GN++   Q+ A +
Sbjct  159  SQLFLEKGNYSHVLQAAANN  178



>ref|XP_007051870.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOX96027.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=276

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 99/139 (71%), Gaps = 12/139 (9%)
 Frame = +3

Query  129  RTPFFLQGLKGQIWTLLLRDF---RSTKKRMSFIGTQQKCKACEKTVYPVELLSADGINY  299
            RT F LQ L       L R F     +KK M+F GT  KCKAC++TV+ V++LS +G+ Y
Sbjct  45   RTLFRLQTLP------LPRVFPCPERSKKEMAFTGTLDKCKACDRTVHVVDMLSLEGVPY  98

Query  300  HKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTPEL  479
            HK+CF+CSHCKG L +S YSSM+GVLYCKPHFEQLFKESGNF+KNF +          EL
Sbjct  99   HKTCFKCSHCKGNLVMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFHTVKSERQN---EL  155

Query  480  TRSPSKAASMFSGTQEKCA  536
            +R+PSK +S+F GTQ+KCA
Sbjct  156  SRTPSKVSSLFCGTQDKCA  174


 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y+++ GVLYCK HF
Sbjct  166  FCGTQDKCAACQKTVYPLEKVTMEGECYHKNCFRCAHGGCHLTHSSYAALNGVLYCKHHF  225

Query  396  EQLFKESGNFNKNFQS  443
             QLF E GN+N   Q+
Sbjct  226  AQLFMEKGNYNHVLQA  241



>gb|EMT19855.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=223

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 93/130 (72%), Gaps = 22/130 (17%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLK-----------------  344
            F GTQQKCK C KTVYP++ LS DG  +H++CF+C HCK TL                  
Sbjct  2    FSGTQQKCKVCTKTVYPMDQLSTDGAVFHRACFKCHHCKSTLSNRVPRIGDHDFVQFAFS  61

Query  345  --LSNYSSMEGVLYCKPHFEQLFKESGNFNKNF--QSPAKSA-DKLTPELTRSPSKAASM  509
               S+YSS EGV YCKPHF QLFKE+G++NK+F  QSPAKSA +KLTPELTRSPSKAA M
Sbjct  62   GLFSSYSSFEGVPYCKPHFAQLFKETGSYNKSFQSQSPAKSATEKLTPELTRSPSKAAGM  121

Query  510  FSGTQEKCAT  539
            FSGTQ+KCAT
Sbjct  122  FSGTQDKCAT  131


 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E ++ +  +YHKSCF+CSH    L  SNY+++EG+LYCK HF
Sbjct  122  FSGTQDKCATCGKTAYPLEKVTVEEKSYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  181

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  182  SQLFKEKGSYN  192



>gb|EYU35073.1| hypothetical protein MIMGU_mgv1a013171mg [Erythranthe guttata]
Length=229

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 89/111 (80%), Gaps = 10/111 (9%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            +F GT  KCKAC+KTVY V+LLSADG  +HKSCF+CSHCKGTL +SNYSSM+GVLYCK H
Sbjct  3    AFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  62

Query  393  FEQLFKESGNFNKNFQSPAKSADKLTPE----LTRSPSKAASMFSGTQEKC  533
            FEQLFK+S +F KNFQ+ AK      PE    LTR+P+K ++MFSGTQ+KC
Sbjct  63   FEQLFKDSAHFTKNFQTSAK------PERENSLTRAPNKLSAMFSGTQDKC  107


 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+K VYP+E ++ +G ++HKSCF+C+H    L  S+Y++++G+LYCK HF
Sbjct  100  FSGTQDKCPACDKIVYPLEKVTMEGESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHF  159

Query  396  EQLFKESGNF  425
            +QLF E GN+
Sbjct  160  QQLFMEKGNY  169



>ref|XP_002452860.1| hypothetical protein SORBIDRAFT_04g033700 [Sorghum bicolor]
 gb|EES05836.1| hypothetical protein SORBIDRAFT_04g033700 [Sorghum bicolor]
Length=200

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCK C+KTV+ ++LL+ADG++YHK+CF+CSHCKGTL +S+YSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSISSYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G F+K FQ  A S      +  ++PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGTFSKKFQGGASSTK---TDQAKAPSKLSSAFSGTQDKCA  106


 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  213  SFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  392
            +F GTQ KC AC+KTVYP+E ++ +G +YHKSCF+CSH    L  S+Y+++ G+LYCK H
Sbjct  97   AFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIH  156

