BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051A23

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788106.1|  PREDICTED: tobamovirus multiplication protei...    147   4e-39   Nicotiana sylvestris
ref|XP_009590611.1|  PREDICTED: tobamovirus multiplication protei...    146   5e-39   Nicotiana tomentosiformis
ref|XP_004245872.1|  PREDICTED: tobamovirus multiplication protei...    145   1e-38   Solanum lycopersicum
ref|XP_006358577.1|  PREDICTED: tobamovirus multiplication protei...    145   2e-38   Solanum tuberosum [potatoes]
gb|AIX10945.1|  putative tetraspanin family protein                     142   3e-37   Gardenia jasminoides
gb|EYU17845.1|  hypothetical protein MIMGU_mgv1a0219312mg               133   8e-35   Erythranthe guttata [common monkey flower]
gb|EYU33040.1|  hypothetical protein MIMGU_mgv1a011318mg                134   4e-34   Erythranthe guttata [common monkey flower]
gb|KJB37690.1|  hypothetical protein B456_006G215600                    133   5e-34   Gossypium raimondii
gb|KHG08208.1|  Tetraspanin-33                                          130   4e-33   Gossypium arboreum [tree cotton]
gb|KHG01123.1|  hypothetical protein F383_00667                         130   5e-33   Gossypium arboreum [tree cotton]
ref|XP_006485406.1|  PREDICTED: tobamovirus multiplication protei...    130   8e-33   Citrus sinensis [apfelsine]
gb|KDO40489.1|  hypothetical protein CISIN_1g038963mg                   125   1e-32   Citrus sinensis [apfelsine]
ref|XP_003517379.1|  PREDICTED: tobamovirus multiplication protei...    129   1e-32   Glycine max [soybeans]
gb|KJB51694.1|  hypothetical protein B456_008G228700                    129   2e-32   Gossypium raimondii
gb|ACU24289.1|  unknown                                                 129   2e-32   Glycine max [soybeans]
gb|KHN42626.1|  hypothetical protein glysoja_018869                     129   2e-32   Glycine soja [wild soybean]
ref|XP_011018623.1|  PREDICTED: tobamovirus multiplication protei...    129   3e-32   Populus euphratica
ref|XP_008465936.1|  PREDICTED: tobamovirus multiplication protei...    128   4e-32   Cucumis melo [Oriental melon]
ref|XP_008375915.1|  PREDICTED: tobamovirus multiplication protei...    127   4e-32   
ref|XP_007039575.1|  Tobamovirus multiplication 2A isoform 1            127   6e-32   Theobroma cacao [chocolate]
gb|EYU33039.1|  hypothetical protein MIMGU_mgv1a011319mg                128   6e-32   Erythranthe guttata [common monkey flower]
gb|KJB25374.1|  hypothetical protein B456_004G188200                    127   8e-32   Gossypium raimondii
ref|XP_009345636.1|  PREDICTED: tobamovirus multiplication protei...    127   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_003539155.1|  PREDICTED: tobamovirus multiplication protei...    127   1e-31   Glycine max [soybeans]
ref|XP_007156638.1|  hypothetical protein PHAVU_002G004900g             127   1e-31   Phaseolus vulgaris [French bean]
gb|KCW71823.1|  hypothetical protein EUGRSUZ_E00307                     125   2e-31   Eucalyptus grandis [rose gum]
ref|XP_006368443.1|  GMFP4 family protein                               126   2e-31   Populus trichocarpa [western balsam poplar]
gb|KDP36200.1|  hypothetical protein JCGZ_10291                         125   3e-31   Jatropha curcas
ref|XP_007156640.1|  hypothetical protein PHAVU_002G005000g             125   3e-31   Phaseolus vulgaris [French bean]
ref|XP_003524459.1|  PREDICTED: tobamovirus multiplication protei...    125   4e-31   
ref|XP_006415200.1|  hypothetical protein EUTSA_v10008423mg             125   5e-31   Eutrema salsugineum [saltwater cress]
ref|XP_011070225.1|  PREDICTED: tobamovirus multiplication protei...    125   6e-31   Sesamum indicum [beniseed]
ref|XP_010269960.1|  PREDICTED: tobamovirus multiplication protei...    125   7e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010055355.1|  PREDICTED: tobamovirus multiplication protei...    125   8e-31   Eucalyptus grandis [rose gum]
ref|XP_002527636.1|  conserved hypothetical protein                     124   8e-31   Ricinus communis
ref|XP_010053569.1|  PREDICTED: tobamovirus multiplication protei...    124   1e-30   Eucalyptus grandis [rose gum]
gb|KEH31557.1|  tetraspanin family protein                              124   1e-30   Medicago truncatula
gb|KDO36654.1|  hypothetical protein CISIN_1g033543mg                   119   1e-30   Citrus sinensis [apfelsine]
ref|XP_010275310.1|  PREDICTED: tobamovirus multiplication protei...    124   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010677296.1|  PREDICTED: tobamovirus multiplication protei...    123   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004148498.1|  PREDICTED: uncharacterized protein LOC101203030    123   2e-30   Cucumis sativus [cucumbers]
gb|AFK40219.1|  unknown                                                 123   4e-30   Lotus japonicus
ref|XP_002279170.2|  PREDICTED: tobamovirus multiplication protei...    122   6e-30   Vitis vinifera
ref|XP_006385612.1|  GMFP4 family protein                               122   9e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010461064.1|  PREDICTED: tobamovirus multiplication protei...    121   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_011028243.1|  PREDICTED: tobamovirus multiplication protei...    121   2e-29   Populus euphratica
gb|EPS67767.1|  hypothetical protein M569_07007                         121   2e-29   Genlisea aurea
ref|XP_010919853.1|  PREDICTED: tobamovirus multiplication protei...    121   2e-29   Elaeis guineensis
ref|XP_006305496.1|  hypothetical protein CARUB_v10009959mg             120   2e-29   Capsella rubella
ref|XP_009151428.1|  PREDICTED: tobamovirus multiplication protei...    120   3e-29   Brassica rapa
ref|XP_010538377.1|  PREDICTED: tobamovirus multiplication protei...    120   3e-29   Tarenaya hassleriana [spider flower]
ref|XP_004300273.1|  PREDICTED: tobamovirus multiplication protei...    120   4e-29   Fragaria vesca subsp. vesca
emb|CDY48874.1|  BnaA05g35820D                                          121   4e-29   Brassica napus [oilseed rape]
emb|CDY32286.1|  BnaC05g28640D                                          121   4e-29   Brassica napus [oilseed rape]
ref|XP_010518876.1|  PREDICTED: tobamovirus multiplication protei...    120   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_007156641.1|  hypothetical protein PHAVU_002G005100g             120   6e-29   Phaseolus vulgaris [French bean]
ref|XP_010499788.1|  PREDICTED: tobamovirus multiplication protei...    119   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004511769.1|  PREDICTED: tetraspanin-20-like isoform X1          119   1e-28   Cicer arietinum [garbanzo]
ref|XP_003611447.1|  GMFP4                                              119   1e-28   Medicago truncatula
ref|NP_001240069.1|  uncharacterized protein LOC100793680               118   2e-28   Glycine max [soybeans]
ref|XP_008784675.1|  PREDICTED: tobamovirus multiplication protei...    117   3e-28   Phoenix dactylifera
ref|NP_564399.1|  tobamovirus multiplication 2A protein                 117   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478663.1|  PREDICTED: tobamovirus multiplication protei...    117   5e-28   Camelina sativa [gold-of-pleasure]
emb|CDX93836.1|  BnaA09g24360D                                          116   8e-28   
ref|XP_009114889.1|  PREDICTED: tobamovirus multiplication protei...    116   9e-28   Brassica rapa
ref|XP_007209447.1|  hypothetical protein PRUPE_ppa009704mg             116   9e-28   Prunus persica
ref|XP_008788690.1|  PREDICTED: tobamovirus multiplication protei...    115   2e-27   Phoenix dactylifera
ref|XP_010933519.1|  PREDICTED: tobamovirus multiplication protei...    115   3e-27   Elaeis guineensis
ref|XP_006305495.1|  hypothetical protein CARUB_v10009959mg             114   4e-27   
ref|XP_008238361.1|  PREDICTED: tobamovirus multiplication protei...    114   5e-27   Prunus mume [ume]
ref|XP_009397919.1|  PREDICTED: tobamovirus multiplication protei...    114   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY01278.1|  BnaC05g24540D                                          114   1e-26   
ref|XP_002893721.1|  hypothetical protein ARALYDRAFT_473428             113   2e-26   
ref|XP_003611445.1|  GMFP4                                              113   2e-26   
ref|XP_010934869.1|  PREDICTED: tobamovirus multiplication protei...    112   2e-26   
ref|XP_010934868.1|  PREDICTED: tobamovirus multiplication protei...    112   3e-26   Elaeis guineensis
ref|XP_009398578.1|  PREDICTED: tobamovirus multiplication protei...    112   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010104372.1|  hypothetical protein L484_023325                   112   3e-26   
ref|XP_004509001.1|  PREDICTED: tetraspanin-20-like isoform X1          111   1e-25   Cicer arietinum [garbanzo]
ref|XP_008352453.1|  PREDICTED: tobamovirus multiplication protei...    106   1e-24   
gb|AAF81337.1|AC007767_17  Contains similarity to GMFP4 from Glyc...    107   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391069.1|  PREDICTED: tobamovirus multiplication protei...    107   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009371175.1|  PREDICTED: tobamovirus multiplication protei...    106   7e-24   Pyrus x bretschneideri [bai li]
ref|XP_006659267.1|  PREDICTED: tobamovirus multiplication protei...    103   7e-23   Oryza brachyantha
gb|EEC83268.1|  hypothetical protein OsI_28600                          100   2e-22   Oryza sativa Indica Group [Indian rice]
gb|EEE68396.1|  hypothetical protein OsJ_26735                          100   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061444.1|  Os08g0282000                                     98.6    4e-21   
ref|XP_004983591.1|  PREDICTED: tetraspanin-18-like isoform X1        96.7    2e-20   
ref|NP_001150827.1|  tetraspanin family protein                       95.1    6e-20   Zea mays [maize]
gb|ACG40574.1|  tetraspanin family protein                            95.1    6e-20   Zea mays [maize]
ref|XP_009385932.1|  PREDICTED: tobamovirus multiplication protei...  94.4    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK22053.1|  unknown                                               93.2    3e-19   Picea sitchensis
ref|XP_003611446.1|  GMFP4                                            91.7    5e-19   
gb|AFK47448.1|  unknown                                               91.7    6e-19   Medicago truncatula
ref|XP_006850026.1|  hypothetical protein AMTR_s00022p00189290        92.0    7e-19   
gb|KJB51696.1|  hypothetical protein B456_008G228700                  90.1    2e-18   Gossypium raimondii
gb|EYU17843.1|  hypothetical protein MIMGU_mgv1a0124672mg             89.7    3e-18   Erythranthe guttata [common monkey flower]
gb|EMS54049.1|  hypothetical protein TRIUR3_29725                     89.4    8e-18   Triticum urartu
emb|CDP12960.1|  unnamed protein product                              88.2    1e-17   Coffea canephora [robusta coffee]
ref|XP_003573849.1|  PREDICTED: tobamovirus multiplication protei...  88.6    1e-17   Brachypodium distachyon [annual false brome]
gb|KCW71821.1|  hypothetical protein EUGRSUZ_E00307                   85.9    9e-17   Eucalyptus grandis [rose gum]
gb|AFW87795.1|  hypothetical protein ZEAMMB73_665682                  84.3    1e-16   
dbj|BAK04010.1|  predicted protein                                    85.5    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006847670.1|  hypothetical protein AMTR_s00149p00039360        84.0    5e-16   Amborella trichopoda
ref|NP_001146619.1|  hypothetical protein                             83.6    7e-16   Zea mays [maize]
emb|CBI33948.3|  unnamed protein product                              81.6    2e-15   Vitis vinifera
ref|XP_006436787.1|  hypothetical protein CICLE_v10033213mg           78.2    4e-15   
dbj|BAJ85018.1|  predicted protein                                    79.3    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW77892.1|  hypothetical protein EUGRSUZ_D021562                  68.9    6e-12   Eucalyptus grandis [rose gum]
gb|KHN21027.1|  hypothetical protein glysoja_034149                   68.9    5e-11   Glycine soja [wild soybean]
gb|KHG29161.1|  Stk31                                                 68.2    1e-10   Gossypium arboreum [tree cotton]
ref|XP_002443902.1|  hypothetical protein SORBIDRAFT_07g004040        67.8    2e-10   Sorghum bicolor [broomcorn]
ref|XP_003573463.1|  PREDICTED: tobamovirus multiplication protei...  67.8    2e-10   Brachypodium distachyon [annual false brome]
gb|AFW61168.1|  hypothetical protein ZEAMMB73_111506                  65.5    3e-10   
ref|NP_001146674.1|  uncharacterized protein LOC100280274             64.7    4e-10   
gb|ACN35034.1|  unknown                                               66.6    5e-10   Zea mays [maize]
gb|KDP43415.1|  hypothetical protein JCGZ_16702                       65.5    8e-10   Jatropha curcas
gb|KHN01670.1|  hypothetical protein glysoja_012981                   62.8    9e-09   Glycine soja [wild soybean]
ref|XP_004972786.1|  PREDICTED: tetraspanin-20-like isoform X2        62.8    1e-08   Setaria italica
ref|XP_008788693.1|  PREDICTED: tobamovirus multiplication protei...  61.2    2e-08   
ref|XP_004972785.1|  PREDICTED: tetraspanin-20-like isoform X1        62.8    2e-08   
gb|KCW77895.1|  hypothetical protein EUGRSUZ_D021561                  59.3    1e-07   Eucalyptus grandis [rose gum]
ref|NP_001061041.1|  Os08g0159100                                     56.6    2e-06   
gb|EEC82932.1|  hypothetical protein OsI_27894                        56.6    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010672322.1|  PREDICTED: tobamovirus multiplication protei...  54.3    7e-06   
gb|KCW77897.1|  hypothetical protein EUGRSUZ_D021561                  53.1    1e-05   Eucalyptus grandis [rose gum]
ref|XP_006659854.1|  PREDICTED: tobamovirus multiplication protei...  53.5    2e-05   
gb|ACG25649.1|  hypothetical protein                                  50.8    2e-05   Zea mays [maize]
ref|XP_011083093.1|  PREDICTED: tetraspanin-18                        53.5    3e-05   Sesamum indicum [beniseed]



