BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051C06

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    127   5e-31   Nicotiana tomentosiformis
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            126   1e-30   Solanum lycopersicum
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             126   1e-30   
ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    126   1e-30   Nicotiana tomentosiformis
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             125   2e-30   Prunus persica
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             125   2e-30   
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    125   3e-30   
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    125   4e-30   Prunus mume [ume]
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    125   4e-30   Nicotiana sylvestris
emb|CDO98349.1|  unnamed protein product                                124   5e-30   Coffea canephora [robusta coffee]
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    124   7e-30   
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    124   7e-30   Solanum tuberosum [potatoes]
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    124   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    123   2e-29   Sesamum indicum [beniseed]
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    122   4e-29   Eucalyptus grandis [rose gum]
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    122   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    122   4e-29   Pyrus x bretschneideri [bai li]
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    122   5e-29   Solanum tuberosum [potatoes]
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                121   7e-29   Erythranthe guttata [common monkey flower]
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    121   8e-29   
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    121   9e-29   Pyrus x bretschneideri [bai li]
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    121   9e-29   Nelumbo nucifera [Indian lotus]
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 121   1e-28   Gossypium hirsutum [American cotton]
emb|CAN64744.1|  hypothetical protein VITISV_041321                     121   1e-28   Vitis vinifera
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    121   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   1e-28   Nicotiana sylvestris
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    120   1e-28   Solanum lycopersicum
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    120   1e-28   Vitis vinifera
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_002883100.1|  N-methyltransferase 1                              120   1e-28   
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    120   1e-28   Gossypium arboreum [tree cotton]
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    120   2e-28   Ricinus communis
gb|KJB30121.1|  hypothetical protein B456_005G132000                    120   2e-28   Gossypium raimondii
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   2e-28   Camelina sativa [gold-of-pleasure]
gb|KJB30119.1|  hypothetical protein B456_005G132000                    119   2e-28   Gossypium raimondii
dbj|BAB02720.1|  methyl transferase-like protein                        120   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30123.1|  hypothetical protein B456_005G132000                    119   2e-28   Gossypium raimondii
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 120   3e-28   Lycium barbarum [Duke of Argyll's teatree]
gb|AAM13092.1|  unknown protein                                         120   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             119   3e-28   Capsella rubella
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             119   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    119   3e-28   Phoenix dactylifera
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 119   3e-28   Pyrus betulifolia
gb|KJB30117.1|  hypothetical protein B456_005G132000                    119   3e-28   Gossypium raimondii
ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    119   4e-28   Sesamum indicum [beniseed]
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    119   4e-28   Nelumbo nucifera [Indian lotus]
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             119   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30122.1|  hypothetical protein B456_005G132000                    119   4e-28   Gossypium raimondii
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    119   5e-28   
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 119   5e-28   Brassica napus [oilseed rape]
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    119   6e-28   Brassica rapa
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    119   6e-28   Phoenix dactylifera
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    118   8e-28   Arabis alpina [alpine rockcress]
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    118   8e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             118   8e-28   Eutrema salsugineum [saltwater cress]
gb|AFW83641.1|  hypothetical protein ZEAMMB73_560974                    115   8e-28   
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    119   9e-28   
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    118   1e-27   Fragaria vesca subsp. vesca
gb|EPS65842.1|  hypothetical protein M569_08933                         118   1e-27   Genlisea aurea
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             117   1e-27   
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    117   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    117   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    117   2e-27   Sesamum indicum [beniseed]
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    117   2e-27   Arabis alpina [alpine rockcress]
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             117   2e-27   Capsella rubella
gb|KDP23922.1|  hypothetical protein JCGZ_27082                         117   3e-27   Jatropha curcas
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    117   3e-27   Camelina sativa [gold-of-pleasure]
dbj|BAD93609.1|  hypothetical protein                                   113   4e-27   Cucumis melo [Oriental melon]
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    116   5e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                116   5e-27   Erythranthe guttata [common monkey flower]
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    116   5e-27   
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    116   5e-27   Cicer arietinum [garbanzo]
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    116   5e-27   
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    115   6e-27   
ref|NP_001148925.1|  LOC100282545                                       115   8e-27   Zea mays [maize]
ref|XP_006843796.1|  hypothetical protein AMTR_s00007p00250490          115   8e-27   Amborella trichopoda
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    115   8e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    115   8e-27   Brassica rapa
ref|XP_010097563.1|  hypothetical protein L484_017373                   115   1e-26   
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          115   1e-26   Sorghum bicolor [broomcorn]
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    115   1e-26   Brachypodium distachyon [annual false brome]
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                115   1e-26   Beta vulgaris [beet]
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    115   1e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 114   2e-26   Medicago truncatula
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 114   2e-26   Medicago truncatula
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                115   2e-26   Atriplex nummularia
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   114   2e-26   Citrus sinensis [apfelsine]
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            114   2e-26   
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 114   2e-26   
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   2e-26   Setaria italica
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            114   2e-26   
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 114   3e-26   Medicago truncatula
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             114   3e-26   Phaseolus vulgaris [French bean]
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                114   3e-26   Tripolium pannonicum [sea starwort]
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             114   3e-26   Citrus clementina [clementine]
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   3e-26   
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   4e-26   Cucumis sativus [cucumbers]
ref|XP_004166029.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    114   4e-26   
gb|AFK34653.1|  unknown                                                 110   4e-26   Lotus japonicus
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 114   4e-26   Oryza sativa [red rice]
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               114   4e-26   
ref|NP_001043957.1|  Os01g0695100                                       114   4e-26   
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               114   4e-26   Triticum urartu
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    114   5e-26   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ97525.1|  predicted protein                                      114   5e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM83845.1|  unnamed protein product                                113   5e-26   Triticum aestivum [Canadian hard winter wheat]
gb|EEE55232.1|  hypothetical protein OsJ_03109                          113   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    113   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          113   6e-26   
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   6e-26   Cucumis melo [Oriental melon]
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   7e-26   Oryza brachyantha
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    113   8e-26   Spinacia oleracea
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   8e-26   Solanum tuberosum [potatoes]
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   9e-26   Cucumis melo [Oriental melon]
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 112   1e-25   Atriplex canescens [shadscale]
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   1e-25   Brachypodium distachyon [annual false brome]
gb|KDP23923.1|  hypothetical protein JCGZ_27083                         112   1e-25   Jatropha curcas
ref|XP_004161835.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   1e-25   
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   2e-25   Solanum lycopersicum
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   2e-25   
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   2e-25   
ref|XP_006376718.1|  hypothetical protein POPTR_0012s044902g            106   2e-25   
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          112   2e-25   Sorghum bicolor [broomcorn]
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   3e-25   Nicotiana sylvestris
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   3e-25   Elaeis guineensis
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   4e-25   Setaria italica
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   4e-25   Elaeis guineensis
gb|ACJ83326.1|  unknown                                                 107   4e-25   Medicago truncatula
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    110   4e-25   Nicotiana tomentosiformis
ref|NP_001169597.1|  uncharacterized LOC100383478                       110   6e-25   Zea mays [maize]
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    110   7e-25   
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    110   7e-25   Cicer arietinum [garbanzo]
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    110   8e-25   Setaria italica
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    110   8e-25   Cucumis sativus [cucumbers]
dbj|BAH01482.1|  unnamed protein product                                110   9e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    110   9e-25   Brassica rapa
emb|CDX68222.1|  BnaA07g22620D                                          110   9e-25   
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    109   1e-24   
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          109   1e-24   Sorghum bicolor [broomcorn]
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    110   1e-24
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   2e-24   Camelina sativa [gold-of-pleasure]
emb|CDY11100.1|  BnaC06g23520D                                          109   2e-24   Brassica napus [oilseed rape]
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    108   2e-24   Arabis alpina [alpine rockcress]
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   3e-24   Oryza brachyantha
ref|XP_002887491.1|  predicted protein                                  108   4e-24   
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   5e-24   Cicer arietinum [garbanzo]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   5e-24   Zea mays [maize]
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   7e-24   
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    107   8e-24   Populus euphratica
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    107   8e-24   Populus euphratica
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   107   9e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            107   9e-24   Medicago truncatula
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    107   1e-23   
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        107   1e-23   Zea mays [maize]
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             106   2e-23   Capsella rubella
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    105   2e-23   Populus euphratica
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    106   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    105   3e-23   Populus euphratica
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             104   3e-23   
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                103   3e-23   Suaeda maritima
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    105   3e-23   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                103   3e-23   Suaeda japonica