Query  393  FEQLFKESGNFNKNFQSP  446
            F QLFKE G++N   Q+ 
Sbjct  157  FSQLFKEKGSYNHLIQTA  174



>ref|XP_009389159.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=200

 Score =   150 bits (379),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG+ +HK+CF+CS CKGTL + NYSS++G+LYCKP
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPFHKTCFKCSRCKGTLSMCNYSSLDGILYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE+G+F K F   AKS ++   EL R  S+ +SMFSGTQ+KCAT
Sbjct  61   HFEQLFKETGSFTKKFPIGAKSGER--NELARPASRVSSMFSGTQDKCAT  108


 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KT YP+E L+ +G +YHK+CF+CSH    L  S+Y+++EG++YCK HF
Sbjct  99   FSGTQDKCATCHKTAYPLEKLTVEGESYHKTCFKCSHGGCKLTPSSYAALEGIIYCKHHF  158

Query  396  EQLFKESGNFN  428
             QLFKE G++N
Sbjct  159  AQLFKEKGSYN  169



>dbj|BAH57141.1| AT3G55770 [Arabidopsis thaliana]
Length=80

 Score =   146 bits (369),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQQKCKACEKTVY VELLSADG+ YHKSCF+C+HCK  L+LS+YSSMEGVLYCKP
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQS  443
            HFEQLFKESG+FNKNFQS
Sbjct  61   HFEQLFKESGSFNKNFQS  78



>ref|XP_008677533.1| PREDICTED: uncharacterized LOC100381874 isoform X1 [Zea mays]
 gb|AFW63175.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB04943.1| LIM transcription factor, partial [Zea mays]
Length=207

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCKAC+KTV+ ++LL+ADG++YHK+CF+CSHCKG L +S+YSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGVLSISSYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQ-SPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+GNF+K FQ     S++K  P   ++PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGNFSKKFQGGGGASSNKNDP--AKAPSKLSSAFSGTQDKCA  108


 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K   +F GTQ KC AC+KTVYP+E ++ +G +YHK CF+CSH    L  S+Y+++ G+L
Sbjct  94   SKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKGCFKCSHGGCILTTSSYAALNGIL  153

Query  378  YCKPHFEQLFKESGNFN  428
            YCK HF QLFKE G++N
Sbjct  154  YCKIHFSQLFKEKGSYN  170



>dbj|BAK06966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KCK C+KTV+ ++LL+ADG++YHK+CF+CSHCKGTL + NYSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+K F    KSA+K      ++PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKKFTPGGKSAEK---SEAKAPSKMSSAFSGTQDKCA  106


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K   +F GTQ KC AC+KTVYP+E LS +G  YHK CF+CSH    L  S+Y+++ G+L
Sbjct  92   SKMSSAFSGTQDKCAACQKTVYPLEKLSLEGECYHKGCFKCSHGGCILTTSSYAALNGIL  151

Query  378  YCKPHFEQLFKESGNFN  428
            YCK HF QLFKE G++N
Sbjct  152  YCKIHFSQLFKEKGSYN  168



>ref|XP_007135026.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
 gb|ESW07020.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
Length=226

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LL+ +GI YHK+CF+CSHCKG L +  YSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMCTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKS +K      R+PSK +SMFSGT +KCA 
Sbjct  61   HFEQLFKESGNFSKNF---AKSTEKQNDIQNRTPSKLSSMFSGTLDKCAV  107


 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC  C KTVYP+E +S +G  YHK+CFRC+H    L  SNY++++GV+YC+ HF
Sbjct  98   FSGTLDKCAVCSKTVYPLEKVSLEGECYHKTCFRCAHAGCPLTHSNYAALDGVVYCRVHF  157

Query  396  EQLFKESGNFNKNFQSPA--KSADKLTPE-LTRSPSKAA  503
             QLF E GN++   Q+ A  ++     PE L   PS  A
Sbjct  158  AQLFMEKGNYSHVLQAAAHKRTGSSTPPEPLFEEPSHPA  196



>emb|CDY38028.1| BnaCnng08890D [Brassica napus]
Length=205

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC  C+KTVY +++LS +G+ YHKSCF+C+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K+     PE +++PSK +S+F GTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQ-PGKTEK---PEQSKTPSKISSIFCGTQDKCA  105