>ref|XP_009788106.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
 ref|XP_009788107.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
Length=283

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  P SS E+++ 
Sbjct  1    MACKGFWECLLKLLNFLLTLVGLAMVGYGIYLFVEYKNHSSSGDDYPVA-PTSSAEVIEF  59

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSLA+NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCCLSCYSVL+
Sbjct  60   GRPMLIAVSLADNIFDKLPKAWFIYLFIGIGAVLVVVSCCGCIGAATRNGCCLSCYSVLL  119

Query  565  illilvelGAAAFIFFDE  618
             LLILVELGAA FIFFD+
Sbjct  120  FLLILVELGAAGFIFFDK  137



>ref|XP_009590611.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
 ref|XP_009590612.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
Length=283

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  P SS E+++L
Sbjct  1    MACKGFWECLLKLLNFLLTLVGLAMVGYGIYLFVEYKNHSSSGDDYPVA-PTSSAEVIEL  59

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVS+A NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCCLSCYSVL+
Sbjct  60   GRPMLMAVSVAENIFDKLPKAWFIYLFIGIGAVLVVVSCCGCIGAATRNGCCLSCYSVLL  119

Query  565  illilvelGAAAFIFFDE  618
             LLILVELGAA FIFFD+
Sbjct  120  FLLILVELGAAGFIFFDK  137



>ref|XP_004245872.1| PREDICTED: tobamovirus multiplication protein 2A [Solanum lycopersicum]
Length=284