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 103   3e-23   Suaeda liaotungensis
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             105   4e-23   Phaseolus vulgaris [French bean]
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             105   4e-23   Eutrema salsugineum [saltwater cress]
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             105   5e-23   Phaseolus vulgaris [French bean]
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 105   5e-23   Salicornia europaea [chicken-claws]
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    105   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    105   7e-23   Camelina sativa [gold-of-pleasure]
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative       103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    102   5e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79704.1|AC020889_12  T1N15.22                                   98.2    9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393388.1|  hypothetical protein EUTSA_v10012068mg           99.4    1e-21   
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       100   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2           98.6    4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KJB53041.1|  hypothetical protein B456_008G289900                  99.0    8e-21   Gossypium raimondii
emb|CDX93681.1|  BnaA06g03670D                                        97.1    1e-20   
emb|CDY40594.1|  BnaC06g02100D                                        97.1    1e-20   Brassica napus [oilseed rape]
gb|KJB53038.1|  hypothetical protein B456_008G289900                  98.6    1e-20   Gossypium raimondii
gb|KJB53040.1|  hypothetical protein B456_008G289900                  98.6    1e-20   Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                  98.6    1e-20   Gossypium raimondii
gb|KDD75565.1|  hypothetical protein H632_c615p0                      96.7    1e-20   Helicosporidium sp. ATCC 50920
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg           95.1    4e-20   
dbj|BAG50404.1|  methyltransferase                                    92.8    4e-20   Cardamine sp. SIM-2007
gb|KIZ00652.1|  hypothetical protein MNEG_7307                        94.4    6e-20   Monoraphidium neglectum
ref|XP_001763293.1|  predicted protein                                96.7    7e-20   
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...  94.0    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010461685.1|  PREDICTED: phosphomethylethanolamine N-methy...  94.0    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase          95.5    2e-19   Auxenochlorella protothecoides
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875           95.1    3e-19   Selaginella moellendorffii
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547           95.1    3e-19   Selaginella moellendorffii
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...  93.2    8e-19   
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...  93.2    1e-18   Vitis vinifera
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...  92.8    1e-18   Vitis vinifera
gb|AFZ78648.1|  methyl transferase                                    88.2    2e-18   Populus tomentosa [Chinese white poplar]
ref|XP_002317875.2|  Phosphoethanolamine N-methyltransferase 1 fa...  86.7    5e-18   
ref|XP_002454522.1|  hypothetical protein SORBIDRAFT_04g032625        87.0    5e-18   
ref|XP_001768934.1|  predicted protein                                90.9    5e-18   
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...  91.3    6e-18   Coccomyxa subellipsoidea C-169
gb|ABK24808.1|  unknown                                               90.9    6e-18   Picea sitchensis
ref|XP_002730517.1|  PREDICTED: phosphoethanolamine N-methyltrans...  84.7    5e-17   Saccoglossus kowalevskii
emb|CDX92181.1|  BnaA05g22260D                                        82.0    2e-15   
gb|KJB30120.1|  hypothetical protein B456_005G132000                  80.9    2e-15   Gossypium raimondii
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...  84.0    2e-15   Aplysia californica
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg           78.2    9e-15   
gb|EEC79642.1|  hypothetical protein OsI_20868                        78.6    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002594091.1|  hypothetical protein BRAFLDRAFT_68467            78.2    3e-14   Branchiostoma floridae
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...  80.1    5e-14   Aplysia californica
gb|EPS69227.1|  hypothetical protein M569_05544                       78.6    5e-14   Genlisea aurea
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase               79.3    6e-14   Glycine soja [wild soybean]
ref|XP_009011308.1|  hypothetical protein HELRODRAFT_71964            77.0    6e-14   Helobdella robusta
gb|AGO59019.1|  heat responsive transcription factor protein          76.3    1e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...  78.2    2e-13   Poecilia reticulata
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...  78.2    2e-13   Stegastes partitus
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...  78.2    2e-13   Poecilia reticulata
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...  78.2    2e-13   Stegastes partitus
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...  77.8    2e-13   Poecilia formosa
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790           77.8    3e-13   Branchiostoma floridae
ref|XP_006003521.1|  PREDICTED: phosphoethanolamine N-methyltrans...  75.5    3e-13   
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...  77.0    5e-13   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...  77.0    5e-13   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...  77.0    5e-13   Oreochromis niloticus
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...  77.0    5e-13   
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...  77.0    5e-13   Pundamilia nyererei
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.6    5e-13   Pundamilia nyererei
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.6    5e-13   Oreochromis niloticus
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.6    5e-13   
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.6    5e-13   Haplochromis burtoni
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.6    5e-13   
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.6    6e-13   Oreochromis niloticus
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.6    6e-13   Haplochromis burtoni
ref|XP_008872791.1|  hypothetical protein H310_08714                  76.6    6e-13   Aphanomyces invadans
ref|XP_009832411.1|  hypothetical protein H257_08283                  76.6    6e-13   Aphanomyces astaci
emb|CDQ92053.1|  unnamed protein product                              72.8    7e-13   Oncorhynchus mykiss
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...  76.6    7e-13   
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.3    8e-13   Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3        76.3    8e-13   Salmo salar
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...  76.3    8e-13   Xiphophorus maculatus
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...  76.3    8e-13   
gb|AHY01341.1|  phosphoethanolamine methyltransferase                 73.2    1e-12   Carassius gibelio [gibel carp]
ref|XP_002594077.1|  hypothetical protein BRAFLDRAFT_68483            73.9    1e-12   Branchiostoma floridae
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...  75.9    1e-12   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001096276.2|  phosphoethanolamine methyltransferase            75.9    1e-12   Xenopus tropicalis [western clawed frog]
gb|AFW78992.1|  hypothetical protein ZEAMMB73_932976                  71.2    1e-12   
gb|ETI43103.1|  hypothetical protein F443_11871                       72.8    2e-12   Phytophthora parasitica P1569
emb|CBI26879.3|  unnamed protein product                              70.5    2e-12   Vitis vinifera
gb|ETP40954.1|  hypothetical protein F442_11792                       73.2    2e-12   Phytophthora parasitica P10297
gb|ETP27600.1|  hypothetical protein F442_23122                       73.2    2e-12   Phytophthora parasitica P10297
gb|EWM27854.1|  phosphoethanolamine n-methyltransferase               75.5    2e-12   Nannochloropsis gaditana
emb|CDX95799.1|  BnaC05g35500D                                        71.2    2e-12   
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...  73.9    5e-12   Esox lucius
gb|ETL89752.1|  hypothetical protein L917_11366                       72.8    6e-12   Phytophthora parasitica
ref|XP_005855505.1|  phosphoethanolamine n-methyltransferase          73.9    6e-12   Nannochloropsis gaditana CCMP526
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...  73.6    7e-12   Phytophthora infestans T30-4
gb|ETK83144.1|  hypothetical protein L915_11579                       72.8    7e-12   Phytophthora parasitica
gb|ETO71769.1|  hypothetical protein F444_11956                       68.6    7e-12   Phytophthora parasitica P1976
gb|ETP40963.1|  hypothetical protein F442_11783                       68.6    8e-12   Phytophthora parasitica P10297
gb|ETM43048.1|  hypothetical protein L914_11412                       70.9    9e-12   Phytophthora parasitica
gb|EMT23239.1|  hypothetical protein F775_30181                       67.8    1e-11   
ref|XP_009525377.1|  hypothetical protein PHYSODRAFT_354467           71.6    1e-11   Phytophthora sojae
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...  72.8    1e-11   
ref|NP_001087172.1|  phosphoethanolamine methyltransferase            72.4    1e-11   Xenopus laevis [clawed frog]
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative      72.4    2e-11   Albugo laibachii Nc14
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase          72.0    2e-11   Phytophthora infestans T30-4
gb|AAI35513.1|  LOC100124841 protein                                  71.6    3e-11   Xenopus tropicalis [western clawed frog]
ref|XP_003970259.1|  PREDICTED: phosphoethanolamine N-methyltrans...  71.6    3e-11   
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg           64.3    4e-11   
gb|ETK83171.1|  hypothetical protein L915_11577                       68.6    4e-11   Phytophthora parasitica
gb|ETL36539.1|  hypothetical protein L916_11495                       68.6    5e-11   Phytophthora parasitica
ref|NP_001070105.1|  phosphoethanolamine methyltransferase            70.9    5e-11   Danio rerio [leopard danio]
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...  70.5    8e-11   
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888           70.1    9e-11   Phytophthora sojae
gb|KDO18851.1|  hypothetical protein SPRG_15850                       69.7    1e-10   Saprolegnia parasitica CBS 223.65
ref|XP_008620239.1|  hypothetical protein SDRG_15833                  69.7    1e-10   Saprolegnia diclina VS20
emb|CCI39434.1|  unnamed protein product                              68.9    2e-10   Albugo candida
emb|CAG09731.1|  unnamed protein product                              68.6    3e-10   Tetraodon nigroviridis
ref|XP_004137342.1|  PREDICTED: phosphoethanolamine N-methyltrans...  65.1    7e-10   Cucumis sativus [cucumbers]
ref|XP_004166030.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...  65.1    7e-10   
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756           66.6    1e-09   
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...  65.9    2e-09   
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...  65.5    3e-09   
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...  65.1    4e-09   
gb|ELU13998.1|  hypothetical protein CAPTEDRAFT_140071                62.4    5e-09   
gb|ELU02022.1|  hypothetical protein CAPTEDRAFT_91785                 62.4    6e-09   
gb|EKE08147.1|  Phosphoethanolamine N-methyltransferase               61.6    1e-08   
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                63.2    2e-08   
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                 62.0    4e-08   
gb|ETN83758.1|  methyltransferase domain protein                      60.8    1e-07   
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...  54.7    2e-07   
gb|EYC44164.1|  hypothetical protein Y032_0470g2031                   60.1    2e-07   
gb|KIH63696.1|  hypothetical protein ANCDUO_06001                     56.2    2e-07   
gb|ETL89780.1|  hypothetical protein L917_11359                       55.1    3e-07   
gb|KFM80232.1|  Phosphoethanolamine N-methyltransferase               57.4    4e-07   
emb|CDJ81011.1|  Methyltransferase type 11 domain containing protein  58.9    4e-07   
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...  54.7    5e-07   
gb|EAY75471.1|  hypothetical protein OsI_03371                        53.1    7e-07   
ref|NP_494991.1|  Protein PMT-1, isoform b                            57.8    1e-06   
gb|KIH53398.1|  hypothetical protein ANCDUO_16477                     53.9    1e-06   
ref|XP_006824126.1|  PREDICTED: phosphoethanolamine N-methyltrans...  54.7    2e-06   
ref|NP_494990.2|  Protein PMT-1, isoform a                            56.2    4e-06   
ref|XP_003108788.1|  CRE-PMT-1 protein                                55.5    5e-06   
ref|NP_871998.1|  Protein PMT-1, isoform d                            55.5    6e-06   
gb|EGT50464.1|  hypothetical protein CAEBREN_10892                    55.1    7e-06   
pdb|4KRG|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...  55.1    7e-06   
gb|EGT32041.1|  hypothetical protein CAEBREN_18341                    55.1    7e-06   
ref|XP_002630685.1|  C. briggsae CBR-PMT-1 protein                    55.1    9e-06   
gb|ERG79882.1|  phosphoethanolamine n-methyltransferase               53.5    3e-05   
emb|CEF71262.1|  Protein of unknown function DUF858, methyltransf...  53.5    3e-05   
gb|AER27603.1|  phosphoethanolamine N-methyltransferase               47.4    2e-04   
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1             45.4    2e-04   
gb|ETO35874.1|  phosphoethanolamine N-methyltransferase 2 (NMT2)      49.7    4e-04   
emb|CBI26877.3|  unnamed protein product                              49.7    6e-04   
emb|CAN75113.1|  hypothetical protein VITISV_043577                   49.7    6e-04   
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...  49.7    6e-04   
ref|WP_027370305.1|  hypothetical protein                             48.5    8e-04   
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...  43.1    0.001   