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 4/93 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E +  +G  +HK+CF+C+H    L  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELT  482
             QLF E GN+    QS       S + L PE T
Sbjct  157  NQLFLEKGNYAHVLQSANHRRTASGNTLPPETT  189



>ref|XP_007218397.1| hypothetical protein PRUPE_ppa011395mg [Prunus persica]
 gb|EMJ19596.1| hypothetical protein PRUPE_ppa011395mg [Prunus persica]
Length=212

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 7/110 (6%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V++LS +G+ YHKSCF+CSHCKG L +S YSSM+GVLYCKP
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF        KSA+K   +L R+PSK +SMFSGT +KCAT
Sbjct  61   HFEQLFKESGNFT-------KSAEKQNEQLNRAPSKLSSMFSGTLDKCAT  103


 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GT  KC  C KTVYP+E ++ +G +YHKSCFRC+H    L  S+Y++++GVLYCK HF
Sbjct  94   FSGTLDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHF  153

Query  396  EQLFKESGNFNKNFQSPAKSADKL  467
             QLF E GN++   Q+ A   + L
Sbjct  154  SQLFLEKGNYSHVLQAAANRKNAL  177



>ref|XP_004510816.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=210

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LL+ + I YHK+CF+CSHCKG L +S YSSM+G+LYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLENIPYHKNCFKCSHCKGCLTMSTYSSMDGILYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKS+DK   EL R+PS+ +SMFSGT +KCA 
Sbjct  61   HFEQLFKESGNFSKNF---AKSSDKQN-ELNRTPSRLSSMFSGTLDKCAV  106


 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +3

Query  183  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNY  356
             +   T  R+S  F GT  KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  SNY
Sbjct  84   NELNRTPSRLSSMFSGTLDKCAVCTKTVYPLEKVTLEGECYHKTCFRCAHAGCPLTHSNY  143

Query  357  SSMEGVLYCKPHFEQLFKESGNFNKNFQSPAKSADKLTP  473
            ++++GVLYC+ HF QLF E G ++    S A   +  +P
Sbjct  144  AALDGVLYCRVHFAQLFMEKGTYSHVLNSTAHKRNGSSP  182



>ref|XP_010055180.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW71657.1| hypothetical protein EUGRSUZ_E00179 [Eucalyptus grandis]
Length=218

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V++LS +G+ YHK+CFRCSHC G L +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGMPYHKNCFRCSHCNGHLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQL+KESGNF+KNFQ+ AKS+++   +L R+PS+ +S+FSGT +KC T
Sbjct  61   HFEQLYKESGNFSKNFQT-AKSSER-QHDLNRTPSRLSSLFSGTLDKCTT  108


 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  183  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNY  356
             D   T  R+S  F GT  KC  C KTVYP+E ++ +G  +HK+CFRC+H    L  S+Y
Sbjct  86   HDLNRTPSRLSSLFSGTLDKCTTCGKTVYPLEKVTLEGECFHKNCFRCAHGGCALTHSSY  145

Query  357  SSMEGVLYCKPHFEQLFKESGNFNKNFQSPA  449
            ++++GV YCK HF +LF E GN++   +   
Sbjct  146  AALDGVFYCKHHFARLFMEKGNYSHVLEGAV  176



>ref|XP_011035878.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Populus 
euphratica]
Length=206

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY V+++S +G+ YHKSCF+CSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKE G+F+KNFQ   K   + T +L+R PSK +S+F GTQ+KC+T
Sbjct  61   HFEQLFKEGGDFSKNFQ---KGKPERTHDLSRIPSKLSSVFCGTQDKCST  107


 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC  C KTVYP+E ++ +G  YHK+CFRC+H    L  S+Y++++GVLYCK HF
Sbjct  98   FCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHF  157

Query  396  EQLFKESGNFNKNFQSPA-KSADKLTPELTRS-PSKAASM  509
             QLF E G ++    S A K ++   PEL  S P + A++
Sbjct  158  AQLFMEKGTYSHVLASAAHKRSNSTPPELAESNPEEGAAV  197



>ref|XP_007135027.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
 gb|ESW07021.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
Length=225

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KCKAC+KTVY V+LL+ +GI YHK+CF+CSHCKG L +  YSSM+GVLYCKP
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMCTYSSMDGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCAT  539
            HFEQLFKESGNF+KNF   AKS +K   ++ R+PSK +SMFSGT +KCA 
Sbjct  61   HFEQLFKESGNFSKNF---AKSTEKQN-DINRTPSKLSSMFSGTLDKCAV  106