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  PP SG++++ 
Sbjct  1    MACKGFWECLLKLLNFLLTLVGLTMVGYGIYLFVEYKNHSHSGDDYPVA-PPMSGDMIEF  59

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSLA NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCCLSCYS+L+
Sbjct  60   GRPMLMAVSLAENIFDKLPKPWFIYLFIGIGAVLVVVSCCGCIGAATRNGCCLSCYSMLI  119

Query  565  illilvelGAAAFIFFDE  618
             LLILVELGAA FIFFD+
Sbjct  120  FLLILVELGAAGFIFFDK  137



>ref|XP_006358577.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358578.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Solanum tuberosum]
Length=284

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  PP SG++++ 
Sbjct  1    MACKGFWECLLKLLNFLLTLVGLTMVGYGIYLFVEYKNHSHSGDDYPVA-PPMSGDMIEF  59

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSLA NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCCLSCYSVL+
Sbjct  60   GRPMLMAVSLAGNIFDKLPKPWFIYLFIGIGAVLVVVSCCGCIGAATRNGCCLSCYSVLI  119

Query  565  illilvelGAAAFIFFDE  618
             LLILVELGAA FIFFD+
Sbjct  120  FLLILVELGAAGFIFFDK  137



>gb|AIX10945.1| putative tetraspanin family protein [Gardenia jasminoides]
Length=286

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  453
              VGYGIYLFVEYK  + SGDD  +P P S+ EL+QLGRPML+AVSL +N FD LPK WF
Sbjct  27   ATVGYGIYLFVEYKKSASSGDDSGVPVP-STEELIQLGRPMLMAVSLGDNFFDKLPKAWF  85

Query  454  LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            +YLFIG+GV+LF+ISCFGCIGA+TRNGCCLSCY+VLVILLILVELG AAFIFFD+
Sbjct  86   IYLFIGVGVVLFIISCFGCIGAATRNGCCLSCYAVLVILLILVELGVAAFIFFDK  140



>gb|EYU17845.1| hypothetical protein MIMGU_mgv1a0219312mg, partial [Erythranthe 
guttata]
Length=207

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKG  ECLLKLLNFLL L GLGM+GYG+YLFVEYKN S   D      PPS+   VQL
Sbjct  1    MACKGFWECLLKLLNFLLVLVGLGMIGYGVYLFVEYKNISSDDDGGDSALPPSTDAFVQL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSLA+NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCCL+CYSVLV
Sbjct  61   GRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCCLTCYSVLV  120

Query  565  illilvelGAAAFIFFDE  618
            ILLIL ELG AAFIFFDE
Sbjct  121  ILLILAELGFAAFIFFDE  138



>gb|EYU33040.1| hypothetical protein MIMGU_mgv1a011318mg [Erythranthe guttata]
Length=285

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKG  ECLLKLLNFLL L GLGM+GYG+YLFVEYKN S   D      PPS+ + VQL
Sbjct  1    MACKGFWECLLKLLNFLLVLVGLGMIGYGVYLFVEYKNISSDDDGGDSALPPSTDDFVQL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSLANNIFD LPK WF+YLFIG+G ++  ++C GCIG +TRNGCCL+CYSVLV
Sbjct  61   GRPMLLAVSLANNIFDKLPKAWFIYLFIGLGGIVLFVACCGCIGTATRNGCCLTCYSVLV  120

Query  565  illilvelGAAAFIFFDE  618
            ILLIL ELG AAFIFFDE
Sbjct  121  ILLILAELGFAAFIFFDE  138



>gb|KJB37690.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
 gb|KJB37691.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
Length=277

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 4/138 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKGCLECLLKLLNFL+TL GL MVGYGIYLFVEYK  +    D  +   P   + +QL
Sbjct  1    MACKGCLECLLKLLNFLMTLVGLAMVGYGIYLFVEYKRAA----DVAMLLSPVGTDQIQL  56

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSL+++IFDNLPK WF+YLFIG+GV+LFVISCFGCIGASTRN CCLSCYS+LV
Sbjct  57   GRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLFVISCFGCIGASTRNLCCLSCYSLLV  116

Query  565  illilvelGAAAFIFFDE  618
            +LLILVELG AAFIFFD+
Sbjct  117  VLLILVELGCAAFIFFDK  134



>gb|KHG08208.1| Tetraspanin-33 [Gossypium arboreum]
Length=280

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 6/140 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  378
            MAC+GCLECLLKLLNFL+TLAGL MVGYGIYLFVEYKN +    D  +   P  S  +L+
Sbjct  1    MACRGCLECLLKLLNFLMTLAGLAMVGYGIYLFVEYKNAA----DTAMLLSPVGSDRDLI  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            Q GRPML+AVSL+++IFDNLPK WFLYLFIG+G +LFVISCFGCIGA+TRN CCL+CYSV
Sbjct  57   QFGRPMLMAVSLSSSIFDNLPKAWFLYLFIGVGAVLFVISCFGCIGAATRNICCLTCYSV  116

Query  559  lvillilvelGAAAFIFFDE  618
            LVILLILVELG AAFIFFD+
Sbjct  117  LVILLILVELGCAAFIFFDK  136



>gb|KHG01123.1| hypothetical protein F383_00667 [Gossypium arboreum]
Length=278

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 4/138 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKGCLECLLKLLNFL+TL GL MVGYGIYLFVEYK  +    D  +   P   + +QL
Sbjct  1    MACKGCLECLLKLLNFLMTLVGLAMVGYGIYLFVEYKRAA----DVAMLLSPVGTDQIQL  56

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSL+++IFDNLPK WF+YLFIG+GV+LF ISCFGCIGASTRN CCLSCYS+LV
Sbjct  57   GRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLFFISCFGCIGASTRNLCCLSCYSLLV  116

Query  565  illilvelGAAAFIFFDE  618
            +LLILVELG AAFIFFD+
Sbjct  117  VLLILVELGCAAFIFFDK  134



>ref|XP_006485406.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Citrus sinensis]
 ref|XP_006485407.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Citrus sinensis]
Length=279

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 118/140 (84%), Gaps = 7/140 (5%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLLT+ GL MVGYGIYLFVEYK    SG   P+     SG+   V
Sbjct  1    MACRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPV-----SGDEGFV  55

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            QLGRPML+AVSLA++IFD LPK WF+YLFIG+GV+LFVISC GCIGA+TRNGCCL+CYSV
Sbjct  56   QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCIGATTRNGCCLTCYSV  115

Query  559  lvillilvelGAAAFIFFDE  618
            LVILLILVELG AAF +FD+
Sbjct  116  LVILLILVELGCAAFFYFDK  135



>gb|KDO40489.1| hypothetical protein CISIN_1g038963mg [Citrus sinensis]
Length=117

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 92/112 (82%), Gaps = 7/112 (6%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLLT+ GL MVGYGIYLFVEYK    SG   P+     SG+   V
Sbjct  1    MACRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPV-----SGDEGFV  55

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNG  534
            QLGRPML+AVSLA++IFD LPK WF+YLFIG+GV+LFVISC GCIGA+TRNG
Sbjct  56   QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCIGATTRNG  107



>ref|XP_003517379.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
Length=283

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 117/140 (84%), Gaps = 4/140 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+   S   DD+     P S +  L+
Sbjct  1    MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEFSKAS--DDDNTPAISPVSDDSALI  58

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            QLGRP+L+AVSL+N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCCLSCYS+
Sbjct  59   QLGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCCLSCYSI  118

Query  559  lvillilvelGAAAFIFFDE  618
            LV LLILVELG AAFIFFD+
Sbjct  119  LVALLILVELGCAAFIFFDK  138



>gb|KJB51694.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
 gb|KJB51695.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=280

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 16/145 (11%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNH-------SPSGDDHPIPFPPS  363
            MAC+GCLECLLKLLNFL+T+AGL MVGYGIYLFV+YK+        SP G D        
Sbjct  1    MACRGCLECLLKLLNFLMTVAGLAMVGYGIYLFVKYKDAADTVMLLSPVGSDQ-------  53