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  317  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  496
            ++ +A  A  G+ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEGK
Sbjct  4    VISAATTASSGQERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEGK  63

Query  497  SVLELGAGIGRFT  535
            SVLELGAGIGRFT
Sbjct  64   SVLELGAGIGRFT  76



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MAAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_007209941.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11140.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=463

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEV+S+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVVSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA +G+EREVQKSYWIEH+++LTVEAMMLDS AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVEGQEREVQKSYWIEHTADLTVEAMMLDSMAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 1/69 (1%)
 Frame = +2

Query  332  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            MAAF  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  61   LGAGIGRFT  69



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            M A  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MDAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MA+  GEERE+QKSYW+EHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MASSYGEEREIQKSYWMEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA Q +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LEL
Sbjct  1    MAAIQEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA QG+ER VQKSYW EHS+ LTVEAMMLDSKA+DLDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAAAQGDERHVQKSYWAEHSASLTVEAMMLDSKASDLDKEERPEILSLLPPYEGKTVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  320  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  499
            + S+++   GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKS
Sbjct  7    ISSSLSKHNGEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKS  66

Query  500  VLELGAGIGRFTR*IXLKS  556
            VLE GAGIGRFT    LK+
Sbjct  67   VLEFGAGIGRFTGEFALKA  85



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = +2

Query  332  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            MAAF  GEER VQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEERAVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  61   LGAGIGRFT  69



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  347  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  526
            GEER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIG
Sbjct  15   GEERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIG  74

Query  527  RFT  535
            RFT
Sbjct  75   RFT  77



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA Q EERE+QKSYW+EHS +LT+E+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVQDEEREMQKSYWVEHSVDLTLESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  514
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  515  AGIGRFT  535
            AGIGRFT
Sbjct  63   AGIGRFT  69



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  514
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  515  AGIGRFT  535
            AGIGRFT
Sbjct  63   AGIGRFT  69



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA Q EEREVQKSYWIEHSSELT+EAMMLDSKAADLDKEERPEVLS+LP ++GK VLEL
Sbjct  1    MAA-QVEEREVQKSYWIEHSSELTIEAMMLDSKAADLDKEERPEVLSLLPPFKGKDVLEL  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  62   LGAGIGRFT  70



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA QG+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAA-QGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  15   QERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  74

Query  530  FT  535
            FT
Sbjct  75   FT  76



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  514
             A  G+ER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELG
Sbjct  11   GAKSGQERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELG  70

Query  515  AGIGRFT  535
            AGIGRFT
Sbjct  71   AGIGRFT  77



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAAQVGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA+ GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKSVLE 
Sbjct  1    MAAY-GEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKSVLEF  59

Query  512  GAGIGRFTR*IXLKS  556
            GAGIGRFT    LK+
Sbjct  60   GAGIGRFTGEFALKA  74



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  62   LGAGIGRFT  70



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  332  MAAFQG-EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            MAA Q  EEREVQK+YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP+YEGKSVLE
Sbjct  1    MAAAQNVEEREVQKNYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPSYEGKSVLE  60

Query  509  LGAGIGRFT  535
             GAGIGRFT
Sbjct  61   FGAGIGRFT  69



>gb|KJB30121.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=422

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  62   LGAGIGRFT  70



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  62   LGAGIGRFT  70



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  62   LGAGIGRFT  70



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ER++QK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  15   QERDIQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  74

Query  530  FT  535
            FT
Sbjct  75   FT  76



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  332  MAAFQGEE-REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            MAAF GEE R VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLE
Sbjct  1    MAAFSGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLE  60

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  61   LGAGIGRFT  69



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  514
            A+  GEEREVQK+YW+EHS++LTVEAMMLDS A+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSNASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  515  AGIGRFT  535
            AGIGRFT
Sbjct  63   AGIGRFT  69



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  62   LGAGIGRFT  70



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA Q +EREVQKSYW+EHS +LT+EAMMLDS A DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAANQEQEREVQKSYWMEHSVDLTLEAMMLDSNACDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA QG ERE+QKSYWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP ++GKSVLEL
Sbjct  1    MAA-QGGEREIQKSYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPPFKGKSVLEL  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MA    EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKEERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA  G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LEL
Sbjct  1    MAA-NGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILEL  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  514
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+S +ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSXVELG  62

Query  515  AGIGRFT  535
            AGIGRFT
Sbjct  63   AGIGRFT  69



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA    ER+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEAERDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = +2

Query  329  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            A A+F+ E R+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLE
Sbjct  2    AAASFEAE-RDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLE  60

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  61   LGAGIGRFT  69



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 3/71 (4%)
 Frame = +2

Query  332  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  502
            MAAF G   EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAFSGAGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSV  60

Query  503  LELGAGIGRFT  535
            LELGAGIGRFT
Sbjct  61   LELGAGIGRFT  71



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS +LTVE+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSVDLTVESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPFEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>gb|AFW83641.1| hypothetical protein ZEAMMB73_560974 [Zea mays]
Length=244

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  347  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  526
             EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIG
Sbjct  18   AEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIG  77

Query  527  RFT  535
            RFT
Sbjct  78   RFT  80



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 2/80 (3%)
 Frame = +2

Query  302  YLFTAIVQSAMAAFQG--EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSM  475
            +LF++  Q  MA+     +ER VQ+SYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+
Sbjct  30   FLFSSFCQPYMASLATVQDERCVQRSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSL  89