 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = +3

Query  183  RDFRSTKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNY  356
             D   T  ++S  F GT  KC  C KTVYP+E +S +G  YHK+CFRC+H    L  SNY
Sbjct  84   NDINRTPSKLSSMFSGTLDKCAVCSKTVYPLEKVSLEGECYHKTCFRCAHAGCPLTHSNY  143

Query  357  SSMEGVLYCKPHFEQLFKESGNFNKNFQSPA--KSADKLTPE-LTRSPSKAA  503
            ++++GV+YC+ HF QLF E GN++   Q+ A  ++     PE L   PS  A
Sbjct  144  AALDGVVYCRVHFAQLFMEKGNYSHVLQAAAHKRTGSSTPPEPLFEEPSHPA  195



>ref|XP_009119735.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 ref|XP_009119736.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDX90059.1| BnaA10g00230D [Brassica napus]
Length=205

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC  C+KTVY +++LS +G+ YHKSCF+C+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HF+QLFKESGNF+KNFQ P K+     PE T++PSK +S+F GTQ+KCA
Sbjct  61   HFDQLFKESGNFSKNFQ-PGKTEK---PEHTKTPSKISSIFCGTQDKCA  105


 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELTRSPSKAASMFSGTQE  527
             QLF E GN+    Q+       S + L PE T   +  A   +G  +
Sbjct  157  NQLFLEKGNYAHVLQAANHRRTASGNSLPPEPTEEVAVEAKEENGVSQ  204



>ref|XP_006292212.1| hypothetical protein CARUB_v10018418mg [Capsella rubella]
 gb|EOA25110.1| hypothetical protein CARUB_v10018418mg [Capsella rubella]
Length=216

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GT  KCKAC+KTVY ++L++ +G+ YHKSCFRCSHC GTL + NYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ+  K+  + + E +R+P++ +S FSGTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQTAGKT--EKSNETSRAPNRLSSFFSGTQDKCA  107


 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E ++ +G +YHK+CFRC+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHF  158

Query  396  EQLFKESGNFNKNFQSPA  449
             QLF E GN++   Q+ A
Sbjct  159  SQLFLEKGNYSHVLQAAA  176



>emb|CDY15152.1| BnaC05g00310D [Brassica napus]
Length=205

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC  C+KTVY +++LS +G+ YHKSCF+C+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTTDKCDVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HF+QLFKESGNF+KNFQ P K+     PE T++PSK +S+F GTQ+KCA
Sbjct  61   HFDQLFKESGNFSKNFQ-PGKTEK---PEHTKTPSKISSIFCGTQDKCA  105


 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 4/93 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC ACEKTVYP+E +  +G  +HK+CFRC+H   TL  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELT  482
             QLF E GN+    Q+       S + L PE T
Sbjct  157  NQLFLEKGNYAHVLQAANHRRTASGNSLPPEPT  189



>ref|XP_006652565.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=200

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KC AC+KTV+ ++LL+ADG+ YHK+CF+CSHCKG L + +YSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+K F    +S+DK   EL R+PSK +S FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKKFTPGCRSSDK---ELARAPSKISSAFSGTQDKCA  106


 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K   +F GTQ KC AC+KTVYP+E L+ +G +YHKSCF+CSH    L  S+Y+++ GVL
Sbjct  92   SKISSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVL  151

Query  378  YCKPHFEQLFKESGNFN  428
            YCK HF QLF E G++N
Sbjct  152  YCKIHFGQLFMEKGSYN  168



>ref|XP_009118834.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=205

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GT  KC  C+KTVY +++LS +G+ YHKSCF+C+HCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKESGNF+KNFQ P K+     PE  ++PSK +S+F GTQ+KCA
Sbjct  61   HFEQLFKESGNFSKNFQ-PGKTEK---PEQNKTPSKISSIFCGTQDKCA  105


 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 4/93 (4%)
 Frame = +3

Query  216  FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHF  395
            F GTQ KC AC+KTVYP+E +  +G  +HK+CF+C+H    L  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHF  156

Query  396  EQLFKESGNFNKNFQSP----AKSADKLTPELT  482
             QLF E GN+    QS       S + L PE T
Sbjct  157  NQLFLEKGNYAHVLQSANHRRTASGNTLPPETT  189



>ref|XP_002965335.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
 ref|XP_002977179.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ21788.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ34173.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
Length=185