Query  364  SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  543
              +L+QLGRPML+AVSL+++IFDNLPK WFLYLFIG+GV+LF+ISCFGCIG +TRN CCL
Sbjct  54   --DLIQLGRPMLMAVSLSSSIFDNLPKAWFLYLFIGVGVVLFIISCFGCIGTATRNLCCL  111

Query  544  scysvlvillilvelGAAAFIFFDE  618
            +CYS+LVILLILVELG AAFIFFD+
Sbjct  112  TCYSLLVILLILVELGCAAFIFFDK  136



>gb|ACU24289.1| unknown [Glycine max]
Length=283

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 117/140 (84%), Gaps = 4/140 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+   S   DD+     P S +  L+
Sbjct  1    MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEFSKAS--DDDNTPAISPVSDDSALI  58

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            QLGRP+L+AVSL+N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCCLSCYS+
Sbjct  59   QLGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCCLSCYSI  118

Query  559  lvillilvelGAAAFIFFDE  618
            LV LLILVELG AAFIFFD+
Sbjct  119  LVALLILVELGCAAFIFFDK  138



>gb|KHN42626.1| hypothetical protein glysoja_018869 [Glycine soja]
Length=283

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 116/140 (83%), Gaps = 4/140 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+     S DD+     P S +  L+
Sbjct  1    MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEF--SKASDDDNTPAISPVSDDSALI  58

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            QLGRP+L+AVSL+NN FDNLP+ WF+YLFIGIGV+LF+ SCFGCIGA+TRNGCCLSCYS+
Sbjct  59   QLGRPVLMAVSLSNNFFDNLPRAWFIYLFIGIGVVLFLFSCFGCIGAATRNGCCLSCYSI  118

Query  559  lvillilvelGAAAFIFFDE  618
            LV LLILVELG AAFIFFD+
Sbjct  119  LVALLILVELGCAAFIFFDK  138



>ref|XP_011018623.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018624.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018625.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
Length=280

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 4/139 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  381
            MACKGCLECLLKLLNFLLTL GL M+GYGIYLFVEYK    + D+  +   PS G+ L  
Sbjct  1    MACKGCLECLLKLLNFLLTLVGLAMIGYGIYLFVEYKR---ADDNVGLVSTPSDGQGLTL  57

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+AVSL+ +IFD LPK WF+YLFI +GV+LFVISCFGC+GA+TRNGCCL+CYSVL
Sbjct  58   LGRPMLIAVSLSESIFDKLPKAWFIYLFIAVGVILFVISCFGCVGAATRNGCCLTCYSVL  117

Query  562  villilvelGAAAFIFFDE  618
            +ILLILVELG AAFIFFD+
Sbjct  118  IILLILVELGCAAFIFFDK  136



>ref|XP_008465936.1| PREDICTED: tobamovirus multiplication protein 2A [Cucumis melo]
Length=279

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 114/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GC ECLLKLLNF L+L GL MVGYGIYL VEY     S  D P P      +LVQL
Sbjct  1    MACRGCFECLLKLLNFFLSLLGLAMVGYGIYLLVEYLQ---SSSDVPGPSLSGDHDLVQL  57

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSL++NIFDNLPK WF+YLFI  GV++FV+SCFGCIGA+TR+GCCLSCYS+L+
Sbjct  58   GRPMLMAVSLSSNIFDNLPKAWFIYLFIATGVIVFVVSCFGCIGAATRSGCCLSCYSILL  117

Query  565  illilvelGAAAFIFFDE  618
            +LLILV+LG AAFIFFD+
Sbjct  118  LLLILVQLGCAAFIFFDK  135



>ref|XP_008375915.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=248

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 115/145 (79%), Gaps = 16/145 (11%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  363
            MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GD H       
Sbjct  1    MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRAADTTVMSSPVGDVH-------  53

Query  364  SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  543
              +LVQL RPML+ VSL++NI DNLPK WF+YLFIGIG ++FVISCFGC+GA TRNGCCL
Sbjct  54   --DLVQLSRPMLMTVSLSDNILDNLPKAWFIYLFIGIGAIIFVISCFGCVGAMTRNGCCL  111

Query  544  scysvlvillilvelGAAAFIFFDE  618
            SCYSVLVILLILVELGAAAFIFFD+
Sbjct  112  SCYSVLVILLILVELGAAAFIFFDK  136



>ref|XP_007039575.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039576.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039577.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24076.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24077.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24078.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
Length=280

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 117/140 (84%), Gaps = 6/140 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  378
            MAC+GCL CLLKLLN L+TL GL MVGYGIYLFVEY+  S    D  +   P  S  +L+
Sbjct  1    MACRGCLGCLLKLLNLLMTLVGLAMVGYGIYLFVEYEKAS----DTAMLLSPAGSDQDLI  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            QLGRPML+AVSL+++IFDNLPK WF+YLFIG+GV+L +ISCFGCIGA+TRN CCL+CYSV
Sbjct  57   QLGRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLVIISCFGCIGAATRNLCCLTCYSV  116

Query  559  lvillilvelGAAAFIFFDE  618
            LVILLILVELG AAFIFFD+
Sbjct  117  LVILLILVELGCAAFIFFDK  136



>gb|EYU33039.1| hypothetical protein MIMGU_mgv1a011319mg [Erythranthe guttata]
Length=285

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKG  ECLLKLLNFLL L GL M+GYG+YLFVEYKN S   D      PPS+   VQL
Sbjct  1    MACKGFWECLLKLLNFLLVLVGLCMIGYGVYLFVEYKNISSDDDGGDAALPPSTDAFVQL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSLA+NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCCL+CYS+LV
Sbjct  61   GRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCCLTCYSLLV  120

Query  565  illilvelGAAAFIFFDE  618
            ILLIL ELG AAFIFFD+
Sbjct  121  ILLILAELGFAAFIFFDD  138



>gb|KJB25374.1| hypothetical protein B456_004G188200 [Gossypium raimondii]
Length=280

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 6/140 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  378
            MAC+GCLECLLKLLNFL+TLAGL MVGYGIYLFVEYKN +    D  +   P  S  +L+
Sbjct  1    MACRGCLECLLKLLNFLMTLAGLAMVGYGIYLFVEYKNAA----DTAMLLSPVGSDQDLI  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            Q  RPML+AVSL+++IFDNLPK WF+YLFIG+G +LFVISCFGCIGA+TRN CCL+CYSV
Sbjct  57   QFRRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGAVLFVISCFGCIGAATRNLCCLTCYSV  116

Query  559  lvillilvelGAAAFIFFDE  618
            LVILLILVELG AAFIFFD+
Sbjct  117  LVILLILVELGCAAFIFFDK  136



>ref|XP_009345636.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009345644.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=282

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 115/145 (79%), Gaps = 16/145 (11%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  363
            MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GD H       
Sbjct  1    MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRAADTTVMSSPVGDVH-------  53

Query  364  SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  543
              +LVQL RPML+ VSL++NI DNLPK WF+YLFIGIG ++FVISCFGC+GA TRNGCCL
Sbjct  54   --DLVQLSRPMLMTVSLSDNILDNLPKAWFIYLFIGIGAIIFVISCFGCVGAMTRNGCCL  111

Query  544  scysvlvillilvelGAAAFIFFDE  618
            SCYSVLVILLILVELGAAAFIFFD+
Sbjct  112  SCYSVLVILLILVELGAAAFIFFDK  136



>ref|XP_003539155.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
 gb|KHN34864.1| hypothetical protein glysoja_004630 [Glycine soja]
Length=283

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-GELVQ  381
            MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+   S   D+ P   P S    L+Q
Sbjct  1    MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEFSKAS-DDDNMPAISPVSDDSSLIQ  59

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRP+L+AVSL+N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+ RNGCCLSCYS+L
Sbjct  60   LGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAAARNGCCLSCYSIL  119

Query  562  villilvelGAAAFIFFDE  618
            V LLILVELG AAFIFFD+
Sbjct  120  VALLILVELGCAAFIFFDK  138