Query  476  LPAYEGKSVLELGAGIGRFT  535
            LPAYEGKSV+ELGAGIGRFT
Sbjct  90   LPAYEGKSVVELGAGIGRFT  109



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  323  QSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  502
            ++A A   G+ERE+QKSYW E+S+ELTVE+MMLDSKA+DLDKEERPEVL+MLP YEGKSV
Sbjct  7    RTATANGSGKEREIQKSYWEENSTELTVESMMLDSKASDLDKEERPEVLAMLPPYEGKSV  66

Query  503  LELGAGIGRFT  535
            LELGAGIGRFT
Sbjct  67   LELGAGIGRFT  77



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREVQKSYWIEHS +LTVEAMMLDSKA++LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  2    QEREVQKSYWIEHSGDLTVEAMMLDSKASELDKEERPEVLSLLPSYEGKSVLELGAGIGR  61

Query  530  FTR*IXLKS  556
            FT  I  K+
Sbjct  62   FTGEIAKKA  70



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MA    +ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKKERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  530  FT  535
            FT
Sbjct  68   FT  69



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  341  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  520
            F  +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LELGAG
Sbjct  7    FVEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILELGAG  66

Query  521  IGRFT  535
            IGRFT
Sbjct  67   IGRFT  71



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGR
Sbjct  8    EERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGR  67

Query  530  FT  535
            FT
Sbjct  68   FT  69



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MA    EER +QKSYW+EHSS+LTVEAMMLDSKA DLDKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERHIQKSYWMEHSSDLTVEAMMLDSKATDLDKEERPEVLSLIPPYEGKTVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE+Q++YW+EHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP+YEGKSVLE GAGIGR
Sbjct  26   EEREIQRNYWMEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPSYEGKSVLEFGAGIGR  85

Query  530  FT  535
            FT
Sbjct  86   FT  87



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLD+EERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDREERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  530  FT  535
            FT
Sbjct  68   FT  69



>dbj|BAD93609.1| hypothetical protein [Cucumis melo]
Length=211

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  338  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  517
            A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVLELGA
Sbjct  9    ALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVLELGA  68

Query  518  GIGRFTR*IXLKS  556
            GIGRFT  + +K+
Sbjct  69   GIGRFTGDLAVKA  81



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EEREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   EEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   +EREVQK+YW+EHS  LT+E MMLDSKA+DLDKEERPEVL+MLP YEGKS+LEL
Sbjct  1    MAAITEQEREVQKNYWVEHSVNLTLEDMMLDSKASDLDKEERPEVLAMLPPYEGKSILEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  530  FT  535
            FT
Sbjct  69   FT  70



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ERE+QKSYW++H ++L+VEAMMLDSKA+DLDKEERPEVLS+LPAYEGKSV+ELGAGIGR
Sbjct  6    DEREIQKSYWVQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPAYEGKSVIELGAGIGR  65

Query  530  FT  535
            FT
Sbjct  66   FT  67



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  530  FT  535
            FT
Sbjct  69   FT  70



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 4/72 (6%)
 Frame = +2

Query  332  MAAFQG----EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  499
            MAA  G    EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS
Sbjct  1    MAAINGGGGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKS  60

Query  500  VLELGAGIGRFT  535
            VLELGAGIGRFT
Sbjct  61   VLELGAGIGRFT  72



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  314  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  493
            A V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEG
Sbjct  7    ATVVSLNGKMGAEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEG  66

Query  494  KSVLELGAGIGRFT  535
            KSVLELGAGIGRFT
Sbjct  67   KSVLELGAGIGRFT  80



>ref|XP_006843796.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 2/68 (3%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA QGE RE+QKSYWIEHSS+LTVEAMMLDSKAA+LDKEERPEVLS+LP ++GK+VLEL
Sbjct  1    MAA-QGE-REIQKSYWIEHSSDLTVEAMMLDSKAAELDKEERPEVLSLLPPFKGKNVLEL  58

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  59   GAGIGRFT  66



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  347  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  526
            GEEREVQK YWIEHS ELTVEAMMLDS A++LDKEERPEVLS+LP Y+GKSVLELGAGIG
Sbjct  12   GEEREVQKIYWIEHSKELTVEAMMLDSHASELDKEERPEVLSLLPPYKGKSVLELGAGIG  71

Query  527  RFT  535
            RFT
Sbjct  72   RFT  74



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MA     ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLEL
Sbjct  1    MATPYKAERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLEL  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  317  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  496
            +  +A     G+ERE QK YW++HS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK
Sbjct  1    MADAATVNANGQEREKQKIYWMQHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGK  60

Query  497  SVLELGAGIGRFT  535
            SVLELGAGIGRFT
Sbjct  61   SVLELGAGIGRFT  73



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  311  TAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYE  490
            TA V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP++E
Sbjct  5    TAAVVSVNGKMGVEERQAQKSYWEEHSRNLTVEAMMLDSRAADLDKEERPEVLSLLPSFE  64

Query  491  GKSVLELGAGIGRFT  535
            GKSVLELGAGIGRFT
Sbjct  65   GKSVLELGAGIGRFT  79



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  314  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  493
            A++      F G ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVLS+LP+YEG
Sbjct  5    AVIAVVENGFVGVERKVQKSYWEEHSRDLTVESMMLDSRAKDLDKEERPEVLSILPSYEG  64

Query  494  KSVLELGAGIGRFT  535
            K+VLELGAGIGRFT
Sbjct  65   KTVLELGAGIGRFT  78



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>gb|KEH21429.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=469

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  530  FT  535
            FT
Sbjct  71   FT  72



>gb|KEH21430.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=456

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  530  FT  535
            FT
Sbjct  71   FT  72



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 61/70 (87%), Gaps = 2/70 (3%)
 Frame = +2

Query  326  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  505
            SAM     EEREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVL
Sbjct  4    SAMGV--NEEREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVL  61

Query  506  ELGAGIGRFT  535
            ELGAGIGRFT
Sbjct  62   ELGAGIGRFT  71



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  533  T  535
            T
Sbjct  69   T  69



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  5    DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  64

Query  530  FT  535
            FT
Sbjct  65   FT  66



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  19   EERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  78

Query  530  FT  535
            FT
Sbjct  79   FT  80



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  16   EERQAQKSYWEEHSRDLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  75

Query  530  FT  535
            FT
Sbjct  76   FT  77



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  530  FT  535
            FT
Sbjct  71   FT  72



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  530  FT  535
            FT
Sbjct  71   FT  72



>ref|XP_007152684.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
 gb|ESW24678.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
Length=497

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 3/73 (4%)
 Frame = +2

Query  326  SAMAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  496
            +++A  QG   +ER VQKSYWIEH++EL+VE+MMLDS A+ LDKEERPEVLS+LPAYEGK
Sbjct  2    ASLAMVQGGGVDERCVQKSYWIEHTTELSVESMMLDSNASHLDKEERPEVLSLLPAYEGK  61

Query  497  SVLELGAGIGRFT  535
            SVLELGAGIGRFT
Sbjct  62   SVLELGAGIGRFT  74



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  514
                G+ERE+QK+YW+EHS +LTVE+MMLDS A+DLDKEERPEVLS+LP+YEGK VLELG
Sbjct  3    GVINGDEREIQKNYWVEHSVDLTVESMMLDSMASDLDKEERPEVLSLLPSYEGKRVLELG  62

Query  515  AGIGRFT  535
            AGIGRFT
Sbjct  63   AGIGRFT  69



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  533  T  535
            T
Sbjct  69   T  69



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  6    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  65

Query  533  T  535
            T
Sbjct  66   T  66



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  338  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  517
            A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVLELGA
Sbjct  9    ALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVLELGA  68

Query  518  GIGRFTR*IXLKS  556
            GIGRFT  + +K+
Sbjct  69   GIGRFTGDLAVKA  81



>ref|XP_004166029.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase-like 
[Cucumis sativus]
Length=500

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  338  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  517
            A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVLELGA
Sbjct  9    ALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVLELGA  68

Query  518  GIGRFTR*IXLKS  556
            GIGRFT  + +K+
Sbjct  69   GIGRFTGDLAVKA  81



>gb|AFK34653.1| unknown [Lotus japonicus]
Length=198

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EEREVQKSYWIEHSS+L++E+MMLDS A++LDKEERPEVLS+LPA E KSV+ELGAGIGR
Sbjct  15   EEREVQKSYWIEHSSDLSMESMMLDSNASNLDKEERPEVLSLLPAIESKSVIELGAGIGR  74