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
             SF GTQQKCKAC+KTVY V+ L+ADG+ YHK+CFRC HCKGTLKLSNY+S+EGVLYCKP
Sbjct  4    FSFAGTQQKCKACDKTVYLVDQLTADGVVYHKACFRCHHCKGTLKLSNYASLEGVLYCKP  63

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKC  533
            HF+QLFK +G+F+K+F+S       +  E +++PSK + +FSGTQEKC
Sbjct  64   HFDQLFKLTGSFDKSFES-GLLHKPVGEEASKTPSKTSLLFSGTQEKC  110


 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  198  TKKRMSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVL  377
            +K  + F GTQ+KC AC KTVYP+E ++ +  +YHKSCF+CSH   T+  SNY + EG L
Sbjct  97   SKTSLLFSGTQEKCFACGKTVYPIEKVTVENTSYHKSCFKCSHGGCTISPSNYQAHEGRL  156

Query  378  YCKPHFEQLFKESGNFNKNFQSPAKSADK  464
            YC+ H+ QL KE G+F+   ++P K+A K
Sbjct  157  YCRHHYAQLVKEKGDFSNLSKTPGKAAAK  185



>ref|NP_001053405.1| Os04g0532500 [Oryza sativa Japonica Group]
 emb|CAE04568.1| OSJNBb0039L24.7 [Oryza sativa Japonica Group]
 emb|CAE54551.1| OSJNBa0081C01.26 [Oryza sativa Japonica Group]
 dbj|BAF15319.1| Os04g0532500 [Oryza sativa Japonica Group]
 emb|CAJ86411.1| OSIGBa0125M19.14 [Oryza sativa Indica Group]
 gb|EAY94955.1| hypothetical protein OsI_16763 [Oryza sativa Indica Group]
 gb|EAZ31441.1| hypothetical protein OsJ_15578 [Oryza sativa Japonica Group]
 dbj|BAG91667.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEJ08685.1| PLIM2 [Oryza sativa]
Length=201

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 87/109 (80%), Gaps = 3/109 (3%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            MSF GTQ KC AC+KTV+ ++LL+ADG+ YHK+CF+CSHCKG L + +YSSM+GVLYCK 
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  390  HFEQLFKESGNFNKNFQSPAKSADKLTPELTRSPSKAASMFSGTQEKCA  536
            HFEQLFKE+G+F+K F    +S DK   EL R+PSK  S FSGTQ+KCA
Sbjct  61   HFEQLFKETGSFSKKFAPGCRSTDK---ELARAPSKICSAFSGTQDKCA  106


 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 9/88 (10%)
 Frame = +3

Query  192  RSTKKRMS---------FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLK  344
            RST K ++         F GTQ KC AC+KTVYP+E L+ +G +YHKSCF+CSH    L 
Sbjct  81   RSTDKELARAPSKICSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILT  140

Query  345  LSNYSSMEGVLYCKPHFEQLFKESGNFN  428
             S+Y+++ GVLYCK HF QLF E G++N
Sbjct  141  TSSYAALNGVLYCKIHFGQLFMEKGSYN  168



>gb|ABK22236.1| unknown [Picea sitchensis]
Length=187

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  210  MSFIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  389
            M+F GTQQKCKACEKTVY V+ L+ADG  +HK+CFRC HC GTLKLSNYSS EGVLYCKP
Sbjct  1    MAFAGTQQKCKACEKTVYVVDQLTADGSVFHKACFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  390  HFEQLFKESGNFNKNFQSPAKSA--DKLTPELTRSPSKAASMFSGTQEKC  533
            HF+QLFK +G+ +K+F+   K+   +KL     ++PS+ +++FSGTQEKC
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKAVKNEKLNDGEIKTPSRVSALFSGTQEKC  110


 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query  198  TKKRMS--FIGTQQKCKACEKTVYPVELLSADGINYHKSCFRCSHCKGTLKLSNYSSMEG  371
            T  R+S  F GTQ+KC AC  TVYP+E +S +G+ YHK CF+C H    +  SNY ++EG
Sbjct  95   TPSRVSALFSGTQEKCLACGNTVYPIEKVSVEGVGYHKQCFKCIHGGCVISPSNYIAIEG  154

Query  372  VLYCKPHFEQLFKESGNFNKNFQSPA  449
             LYCK H  QLFKE GN+++  ++P+
Sbjct  155  RLYCKHHHAQLFKEKGNYSQLIKTPS  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645