>ref|XP_007156638.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 ref|XP_007156639.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28632.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28633.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
Length=283

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 3/139 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  381
            MAC+GC ECLLKLLNF+L++ GL +VGYGIYLFVE+   S   DD P   P S    L+Q
Sbjct  1    MACRGCWECLLKLLNFILSITGLAIVGYGIYLFVEFSKVS--DDDTPDISPVSDDYALIQ  58

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+AVSL+++ FDNLP+ WF++LFIG+GV+LF+ISCFGCIGA+TRNGCCLS YS+L
Sbjct  59   LGRPMLMAVSLSDSFFDNLPRAWFIFLFIGVGVVLFLISCFGCIGAATRNGCCLSFYSIL  118

Query  562  villilvelGAAAFIFFDE  618
            V LLIL+ELG AAFIFFD+
Sbjct  119  VALLILIELGCAAFIFFDK  137



>gb|KCW71823.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=251

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1    MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML AVSL+++IFD+LPK WF+YLF+G+GV+LFVISCFGCIGASTRNGCCLSCYSVLV
Sbjct  59   GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILFVISCFGCIGASTRNGCCLSCYSVLV  118

Query  565  illilvelGAAAFIFFDE  618
            I+LILVELG AAFI+FD+
Sbjct  119  IILILVELGCAAFIYFDK  136



>ref|XP_006368443.1| GMFP4 family protein [Populus trichocarpa]
 gb|ERP65012.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 4/139 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  381
            MACKGCLECLLKLLNFLLTL GL M+GYGIYLFVEY+    + D+  +   PS G+ L  
Sbjct  1    MACKGCLECLLKLLNFLLTLVGLAMIGYGIYLFVEYRR---ADDNVGLVSTPSDGQGLTL  57

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+AVSL+ +I D LPK WF+YLFI +GV+LFVISCFGCIGA+TRNGCCL+CYSVL
Sbjct  58   LGRPMLIAVSLSESILDKLPKAWFIYLFIAVGVILFVISCFGCIGAATRNGCCLTCYSVL  117

Query  562  villilvelGAAAFIFFDE  618
            +ILLILVELG AAFIFFD+
Sbjct  118  IILLILVELGCAAFIFFDK  136



>gb|KDP36200.1| hypothetical protein JCGZ_10291 [Jatropha curcas]
Length=279

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLEC+LKLLNFLLTL GL MVGYGIYLFVEYK  +      P+       +L+QL
Sbjct  1    MACRGCLECILKLLNFLLTLVGLAMVGYGIYLFVEYKRAADGESLAPVS---GGSDLIQL  57

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVS + +IFD LPK WF+YLFIG+GV+LFVISCFGCIG+ TRN CCLSCYSVLV
Sbjct  58   GRPMLMAVSFSESIFDKLPKAWFIYLFIGVGVILFVISCFGCIGSVTRNACCLSCYSVLV  117

Query  565  illilvelGAAAFIFFDE  618
            ILLILVELG AAFIFFD+
Sbjct  118  ILLILVELGCAAFIFFDK  135



>ref|XP_007156640.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
 gb|ESW28634.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
Length=282

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 3/139 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  381
            MAC+GC ECLLKLLNF+L L GL +VGYGIYL VE+     S DD P   P S    L+Q
Sbjct  1    MACRGCWECLLKLLNFILNLTGLAIVGYGIYLLVEF--SKASDDDTPDISPVSDDSALIQ  58

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRP+L+AVSL+N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCCLSCYS L
Sbjct  59   LGRPILMAVSLSNSFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCCLSCYSTL  118

Query  562  villilvelGAAAFIFFDE  618
            V+LLIL+ELG A FIFFD+
Sbjct  119  VVLLILIELGCAGFIFFDK  137



>ref|XP_003524459.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Glycine 
max]
 ref|XP_006579675.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Glycine 
max]
 ref|XP_006579676.1| PREDICTED: tobamovirus multiplication protein 2A isoform X3 [Glycine 
max]
Length=277

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 114/143 (80%), Gaps = 15/143 (10%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-----GDDHPIPFPPSSG  369
            MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY N +P      GDD          
Sbjct  1    MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEY-NKTPDNTLTVGDDQ---------  50

Query  370  ELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclsc  549
             LVQLGRPMLVAVSL+N+  D+LPK WF+YLFIGIG +LFVISCFGCI A TRNGCCLS 
Sbjct  51   TLVQLGRPMLVAVSLSNSFLDDLPKAWFIYLFIGIGAVLFVISCFGCIAALTRNGCCLSF  110

Query  550  ysvlvillilvelGAAAFIFFDE  618
            YSVLV+LLILVELG AAFIFFD+
Sbjct  111  YSVLVLLLILVELGCAAFIFFDK  133



>ref|XP_006415200.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
 dbj|BAJ34310.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33553.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
Length=280

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F P +G+   V
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRAT----DNSVTFNPVNGDQSYV  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
             LGRPML+AV+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57   SLGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  116

Query  559  lvillilvelGAAAFIFFD  615
            L+ILLIL ELGAAAFIFFD
Sbjct  117  LLILLILAELGAAAFIFFD  135



>ref|XP_011070225.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
 ref|XP_011070226.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
Length=281

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  ECLLKLLNFLL L GL M+GYG+YLFV YKN + + DD  +P  P+S + VQL
Sbjct  1    MACRGFWECLLKLLNFLLILVGLAMIGYGVYLFVGYKNAASTDDD--VPISPTSEQFVQL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+ VSLA+NIFD LPK WF+YLF GIG ++  I+C GCIG +TRNGCCL+CYSVLV
Sbjct  59   GRPMLLGVSLADNIFDKLPKAWFIYLFTGIGAVILFIACCGCIGTATRNGCCLTCYSVLV  118

Query  565  illilvelGAAAFIFFDE  618
            ILLILVELG AAFIFFD+
Sbjct  119  ILLILVELGLAAFIFFDK  136



>ref|XP_010269960.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269962.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269963.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269964.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
Length=280

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  381
            M+C+GC ECLLKLLNFLLTL GL MVGYGIYL VE+K  S   DD   P P S   E ++
Sbjct  1    MSCRGCFECLLKLLNFLLTLVGLAMVGYGIYLLVEWKRAS---DDTNSPSPLSDNHEFIE  57

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+ VSL++NI D LPK WF+YLFI IGV++FVISCFGCIGA TRNGCCL+CYSVL
Sbjct  58   LGRPMLLVVSLSSNILDKLPKAWFIYLFIAIGVVIFVISCFGCIGAVTRNGCCLTCYSVL  117

Query  562  villilvelGAAAFIFFD  615
            +ILLILVELG AAFIFFD
Sbjct  118  LILLILVELGCAAFIFFD  135



>ref|XP_010055355.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 gb|KCW71822.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=279

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1    MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML AVSL+++IFD+LPK WF+YLF+G+GV+LFVISCFGCIGASTRNGCCLSCYSVLV
Sbjct  59   GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILFVISCFGCIGASTRNGCCLSCYSVLV  118

Query  565  illilvelGAAAFIFFDE  618
            I+LILVELG AAFI+FD+
Sbjct  119  IILILVELGCAAFIYFDK  136



>ref|XP_002527636.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34707.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLEC+LKLLN LLTL GL MVGYGIYLFVEY   +  G D  +    +   L+QL
Sbjct  1    MACRGCLECILKLLNLLLTLVGLAMVGYGIYLFVEYTRAA--GGDTLLAPATNDSSLIQL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSL++++ D LPK WF+YLFIG+G++LFVISCFGCIG+ TRNGCCLSCYSVLV
Sbjct  59   GRPMLMAVSLSDSLVDKLPKAWFIYLFIGVGLILFVISCFGCIGSVTRNGCCLSCYSVLV  118

Query  565  illilvelGAAAFIFFDE  618
            ILLIL+ELG AAFIFFD+
Sbjct  119  ILLILIELGCAAFIFFDK  136



>ref|XP_010053569.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053570.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053571.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
Length=284