Query  530  FT  535
            FT
Sbjct  75   FT  76



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  530  FT  535
            FT
Sbjct  76   FT  77



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  20   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  79

Query  530  FT  535
            FT
Sbjct  80   FT  81



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  530  FT  535
            FT
Sbjct  76   FT  77



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  530  FT  535
            FT
Sbjct  81   FT  82



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  22   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  81

Query  530  FT  535
            FT
Sbjct  82   FT  83



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  25   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  84

Query  530  FT  535
            FT
Sbjct  85   FT  86



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  530  FT  535
            FT
Sbjct  81   FT  82



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  530  FT  535
            FT
Sbjct  76   FT  77



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EEREVQKSYW+EHS +LT+EAMMLDS+A++LDKEERPEVLS+LP Y+GKSVLELGAGIGR
Sbjct  13   EEREVQKSYWMEHSRDLTLEAMMLDSRASELDKEERPEVLSLLPPYKGKSVLELGAGIGR  72

Query  530  FT  535
            FT
Sbjct  73   FT  74



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  344  QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGI  523
             GEERE+QK+YW E+S++LT+E+MMLDSKA+DLDKEERPEVLS+LP +EGKSVLELGAGI
Sbjct  10   NGEEREIQKTYWTENSADLTIESMMLDSKASDLDKEERPEVLSVLPPFEGKSVLELGAGI  69

Query  524  GRFT  535
            GRFT
Sbjct  70   GRFT  73



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  347  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  526
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPE+LS+LP Y+GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEILSLLPPYDGKTVLELGAGIG  67

Query  527  RFT  535
            RFT
Sbjct  68   RFT  70



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER+ QKSYW EHS +LTVEAMMLDS+A DLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRATDLDKEERPEILSLLPSYEGKSVLELGAGIGR  75

Query  530  FT  535
            FT
Sbjct  76   FT  77



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +2

Query  326  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  505
            SAM   Q  EREV K YWIEHS +LTVEAMMLDS+A+DLDK ERPEVLSMLP YEGKSVL
Sbjct  4    SAMGVLQ--EREVFKKYWIEHSVDLTVEAMMLDSQASDLDKVERPEVLSMLPPYEGKSVL  61

Query  506  ELGAGIGRFT  535
            ELGAGIGRFT
Sbjct  62   ELGAGIGRFT  71



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  326  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  505
            +A+A   G+ERE+QKSYW+E ++EL +EAMMLDS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPGVGQEREIQKSYWMEQTTELNLEAMMLDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  506  ELGAGIGRFT  535
            ELGAGIGRFT
Sbjct  62   ELGAGIGRFT  71



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  338  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  517
            A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVLELGA
Sbjct  9    ALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVLELGA  68

Query  518  GIGRFTR*IXLKS  556
            GIGRFT  + +K+
Sbjct  69   GIGRFTGDLAVKA  81



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   112 bits (280),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            EREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVLELGAGIGRF
Sbjct  11   EREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVLELGAGIGRF  70

Query  533  T  535
            T
Sbjct  71   T  71


 Score = 31.2 bits (69),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAGQVIA+DFIE
Sbjct  67   IGRFTGELAEKAGQVIALDFIE  88



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE QK YW EHS +LTVEAMMLDS AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  19   EEREAQKKYWEEHSRDLTVEAMMLDSHAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  78

Query  530  FT  535
            FT
Sbjct  79   FT  80



>gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA   EERE+QK+YWIE+S  LTVEAMMLDS A+ LDKEERPEVLSMLP YEGKSVLE 
Sbjct  1    MAAAHVEEREIQKNYWIENSDGLTVEAMMLDSNASLLDKEERPEVLSMLPPYEGKSVLEF  60

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  61   GAGIGRFT  68



>ref|XP_004161835.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
1 [Cucumis sativus]
Length=527

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  341  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  520
            F G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAG
Sbjct  40   FTGQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAG  99

Query  521  IGRFT  535
            IGRFT
Sbjct  100  IGRFT  104



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  326  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  505
            +A+A   GEERE+QKSYW+E +SEL +EAMM DS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPEVGEEREIQKSYWMEQTSELNLEAMMRDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  506  ELGAGIGRFT  535
            ELGAGIGRFT
Sbjct  62   ELGAGIGRFT  71



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ER +QKSYW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGR
Sbjct  2    DERHIQKSYWLQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGR  61

Query  530  FTR*IXLKS  556
            FT  + LK+
Sbjct  62   FTGELALKA  70



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MA  Q +ER VQKSYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+LP YEGKSV+EL
Sbjct  1    MAMVQ-DERCVQKSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSLLPPYEGKSVVEL  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>ref|XP_006376718.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 ref|XP_006376719.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54515.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54516.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
Length=135

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  530  FT  535
            FT
Sbjct  66   FT  67



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER+VQKSYW EHS +LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  28   ERKVQKSYWEEHSKDLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRF  87

Query  533  T  535
            T
Sbjct  88   T  88



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            +AA   +ERE+QKSYW+E ++ELT+EAMMLDS+A+DLDKE+RPEVLS+LP+YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWMEQAAELTLEAMMLDSEASDLDKEDRPEVLSLLPSYEGKSVLEL  65

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  66   GAGIGRFT  73



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 3/71 (4%)
 Frame = +2

Query  332  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  502
            MAA  G   EER VQKSYW+EHS +LTV AMMLDS+A +LDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAVSGAGEEERMVQKSYWMEHSKDLTVAAMMLDSRATNLDKEERPEVLSLLPPYKGKSV  60

Query  503  LELGAGIGRFT  535
            LELGAGIGRFT
Sbjct  61   LELGAGIGRFT  71



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  329  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  505
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  7    AVANGIGEVERKVQKSYWEEHSKSLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  66

Query  506  ELGAGIGRFT  535
            ELGAGIGRFT
Sbjct  67   ELGAGIGRFT  76



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  10   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>gb|ACJ83326.1| unknown [Medicago truncatula]
Length=221

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  13   DEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLELGAGIGR  72

Query  530  FT  535
            FT
Sbjct  73   FT  74



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            +AA   +ERE+QKSYWIE ++ELT++AMMLDS+A+DLDKE+RPEVLS+LP YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWIEQAAELTLKAMMLDSEASDLDKEDRPEVLSLLPPYEGKSVLEL  65

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  66   GAGIGRFT  73



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  329  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  505
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  10   AVANGIGEVERKVQKSYWEEHSKCLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  69

Query  506  ELGAGIGRFT  535
            ELGAGIGRFT
Sbjct  70   ELGAGIGRFT  79



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  48   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  107

Query  530  FT  535
            FT
Sbjct  108  FT  109



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  508
            AM   + +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LE
Sbjct  6    AMTQVEEDEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILE  65

Query  509  LGAGIGRFT  535
            LGAGIGRFT
Sbjct  66   LGAGIGRFT  74



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER+ Q+SYW EHS +LTVEAMMLDS+AA+LDKE+RPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQRSYWEEHSRDLTVEAMMLDSRAAELDKEDRPEVLSLLPSYEGKSVLELGAGIGR  75

Query  530  FT  535
            FT
Sbjct  76   FT  77



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004161836.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
2 [Cucumis sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  347  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  526
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAGIG  67

Query  527  RFT  535
            RFT
Sbjct  68   RFT  70



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER+ Q+SYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRAADLDKEERPEVLSVLPSYKGKSVLELGAGIGRF  72

Query  533  T  535
            T
Sbjct  73   T  73



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  317  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  496
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  497  SVLELGAGIGRFT  535
            +VLE GAGIGRFT
Sbjct  70   TVLEFGAGIGRFT  82



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  317  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  496
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  497  SVLELGAGIGRFT  535
            +VLE GAGIGRFT
Sbjct  70   TVLEFGAGIGRFT  82



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  362  VQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLELGAGIGRFT
Sbjct  2    VQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLELGAGIGRFT  59



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
             ER+ Q+SYW EHS ELT+EAMMLDS+AA+LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   HERKAQRSYWEEHSGELTLEAMMLDSRAAELDKEERPEVLSLLPSYEGKSVLELGAGIGR  75

Query  530  FT  535
            FT
Sbjct  76   FT  77



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +2

Query  260  FSV-RIAFPGFLDFFYLFTAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAA  436
            FS+ R  +P      +LF ++    MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+
Sbjct  41   FSIHRFHYPREKIVSFLFPSVFSRIMASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKAS  99

Query  437  DLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            DLDKEERPE+L+ LP  EG +VLE GAGIGRFT
Sbjct  100  DLDKEERPEILAFLPPIEGTTVLEFGAGIGRFT  132



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  3    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  61

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  62   GAGIGRFT  69



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  317  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  496
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  497  SVLELGAGIGRFT  535
             VLE GAGIGRFT
Sbjct  70   KVLEFGAGIGRFT  82



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  317  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  496
            ++ S+     GEERE+QK+YW EHS++L+VE+MMLDS+AADLDKEERPE++++LP  EGK
Sbjct  10   MISSSFPKNLGEEREIQKNYWKEHSADLSVESMMLDSQAADLDKEERPEIVALLPPIEGK  69

Query  497  SVLELGAGIGRFT  535
            +VLE GAGIGRFT
Sbjct  70   TVLEFGAGIGRFT  82



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER+ Q+SYW EHS  LTVEAMMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKALTVEAMMLDSRAADLDKEERPEILSVLPSYKGKSVLELGAGIGRF  72

Query  533  T  535
            T
Sbjct  73   T  73



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  338  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  517
            A  GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L++LP  EGK+VLE GA
Sbjct  2    AVYGEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILALLPPIEGKTVLEFGA  61

Query  518  GIGRFT  535
            GIGRFT
Sbjct  62   GIGRFT  67



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LELGAGIGR
Sbjct  12   DEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILELGAGIGR  71

Query  530  FT  535
            FT
Sbjct  72   FT  73



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  320  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  499
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  500  VLELGAGIGRFT  535
            +LELGAGIGRFT
Sbjct  68   ILELGAGIGRFT  79



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  320  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  499
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  500  VLELGAGIGRFT  535
            +LELGAGIGRFT
Sbjct  68   ILELGAGIGRFT  79



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRF
Sbjct  15   ERKVQKSYWEEHSKDLTVESMMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRF  74

Query  533  T  535
            T
Sbjct  75   T  75



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  13   DEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLELGAGIGR  72

Query  530  FT  535
            FT
Sbjct  73   FT  74



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  15   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  74

Query  530  FT  535
            FT
Sbjct  75   FT  76



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  12   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  71

Query  530  FT  535
            FT
Sbjct  72   FT  73



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  EGK+VLE GAGIGR
Sbjct  19   EEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIEGKTVLEFGAGIGR  78

Query  530  FT  535
            FT
Sbjct  79   FT  80



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   105 bits (261),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  530  FT  535
            FT
Sbjct  66   FT  67


 Score = 30.4 bits (67),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAGQV+A+DFIE
Sbjct  63   IGRFTGELAQKAGQVVALDFIE  84



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MAA+  EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAYV-EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   105 bits (261),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  530  FT  535
            FT
Sbjct  82   FT  83


 Score = 30.4 bits (67),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAGQV+A+DFIE
Sbjct  79   IGRFTGELAQKAGQVVALDFIE  100



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   104 bits (260),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  530  FT  535
            FT
Sbjct  82   FT  83


 Score = 30.4 bits (67),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAGQV+A+DFIE
Sbjct  79   IGRFTGELAQKAGQVVALDFIE  100



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   103 bits (258),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71


 Score = 31.2 bits (69),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAGQVIA+DFIE
Sbjct  67   IGRFTGELAEKAGQVIALDFIE  88



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE 
Sbjct  1    MASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEF  59

Query  512  GAGIGRFT  535
            GAGIGRFT
Sbjct  60   GAGIGRFT  67



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   103 bits (258),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71


 Score = 31.2 bits (69),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAGQVIA+DFIE
Sbjct  67   IGRFTGELAEKAGQVIALDFIE  88



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   103 bits (258),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71


 Score = 31.2 bits (69),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAGQVIA+DFIE
Sbjct  67   IGRFTGELAEKAGQVIALDFIE  88



>ref|XP_007160543.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32537.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=517

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
             ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGR
Sbjct  10   NERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  320  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  499
            + S+ +    EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  +G++
Sbjct  10   IASSFSKNSWEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIDGRT  69

Query  500  VLELGAGIGRFT  535
            VLE GAGIGRFT
Sbjct  70   VLEFGAGIGRFT  81



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
             ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGR
Sbjct  10   NERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER V K YW+EH+++LTVE+MMLDS+A+DLDKEERPE+LS+LP  EGK VLELGAGIGR
Sbjct  10   EERNVFKKYWVEHTTDLTVESMMLDSQASDLDKEERPEILSLLPNLEGKCVLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  530  FT  535
            FT
Sbjct  80   FT  81



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  530  FT  535
            FT
Sbjct  80   FT  81



>gb|AAM97038.1| phosphoethanolamine N-methyltransferase, putative [Arabidopsis 
thaliana]
Length=376

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  530  FT  535
            FT
Sbjct  80   FT  81



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  530  FT  535
            FT
Sbjct  80   FT  81



>gb|AAF79704.1|AC020889_12 T1N15.22 [Arabidopsis thaliana]
Length=180

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFT
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFT  52



>ref|XP_006393388.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
 gb|ESQ30674.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
Length=258

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  511
            MA    EER +QKSY  E+SS+LTVEA+MLDSK +D DKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERVIQKSYLKENSSDLTVEAIMLDSKDSDPDKEERPEVLSLIPPYEGKTVLEL  60

Query  512  GAGIGRFT  535
            GAGIG FT
Sbjct  61   GAGIGHFT  68



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG + LE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTALEFGAGIGR  79

Query  530  FT  535
            FT
Sbjct  80   FT  81



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score = 98.6 bits (244),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFT
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFT  52


 Score = 29.6 bits (65),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAG+VIA+DFIE
Sbjct  48   IGRFTGELAQKAGEVIALDFIE  69



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  533  T  535
            T
Sbjct  66   T  66



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score = 97.1 bits (240),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFT
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFT  52


 Score = 29.6 bits (65),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAG+VIA+DFIE
Sbjct  48   IGRFTGELAQKAGEVIALDFIE  69



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score = 97.1 bits (240),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFT
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFT  52


 Score = 29.6 bits (65),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAG+VIA+DFIE
Sbjct  48   IGRFTGELAQKAGEVIALDFIE  69



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  533  T  535
            T
Sbjct  66   T  66



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  533  T  535
            T
Sbjct  66   T  66



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  5    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  64

Query  533  T  535
            T
Sbjct  65   T  65



>gb|KDD75565.1| hypothetical protein H632_c615p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=278

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER VQK YWIEHS+  TVE MMLDSKAAD+DK ERPEVL +L + EGK V+ELGAGIGRF
Sbjct  10   ERAVQKQYWIEHSANATVETMMLDSKAADIDKMERPEVLELLGSVEGKDVVELGAGIGRF  69

Query  533  T  535
            T
Sbjct  70   T  70



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score = 95.1 bits (235),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +E+SS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGRFT
Sbjct  1    MENSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGRFT  52


 Score = 29.6 bits (65),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAG+VIA+DFIE
Sbjct  48   IGRFTGELAQKAGEVIALDFIE  69



>dbj|BAG50404.1| methyltransferase [Cardamine sp. SIM-2007]
Length=148

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  386  HSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            HS++LTVEAMMLDS+A+DLDKEERP VLS+LP+YEGKSVLELGAGIGRFT
Sbjct  1    HSADLTVEAMMLDSRASDLDKEERPGVLSLLPSYEGKSVLELGAGIGRFT  50



>gb|KIZ00652.1| hypothetical protein MNEG_7307 [Monoraphidium neglectum]
Length=252

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +EREVQ +YW+EHS E TVEAMMLDSKA+++D+ ERPEVLS L + +GK VLELGAGIGR
Sbjct  10   QEREVQLNYWLEHSKEPTVEAMMLDSKASEIDQMERPEVLSTLGSIKGKRVLELGAGIGR  69

Query  530  FT  535
            FT
Sbjct  70   FT  71



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER +Q +YW EHS E +VEAMMLDS+A+ LDKEERPE+LS+LP YE K V+ELGAGIGRF
Sbjct  6    ERSLQSTYWKEHSVEPSVEAMMLDSQASKLDKEERPEILSLLPPYENKDVMELGAGIGRF  65

Query  533  T  535
            T
Sbjct  66   T  66



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score = 94.0 bits (232),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERP-EVLSMLPAYEGKSVLELGAGIGRFT  535
            +EHSS+LTVEAMMLDSKA+DLDKEERP EVLS++P YEGKSVLELGAGIGRFT
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLIPPYEGKSVLELGAGIGRFT  53


 Score = 29.6 bits (65),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAG+VIA+DFIE
Sbjct  49   IGRFTGELAQKAGEVIALDFIE  70