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLEC+LKLLNFLLTL GL MVGYGIYLFVEYK  S SG     P     G  VQL
Sbjct  1    MACRGCLECVLKLLNFLLTLVGLAMVGYGIYLFVEYK-RSSSGTVGYSPIGADEGS-VQL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRP+LV VSL+ +IFDNLPK WF++LFIG+GV+LF+ISCFGCIG+ TRNGCCL+CYSVLV
Sbjct  59   GRPLLVTVSLSASIFDNLPKAWFIFLFIGVGVVLFIISCFGCIGSVTRNGCCLTCYSVLV  118

Query  565  illilvelGAAAFIFFDE  618
            ILLILVELG AAFI+FD+
Sbjct  119  ILLILVELGCAAFIYFDK  136



>gb|KEH31557.1| tetraspanin family protein [Medicago truncatula]
Length=280

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GC ECLLKLLNF+LT+ GL MVGYGIYL VE+   S   +   +  P     LVQL
Sbjct  1    MACRGCWECLLKLLNFILTITGLAMVGYGIYLLVEFSRAS--DNSMMLSAPSDDQTLVQL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+A+ L++NIFDNLPK WF+YLFIG+G +LFVISCFGCI + TRNGCCLSCYS+LV
Sbjct  59   GRPMLMALPLSDNIFDNLPKAWFIYLFIGVGAVLFVISCFGCIASMTRNGCCLSCYSILV  118

Query  565  illilvelGAAAFIFFDE  618
            +LLILVELG AAFIFFD+
Sbjct  119  VLLILVELGCAAFIFFDK  136



>gb|KDO36654.1| hypothetical protein CISIN_1g033543mg [Citrus sinensis]
 gb|KDO36655.1| hypothetical protein CISIN_1g033543mg [Citrus sinensis]
Length=117

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 91/112 (81%), Gaps = 7/112 (6%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLLTLAGL MVGYGIYLFVEYK     G   P+     SG+   V
Sbjct  1    MACRGCLECLLKLLNFLLTLAGLAMVGYGIYLFVEYKRVDNLGTVSPV-----SGDEGFV  55

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNG  534
            QLGRPML+AVSLA++IFD LPK WF+YLFIG+GV+LFVISC GCI A+TRNG
Sbjct  56   QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCISATTRNG  107



>ref|XP_010275310.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275311.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275312.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275313.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
Length=280

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDD-HPIPFPPSSGELVQ  381
            MAC+GCLECLLKLLNFLLTL GL MVGYGIYL VE+K  S   D   P+     + E VQ
Sbjct  1    MACRGCLECLLKLLNFLLTLVGLAMVGYGIYLLVEWKKTSADTDSLSPLS---DNHEFVQ  57

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+ VSL++NIFD LPK WF+YLFI +GV+LF+ISC GCIGA TRNGCCL+CYS+L
Sbjct  58   LGRPMLLVVSLSSNIFDKLPKAWFIYLFIAVGVILFIISCCGCIGAVTRNGCCLTCYSIL  117

Query  562  villilvelGAAAFIFFD  615
            VILLILVELG AAFIFFD
Sbjct  118  VILLILVELGCAAFIFFD  135



>ref|XP_010677296.1| PREDICTED: tobamovirus multiplication protein 2A [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 7/117 (6%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LVQLGRPMLVAVSLANNIFDNLPKE  447
             MVGYGIYLFV YK  SP         PP S E  ++QLGRP++++VSL+N++FDNLPK 
Sbjct  24   AMVGYGIYLFVMYKQASPDTG-----LPPISPEETMIQLGRPLIMSVSLSNSVFDNLPKA  78

Query  448  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            WF+Y+FIGIG +LFVISCFGCIGAST+NGCCLS Y+V +ILLIL+ELG AAF+FFD+
Sbjct  79   WFIYMFIGIGAVLFVISCFGCIGASTKNGCCLSTYAVFIILLILLELGCAAFVFFDK  135



>ref|XP_004148498.1| PREDICTED: uncharacterized protein LOC101203030 [Cucumis sativus]
 ref|XP_004170668.1| PREDICTED: uncharacterized protein LOC101226567 [Cucumis sativus]
 gb|KGN60424.1| hypothetical protein Csa_3G904130 [Cucumis sativus]
Length=279

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 5/139 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  381
            MAC+GC ECLLKLLNF L+L GL MVGYGIYL VEY ++HS    D P P      +LVQ
Sbjct  1    MACRGCFECLLKLLNFFLSLLGLAMVGYGIYLLVEYLQSHS----DVPGPSLSGDHDLVQ  56

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+AVSL+++IFDNLPK WF+YLFI  GV +FV+SCFGCIGA+TR+GCCLSCYS+L
Sbjct  57   LGRPMLMAVSLSSSIFDNLPKAWFIYLFIATGVTIFVVSCFGCIGAATRSGCCLSCYSIL  116

Query  562  villilvelGAAAFIFFDE  618
            ++LLILV+LG  AFIFFD+
Sbjct  117  LLLLILVQLGCGAFIFFDK  135



>gb|AFK40219.1| unknown [Lotus japonicus]
Length=282

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 114/139 (82%), Gaps = 6/139 (4%)
 Frame = +1

Query  208  ACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LVQ  381
            AC+GC ECLLKLLNFLLTL GL MVGYGIYL VE+   S    D+ +     S +  LVQ
Sbjct  4    ACRGCWECLLKLLNFLLTLVGLAMVGYGIYLLVEFSKAS----DNTLSVSTVSDDQTLVQ  59

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+AVSL+N+ FD+LPK WF+YLFIGIGV+LFVISCFGCIGA TR+GCCLSC++VL
Sbjct  60   LGRPMLMAVSLSNSFFDDLPKAWFIYLFIGIGVVLFVISCFGCIGAMTRSGCCLSCFAVL  119

Query  562  villilvelGAAAFIFFDE  618
            V+LLIL ELG AAFIFFD+
Sbjct  120  VVLLILAELGCAAFIFFDK  138



>ref|XP_002279170.2| PREDICTED: tobamovirus multiplication protein 2A [Vitis vinifera]
Length=280

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLECLLK+LNFLLTL GL MVGYGIYLFVEYK  S  G+   I       +++QL
Sbjct  1    MACRGCLECLLKILNFLLTLVGLAMVGYGIYLFVEYKKSS--GETLTISPVMGDSDVIQL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRP+++AV+L+++I DNLPK WF+Y F  IGV+LFVISCFGC+GA TRNGCCLSCY+VLV
Sbjct  59   GRPVMMAVTLSSSILDNLPKAWFIYCFFAIGVILFVISCFGCVGAVTRNGCCLSCYAVLV  118

Query  565  illilvelGAAAFIFFDE  618
            ILLIL+ELG AAFIFFD+
Sbjct  119  ILLILIELGCAAFIFFDK  136



>ref|XP_006385612.1| GMFP4 family protein [Populus trichocarpa]
 gb|ABK92751.1| unknown [Populus trichocarpa]
 gb|ERP63409.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  381
            MACKGCLECLLKLLNFLLTL GL MVG+GIYLFVEY     + D+  +    S G+ L Q
Sbjct  1    MACKGCLECLLKLLNFLLTLVGLAMVGFGIYLFVEYTR---ADDNVALVSTLSDGQGLTQ  57

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+ +SL++NI D LPK WF+YLF+ +GV+LF+ISCFGCIGA+TRNGCCL+CYSVL
Sbjct  58   LGRPMLMTMSLSDNILDKLPKAWFIYLFVAVGVILFIISCFGCIGAATRNGCCLTCYSVL  117

Query  562  villilvelGAAAFIFFDE  618
            ++LLILVELG AAFIFFD+
Sbjct  118  IVLLILVELGCAAFIFFDK  136



>ref|XP_010461064.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=280

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  378
            MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F P  S    V
Sbjct  1    MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDPVNSDQSYV  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
              GRP+L+AV+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57   SFGRPLLMAVTLSSNVFDNLPKAWFIYLFIGIGVTLFVISCCGCVGTCSRSVCCLSCYSL  116