>ref|XP_010461685.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
 ref|XP_010461686.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=234

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERP-EVLSMLPAYEGKSVLELGAGIGRFT  535
            +EHSS+LTVEAMMLDSKA+DLDKEERP EVLS++P YEGKSVLELGAGIGRFT
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLVPPYEGKSVLELGAGIGRFT  53



>ref|XP_011399976.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
 gb|KFM27020.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
Length=503

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ERE QKSYW EHSS  TVE+MMLDS+AAD+DK ERPEVL +L + +G  V+ELGAGIGR
Sbjct  5    QEREAQKSYWAEHSSNATVESMMLDSQAADIDKLERPEVLKLLGSVDGLDVVELGAGIGR  64

Query  530  FTR  538
            FTR
Sbjct  65   FTR  67



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  533  T  535
            T
Sbjct  69   T  69



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  533  T  535
            T
Sbjct  69   T  69



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score = 93.2 bits (230),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGRFT
Sbjct  1    MEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGRFT  52


 Score = 26.9 bits (58),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + +AG V+A+DFIE
Sbjct  48   IGRFTGELAKEAGHVLALDFIE  69



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  347  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  526
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  527  RFT  535
            RFT
Sbjct  65   RFT  67



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  347  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  526
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  527  RFT  535
            RFT
Sbjct  65   RFT  67



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score = 88.2 bits (217),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            ++++S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFT
Sbjct  1    MDNTSDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFT  52


 Score = 30.8 bits (68),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAGQV+A+DFIE
Sbjct  48   IGRFTGELAQKAGQVVALDFIE  69



>ref|XP_002317875.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
 gb|EEE96095.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
Length=129

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFT
Sbjct  1    MDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFT  52



>ref|XP_002454522.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
 gb|EES07498.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
Length=136

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  395  ELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
             LTVEAMMLDS+AADL++EERPEVLS+LP+YEGKSVLELGAGIG FT
Sbjct  18   NLTVEAMMLDSRAADLNREERPEVLSLLPSYEGKSVLELGAGIGHFT  64



>ref|XP_001768934.1| predicted protein [Physcomitrella patens]
 gb|EDQ66288.1| predicted protein [Physcomitrella patens]
Length=431

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER +Q +YW EHS   +VE MMLDS+A  LD EERPE+LS+LP Y+GK V+ELGAGIGRF
Sbjct  17   ERTLQSNYWKEHSVNPSVETMMLDSQAPKLDLEERPEILSLLPPYKGKDVIELGAGIGRF  76

Query  533  T  535
            T
Sbjct  77   T  77



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            EER  QKSYW +HS+  +VEAMMLDS+A+ +DKEERPEVL+ML   EG  ++ELGAGIGR
Sbjct  16   EERAAQKSYWADHSATASVEAMMLDSQASVIDKEERPEVLTMLGCVEGARIVELGAGIGR  75

Query  530  FTR*IXLKSR  559
            FT  + + +R
Sbjct  76   FTGELAVAAR  85



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  532
            ER +Q +YW EHS  L++EAMMLDS+A+ LD+EERPE++S+LP  EGKSV+ELGAGIGR+
Sbjct  6    ERALQLNYWKEHSVVLSLEAMMLDSQASKLDQEERPEIISLLPPLEGKSVIELGAGIGRY  65

Query  533  T  535
            T
Sbjct  66   T  66



>ref|XP_002730517.1| PREDICTED: phosphoethanolamine N-methyltransferase-like, partial 
[Saccoglossus kowalevskii]
Length=160

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  347  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  526
             E R+V  SYW++HS + ++E MMLD++A  L + E PE+LS+LP YEGK ++ELGAGIG
Sbjct  4    NEVRQVMSSYWMDHSKDASLEEMMLDTQAESLAQSEHPEILSLLPPYEGKRIIELGAGIG  63

Query  527  RFT  535
            RFT
Sbjct  64   RFT  66



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score = 82.0 bits (201),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  413  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            MMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGRFT
Sbjct  1    MMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGRFT  41


 Score = 27.3 bits (59),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + KAG++IA+DFI+
Sbjct  37   IGRFTGELAQKAGELIALDFID  58



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score = 80.9 bits (198),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  413  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            MMLDSKAAD+DKEERPEVLS+LP YEGK++LELGAGIGRFT
Sbjct  1    MMLDSKAADIDKEERPEVLSLLPPYEGKTILELGAGIGRFT  41


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   G+ + KAG VIA+DFIE
Sbjct  37   IGRFTGDLAKKAGHVIALDFIE  58



>ref|XP_005096334.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Aplysia californica]
Length=494

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            E R+V  +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGR
Sbjct  4    EVRQVMAAYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGR  63

Query  530  FTR*IXLKSR  559
            FT  I  K++
Sbjct  64   FTTEIAKKAK  73



>ref|XP_006306318.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
 gb|EOA39216.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
Length=354

 Score = 78.2 bits (191),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 3/54 (6%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDS-KAADLDKEE--RPEVLSMLPAYEGKSVLELGAGIGRF  532
            +EHSS+LT EAMMLDS +A+DLD+EE  RPEVLS++P YEGKSVLELGAGI RF
Sbjct  1    MEHSSDLTAEAMMLDSTEASDLDEEEERRPEVLSLIPPYEGKSVLELGAGIDRF  54


 Score = 28.5 bits (62),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +3

Query  537  GEXSSKAGQVIAMDFIE  587
            GE + KAG+VIA+DFIE
Sbjct  56   GEVAQKAGEVIALDFIE  72



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score = 78.6 bits (192),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 9/70 (13%)
 Frame = +2

Query  353  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERP---------EVLSMLPAYEGKSVL  505
            ER+ Q+SYW EHS +LTVEAMMLDS+     +   P         +VLS+LP+Y+GKSVL
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRPRRPRQGGAPRGLIGTVDAQVLSVLPSYKGKSVL  72

Query  506  ELGAGIGRFT  535
            ELGAGIGRFT
Sbjct  73   ELGAGIGRFT  82


 Score = 26.9 bits (58),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + +AG V+A+DFIE
Sbjct  78   IGRFTGELAKEAGHVLALDFIE  99



>ref|XP_002594091.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
 gb|EEN50102.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
Length=242

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R+    +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EGK++LELGAGIGR+T
Sbjct  10   RDKMSQFWREHSSQASIEEMMLDDAAKELSKDELPEILSLLPGIEGKTILELGAGIGRYT  69



>ref|XP_005096335.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Aplysia californica]
 ref|XP_005096336.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Aplysia californica]
Length=486

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  371  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IXL  550
            +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGRFT  I  
Sbjct  3    AYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGRFTTEIAK  62

Query  551  KSR  559
            K++
Sbjct  63   KAK  65



>gb|EPS69227.1| hypothetical protein M569_05544 [Genlisea aurea]
Length=333

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  398  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            L++E MM D+KA+DLD+EERPEVLS++P Y+GKS+LELGAG+GRFT
Sbjct  69   LSIEDMMADTKASDLDREERPEVLSLVPPYDGKSILELGAGVGRFT  114



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  413  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IXLKS  556
            MMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGRFT  + LK+
Sbjct  1    MMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGRFTGELALKA  48



>ref|XP_009011308.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
 gb|ESO11039.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
Length=215

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  368  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IX  547
            +++W EHS++   E MMLDS A  L +EE PE+LS+LP  EGKSVLELGAGIGRF+  I 
Sbjct  2    QNFWKEHSTKANEEEMMLDSDADTLGREEVPEILSLLPGLEGKSVLELGAGIGRFSGRIA  61

Query  548  LKSR  559
             K++
Sbjct  62   AKAK  65



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score = 76.3 bits (186),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  413  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRFT
Sbjct  1    MMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRFT  41


 Score = 26.6 bits (57),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + +AG VIA+DFI+
Sbjct  37   IGRFTGELAKEAGHVIALDFID  58



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFT  63



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  23   RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  82



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFT  64



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  64



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT
Sbjct  11   FWKEHSKGATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFT  64



>ref|XP_002594089.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
 gb|EEN50100.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
Length=577

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 6/74 (8%)
 Frame = +2

Query  332  MAAFQGEE------REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  493
            M++ QGE       R+    +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EG
Sbjct  1    MSSDQGESAEYEATRDKMSQFWREHSSKASLEEMMLDDNAKELSKDELPEILSLLPGIEG  60

Query  494  KSVLELGAGIGRFT  535
            K++LELGAGIGR+T
Sbjct  61   KTILELGAGIGRYT  74



>ref|XP_006003521.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Latimeria chalumnae]
Length=264

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  368  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IX  547
            K +W EHS E +VE MMLDS A  + +E+R E+++MLP  EGK VLELGAGIGRF+  + 
Sbjct  2    KQFWEEHSKEASVEEMMLDSNAQAIAEEDRSEIIAMLPCVEGKDVLELGAGIGRFSGQLA  61

Query  548  LKSR  559
             K+R
Sbjct  62   KKAR  65



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64



>ref|XP_003444639.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Oreochromis niloticus]
Length=493

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  6    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  65

Query  536  R*IXLKS  556
            + +  K+
Sbjct  66   KHLLTKA  72



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  4    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  63

Query  536  R*IXLKS  556
            + +  K+
Sbjct  64   KHLLTKA  70



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  64

Query  536  R*IXLKS  556
            + +  K+
Sbjct  65   KHLLTKA  71



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IXLK  553
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T+ +  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  554  S  556
            +
Sbjct  64   A  64



>ref|XP_005467629.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X4 [Oreochromis niloticus]
Length=485

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IXLK  553
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T+ +  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  554  S  556
            +
Sbjct  64   A  64



>ref|XP_004545582.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Maylandia zebra]
Length=491

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  4    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  63

Query  536  R*IXLKS  556
            + +  K+
Sbjct  64   KHLLTKA  70



>ref|XP_005913451.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Haplochromis burtoni]
Length=485

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IXLK  553
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T+ +  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  554  S  556
            +
Sbjct  64   A  64



>ref|XP_004545581.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Maylandia zebra]
Length=492

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IXLK  553
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T+ +  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  554  S  556
            +
Sbjct  71   A  71



>ref|XP_005467627.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005467628.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Oreochromis niloticus]
Length=492

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  64

Query  536  R*IXLKS  556
            + +  K+
Sbjct  65   KHLLTKA  71



>ref|XP_005913450.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Haplochromis burtoni]
Length=492

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  64

Query  536  R*IXLKS  556
            + +  K+
Sbjct  65   KHLLTKA  71



>ref|XP_008872791.1| hypothetical protein H310_08714 [Aphanomyces invadans]
 gb|ETV98594.1| hypothetical protein H310_08714 [Aphanomyces invadans]
Length=503

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            E R   K+YW+EHSS+  VE MMLDS A  L + E PE+LS +P+Y+ K VLE+ AGIGR
Sbjct  19   ETRTSMKAYWVEHSSDSNVETMMLDSNAKILTELETPEILSKMPSYKDKDVLEMAAGIGR  78

Query  530  FT  535
            +T
Sbjct  79   YT  80



>ref|XP_009832411.1| hypothetical protein H257_08283 [Aphanomyces astaci]
 gb|ETV78074.1| hypothetical protein H257_08283 [Aphanomyces astaci]
Length=507

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            E R   K+YW+EHSS+  VE MMLDS A  L + E PE+LS +P+Y+ K VLE+ AGIGR
Sbjct  23   ETRTSMKAYWVEHSSDSNVETMMLDSNAKILTELETPEILSKMPSYKDKDVLEMAAGIGR  82

Query  530  FT  535
            +T
Sbjct  83   YT  84



>emb|CDQ92053.1| unnamed protein product [Oncorhynchus mykiss]
Length=135

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +W EHS + TVE MMLDS A +L   E PE+LS+LP+  G+ VLELGAGIGR+T
Sbjct  4    FWKEHSRQATVEEMMLDSHAQELTLHELPEILSLLPSLSGQRVLELGAGIGRYT  57



>ref|XP_010730439.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Larimichthys crocea]
Length=506

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP  +G  VLELGAGIGR+T
Sbjct  19   RSNMTEFWKEHSKAATVEEMMLDSRARELTQHELPEILSMLPCLDGYRVLELGAGIGRYT  78

Query  536  R*IXLKSR  559
              +  K+R
Sbjct  79   SHLLTKAR  86



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  371  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  3    AFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  57



>ref|NP_001167350.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
 gb|ACN11445.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
Length=495

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            +ER     +W EHS + TVE MMLDS A +L + E PE+LS+LP+  G+ VLELGAGIGR
Sbjct  4    KERSTMTEFWKEHSRQATVEEMMLDSHAQELTQHELPEILSLLPSLSGQRVLELGAGIGR  63

Query  530  FT  535
            +T
Sbjct  64   YT  65



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +W EHS   TVE MMLDS+A  L + E PE+LSMLP  EG+ VLELGAGIGRFT
Sbjct  11   FWKEHSKAATVEEMMLDSQAKKLTEHELPEILSMLPPLEGRRVLELGAGIGRFT  64



>ref|XP_010730440.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Larimichthys crocea]
Length=500

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP  +G  VLELGAGIGR+T
Sbjct  13   RSNMTEFWKEHSKAATVEEMMLDSRARELTQHELPEILSMLPCLDGYRVLELGAGIGRYT  72

Query  536  R*IXLKSR  559
              +  K+R
Sbjct  73   SHLLTKAR  80



>gb|AHY01341.1| phosphoethanolamine methyltransferase, partial [Carassius gibelio]
Length=172

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTR*IXLK  553
            +W EHS   TVE MMLD+ A +L + E PE+LS+LP+     VLELGAGIGRFTR +  K
Sbjct  4    FWKEHSKFATVEEMMLDTNAQELTQHELPEILSLLPSLAASDVLELGAGIGRFTRHLIGK  63

Query  554  SR  559
            +R
Sbjct  64   AR  65



>ref|XP_002594077.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
 gb|EEN50088.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
Length=274

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +W E S + +++ MMLD  A +LD+EERPE+L+MLP  +GK VLELGAGIGRFT
Sbjct  56   FWREQSHDGSLQEMMLDENADELDQEERPEILAMLPDLKGKRVLELGAGIGRFT  109



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP  EG  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPRLEGCKVLELGAGIGRYT  64

Query  536  R*IXLKS  556
            + +  K+
Sbjct  65   KHLLTKA  71



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  529
            + R+V   +W EHS + TVE MMLDS A  L  EE+PE++ +LP  +G SVLELGAGIGR
Sbjct  4    DTRQVMTQFWEEHSRDATVEEMMLDSSAKLLSLEEKPEIILLLPCLDGHSVLELGAGIGR  63

Query  530  FT  535
            +T
Sbjct  64   YT  65



>gb|AFW78992.1| hypothetical protein ZEAMMB73_932976 [Zea mays]
Length=101

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = +2

Query  329  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLP  481
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPEVL   P
Sbjct  10   AVANGIGEVERKVQKSYWEEHSKCLTVESMMLDSRAADLDKEERPEVLHQHP  61



>gb|ETI43103.1| hypothetical protein F443_11871, partial [Phytophthora parasitica 
P1569]
 gb|ETL36535.1| hypothetical protein L916_11499, partial [Phytophthora parasitica]
 gb|ETM43021.1| hypothetical protein L914_11419, partial [Phytophthora parasitica]
 gb|ETO71742.1| hypothetical protein F444_11963, partial [Phytophthora parasitica 
P1976]
 gb|ETP12862.1| hypothetical protein F441_11831, partial [Phytophthora parasitica 
CJ01A1]
Length=211

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R+  KSYW EHSS   +E MMLDS A  L + E PE++   P+ E K VLEL AGIGRFT
Sbjct  10   RQQMKSYWTEHSSNTDIETMMLDSNAKVLHEREMPEIMERAPSMENKDVLELAAGIGRFT  69



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score = 70.5 bits (171),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  380  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            +EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIGRFT
Sbjct  1    MEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIGRFT  52


 Score = 28.5 bits (62),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  522  LGVSPGEXSSKAGQVIAMDFIE  587
            +G   GE + +AGQV+A+DFIE
Sbjct  48   IGRFTGELAKQAGQVLAIDFIE  69



>gb|ETP40954.1| hypothetical protein F442_11792, partial [Phytophthora parasitica 
P10297]
Length=268

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R+  KSYW EHSS   +E MMLDS A  L + E PE++   P+ E K VLEL AGIGRFT
Sbjct  10   RQQMKSYWTEHSSNTDIETMMLDSNAKVLHEREMPEIMERAPSMENKDVLELAAGIGRFT  69



>gb|ETP27600.1| hypothetical protein F442_23122, partial [Phytophthora parasitica 
P10297]
Length=269

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  356  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  535
            R+  KSYW EHSS   +E MMLDS A  L + E PE++   P+ E K VLEL AGIGRFT
Sbjct  10   RQQMKSYWTEHSSNTDIETMMLDSNAKVLHEREMPEIMERAPSMENKDVLELAAGIGRFT  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925