Query  559  lvillilvelGAAAFIFFD  615
            L+ILLILVELGAAAFIFFD
Sbjct  117  LLILLILVELGAAAFIFFD  135



>ref|XP_011028243.1| PREDICTED: tobamovirus multiplication protein 2A-like [Populus 
euphratica]
Length=280

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 4/139 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  381
            MACKGCLECLLKLLNFLLTL GL M+G+GIYLFVEY   + + D+  +    + G+ L Q
Sbjct  1    MACKGCLECLLKLLNFLLTLVGLAMIGFGIYLFVEY---TRADDNVALVSTLNDGQGLTQ  57

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+ VSL++NI D LPK WF+YLF+ +GV+LF+ISCFGCIGA+TRNGCCL+CYSVL
Sbjct  58   LGRPMLMTVSLSDNILDKLPKAWFIYLFVAVGVILFIISCFGCIGAATRNGCCLTCYSVL  117

Query  562  villilvelGAAAFIFFDE  618
            ++LLILVELG AAFIFFD+
Sbjct  118  IVLLILVELGCAAFIFFDK  136



>gb|EPS67767.1| hypothetical protein M569_07007 [Genlisea aurea]
Length=281

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  +CLLKLLNFLL L GL M+GYGIYLFVEYKN +   DD P  FPPS+ ++V L
Sbjct  1    MACRGFFDCLLKLLNFLLILVGLAMIGYGIYLFVEYKNGASGDDDGP--FPPSNPDIVML  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+ + LA++IFDNLP+ WF+YLF GIGV++ VISCFGCIGAS RN CCL+CY+V V
Sbjct  59   GRPMLMGLYLADSIFDNLPRAWFIYLFTGIGVVVLVISCFGCIGASIRNRCCLTCYAVFV  118

Query  565  illilvelGAAAFIFFDE  618
            +LLIL+ELG AAF+FFD+
Sbjct  119  VLLILLELGLAAFVFFDK  136



>ref|XP_010919853.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
 ref|XP_010919854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=282

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  ECLLKLLNFLL L GL MVGYG YL VE+   S S DD PI     + EL++L
Sbjct  1    MACRGFWECLLKLLNFLLMLTGLAMVGYGAYLLVEWMKISSSEDDDPISPVGDNYELLKL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML   +L+++I D LPK WF+YLFIGIGV+LF+ISCFGCIG   RNGCC+SCYS LV
Sbjct  61   GRPMLAVATLSDSILDKLPKAWFIYLFIGIGVILFIISCFGCIGVVMRNGCCISCYSFLV  120

Query  565  illilvelGAAAFIFFDER  621
            ILLILVELGAAAFIFFD R
Sbjct  121  ILLILVELGAAAFIFFDHR  139



>ref|XP_006305496.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38394.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=280

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 115/139 (83%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F P +G+   V
Sbjct  1    MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDPVNGDQSFV  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
              GRPML+AV++++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57   SFGRPMLMAVAMSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  116

Query  559  lvillilvelGAAAFIFFD  615
            L+ILLILVELG AAFIFFD
Sbjct  117  LLILLILVELGVAAFIFFD  135



>ref|XP_009151428.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=279

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 3/137 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+  +   D++ + F       V  
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQRAT---DNNSLNFTRDDQSHVSF  57

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML++++L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CCLSCYS+L+
Sbjct  58   GRPMLMSLALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNVCCLSCYSLLL  117

Query  565  illilvelGAAAFIFFD  615
            ILLIL ELGAAAFIFFD
Sbjct  118  ILLILAELGAAAFIFFD  134



>ref|XP_010538377.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
 ref|XP_010538378.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
Length=280

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 3/138 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLECLLKLLNFLL L GLGMVGYGIYLFVEY+  +   D+  +    S    + L
Sbjct  1    MACRGCLECLLKLLNFLLALVGLGMVGYGIYLFVEYQRAT---DNSHMVAQTSGDGYISL  57

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AVSL+N+IFD LPK WF+YLFIGIGV+LFV+SC GC+G  TRN CCLSCYS LV
Sbjct  58   GRPMLMAVSLSNDIFDKLPKPWFIYLFIGIGVILFVVSCCGCLGVCTRNVCCLSCYSALV  117

Query  565  illilvelGAAAFIFFDE  618
            ILL++VELG AAFIFFD+
Sbjct  118  ILLVVVELGCAAFIFFDK  135



>ref|XP_004300273.1| PREDICTED: tobamovirus multiplication protein 2A [Fragaria vesca 
subsp. vesca]
Length=271

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 112/139 (81%), Gaps = 4/139 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDH-PIPFPPSSGELVQ  381
            MAC+GCL  LLKLLNF+LTL GL MVGYGIYL VEY   + + + + P+     +  L+Q
Sbjct  1    MACRGCLVFLLKLLNFILTLVGLAMVGYGIYLLVEYMKVADTANVYSPVG---ETDALIQ  57

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML  VSL+ +  DNLPK WF+YLFIG+GV++FVISCFGCIGA TRNGCCLSCYSVL
Sbjct  58   LGRPMLTTVSLSASFLDNLPKAWFIYLFIGVGVIIFVISCFGCIGAVTRNGCCLSCYSVL  117

Query  562  villilvelGAAAFIFFDE  618
            +ILLILVEL AAAFIFFD+
Sbjct  118  LILLILVELAAAAFIFFDK  136



>emb|CDY48874.1| BnaA05g35820D [Brassica napus]
Length=344

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 113/138 (82%), Gaps = 3/138 (2%)
 Frame = +1

Query  202  NMACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQ  381
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+    + D++ + F       V 
Sbjct  65   KMACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQR---ATDNNSLNFTRDDQSYVS  121

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
             GRPML++++L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CCLSCYS+L
Sbjct  122  FGRPMLMSLALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNVCCLSCYSLL  181

Query  562  villilvelGAAAFIFFD  615
            +ILLIL ELGAAAFIFFD
Sbjct  182  LILLILAELGAAAFIFFD  199



>emb|CDY32286.1| BnaC05g28640D [Brassica napus]
Length=370

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 113/138 (82%), Gaps = 3/138 (2%)
 Frame = +1

Query  202  NMACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQ  381
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+  +   D++ + F       V 
Sbjct  91   KMACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQRAT---DNNSLNFTGDDQSYVS  147

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
             GRPML++V+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CCLSCYS+L
Sbjct  148  FGRPMLMSVALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNICCLSCYSLL  207

Query  562  villilvelGAAAFIFFD  615
            +ILLIL ELGAAAFIFFD
Sbjct  208  LILLILAELGAAAFIFFD  225



>ref|XP_010518876.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
 ref|XP_010518877.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
Length=279

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 110/138 (80%), Gaps = 3/138 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLECLLK LNFLL L GLGMVGYGIYLFVEY+    + + H +      G  V  
Sbjct  1    MACRGCLECLLKFLNFLLALVGLGMVGYGIYLFVEYQR--ATDNSHMVTQTGDDG-YVSF  57

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+ V+L+N+IFD LPK WF+YLFIGIGV+LFV+SC GC+G  TRNGCCLSCYS LV
Sbjct  58   GRPMLMVVALSNDIFDKLPKAWFIYLFIGIGVVLFVVSCCGCVGTCTRNGCCLSCYSALV  117

Query  565  illilvelGAAAFIFFDE  618
            ILLI+VELG AAFIFFD+
Sbjct  118  ILLIIVELGCAAFIFFDK  135



>ref|XP_007156641.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 ref|XP_007156642.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28635.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28636.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
Length=279

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 116/140 (83%), Gaps = 5/140 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GC ECLLKLLNF+L+L GL +VGYGIYLFVE+   S + D   +   P S +  L+
Sbjct  1    MACRGCWECLLKLLNFILSLTGLAIVGYGIYLFVEF---SKASDGETLTTSPVSDDSALI  57

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            QLGRP+L+ VSL+N+  DNLP  WF+++FIGIGV+LF+ISCFGCIGA+TRNGCCLSCYS+
Sbjct  58   QLGRPVLMTVSLSNSFLDNLPSAWFIFVFIGIGVVLFLISCFGCIGAATRNGCCLSCYSI  117

Query  559  lvillilvelGAAAFIFFDE  618
            LV+LLIL+ELG AAFIFFD+
Sbjct  118  LVVLLILIELGCAAFIFFDK  137



>ref|XP_010499788.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Camelina 
sativa]
 ref|XP_010499789.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Camelina 
sativa]
Length=276

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 113/137 (82%), Gaps = 6/137 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F   S   +  
Sbjct  1    MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDDQS--YISF  54

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+AV+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+L+
Sbjct  55   GRPMLMAVTLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSLLL  114

Query  565  illilvelGAAAFIFFD  615
            ILLILVELGAAAFIFFD
Sbjct  115  ILLILVELGAAAFIFFD  131



>ref|XP_004511769.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004511770.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
 ref|XP_004511771.1| PREDICTED: tetraspanin-20-like isoform X3 [Cicer arietinum]
Length=281

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 112/139 (81%), Gaps = 3/139 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  381
            MAC+G  ECLLKLLNF+LTL GL MVGYGIYLFV +   S   DD P   P S    L+Q
Sbjct  1    MACRGFWECLLKLLNFILTLTGLAMVGYGIYLFVGFTKAS--DDDIPEISPVSDDSALIQ  58

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+A+SL++++FD LPK WF+YLFIG+G +LFV+SCFGCIGA TRNGCCL CYS+L
Sbjct  59   LGRPMLLAMSLSDSLFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGAKTRNGCCLICYSIL  118

Query  562  villilvelGAAAFIFFDE  618
            V LLILVELG AAF+FFD+
Sbjct  119  VALLILVELGCAAFLFFDK  137



>ref|XP_003611447.1| GMFP4 [Medicago truncatula]
 gb|AES94405.1| tobamovirus multiplication protein 2A [Medicago truncatula]
Length=289

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 9/122 (7%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHP--IPFP---PSSGE--LVQLGRPMLVAVSLANNIFD  432
             +VGYGIYL V +   S   DD P   P P   P SG+  L+Q GRPML+AVSL++NIFD
Sbjct  25   AIVGYGIYLLVAFAKAS--DDDKPDISPTPDISPVSGDSALIQFGRPMLMAVSLSDNIFD  82

Query  433  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFF  612
             LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCCL CYS+LV LLILVELG AAF+FF
Sbjct  83   KLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCCLICYSILVALLILVELGCAAFLFF  142

Query  613  DE  618
            D+
Sbjct  143  DK  144



>ref|NP_001240069.1| uncharacterized protein LOC100793680 [Glycine max]
 gb|ACU21254.1| unknown [Glycine max]
Length=277

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 108/138 (78%), Gaps = 5/138 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY        D+ + F     E VQ 
Sbjct  1    MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEYN----KAWDNTLNFSEDKTE-VQF  55

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPMLV VSL+N+  D LPK WF+YLFIGIG +LFVISCFGCI A TRNGCCLS YSVLV
Sbjct  56   GRPMLVVVSLSNSFLDELPKAWFIYLFIGIGAVLFVISCFGCIAALTRNGCCLSFYSVLV  115

Query  565  illilvelGAAAFIFFDE  618
            +LLILVELG AAF FFD+
Sbjct  116  LLLILVELGCAAFTFFDK  133



>ref|XP_008784675.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784676.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784677.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
Length=282

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  ECLLKLLNFLL L GL MVGYG YL VE+   S   DD PI     + EL++L
Sbjct  1    MACRGFWECLLKLLNFLLMLTGLAMVGYGAYLLVEWIKISSGQDDGPISPVSDNYELLKL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML  V+L+ +I D LPK WF+YLFIGIGV+LF+ISCFGCIG   RNGCCLSCYSVLV
Sbjct  61   GRPMLAVVTLSESILDKLPKAWFIYLFIGIGVILFIISCFGCIGVIARNGCCLSCYSVLV  120

Query  565  illilvelGAAAFIFFDE  618
            ILLILVELGAAAFIFFD 
Sbjct  121  ILLILVELGAAAFIFFDH  138



>ref|NP_564399.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_973952.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_001031127.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 sp|Q9C5W7.1|TOM2A_ARATH RecName: Full=Tobamovirus multiplication protein 2A; Short=AtTOM2A 
[Arabidopsis thaliana]
 gb|AAG50101.1|AF334723_1 unknown protein [Arabidopsis thaliana]
 gb|AAK60280.1|AF385687_1 At1g32400/F5D14_22 [Arabidopsis thaliana]
 gb|AAM66092.1| unknown [Arabidopsis thaliana]
 dbj|BAC24019.1| tobamovirus multiplication 2A [Arabidopsis thaliana]
 gb|AEE31476.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31477.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31478.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
Length=280

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRVT----DNSVTFDLTNGDQSYV  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
              GRP+L+AVSL++NIFDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57   SFGRPILMAVSLSSNIFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  116

Query  559  lvillilvelGAAAFIFFD  615
            L+ILLILVELG AAFIFFD
Sbjct  117  LLILLILVELGFAAFIFFD  135



>ref|XP_010478663.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=281

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 5/139 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +   D+    F P +G+   +
Sbjct  1    MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT---DNSSGTFDPVNGDQSYI  57

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
              GRP+L+AV+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  58   SFGRPLLMAVTLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  117

Query  559  lvillilvelGAAAFIFFD  615
            L+ILLILVELG AAFIFFD
Sbjct  118  LLILLILVELGVAAFIFFD  136



>emb|CDX93836.1| BnaA09g24360D [Brassica napus]
Length=281

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 7/140 (5%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  375
            MAC+GCLECLLKLLNF+L +AGL ++GYGIYLFVE+K  +    DH + F P++      
Sbjct  1    MACRGCLECLLKLLNFILAVAGLSIIGYGIYLFVEFKRAT----DHSVSFIPTNVNDQSY  56

Query  376  VQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscys  555
            V  GRPML+AV+L++N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CCLSCYS
Sbjct  57   VSFGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVVLFVTSCCGCVGTCSRSICCLSCYS  116

Query  556  vlvillilvelGAAAFIFFD  615
            +L+ILLIL ELGAAAFIFFD
Sbjct  117  LLLILLILAELGAAAFIFFD  136



>ref|XP_009114889.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=281

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 7/140 (5%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  375
            MAC+GCLECLLKLLNF+L +AGLG++GYGIYLFVE+K  +    DH +   P++      
Sbjct  1    MACRGCLECLLKLLNFILAVAGLGIIGYGIYLFVEFKRAT----DHSVSLIPTNVNDQSY  56

Query  376  VQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscys  555
            V  GRPML+AV+L++N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CCLSCYS
Sbjct  57   VSFGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVVLFVTSCCGCVGTCSRSICCLSCYS  116

Query  556  vlvillilvelGAAAFIFFD  615
            +L+ILLIL ELGAAAFIFFD
Sbjct  117  LLLILLILAELGAAAFIFFD  136



>ref|XP_007209447.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 ref|XP_007209448.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10646.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10647.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
Length=281

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 111/145 (77%), Gaps = 16/145 (11%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  363
            MAC+GC EC+LKLLNF+LTL GL MVGYGIYL VEY   + +       GD+        
Sbjct  1    MACRGCWECVLKLLNFVLTLVGLAMVGYGIYLLVEYLKAADTVAMSSLVGDNQ-------  53

Query  364  SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  543
               L+QL RPML+ VSL++NI DNLPK WF+YLFIGIG ++FVISCFGC+ A TRNGCCL
Sbjct  54   --ALIQLSRPMLMTVSLSSNIVDNLPKAWFIYLFIGIGAIIFVISCFGCVAAMTRNGCCL  111

Query  544  scysvlvillilvelGAAAFIFFDE  618
            SCYSVL+ILLILVELG AAFIFFD+
Sbjct  112  SCYSVLLILLILVELGGAAFIFFDK  136



>ref|XP_008788690.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788691.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788692.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
Length=279

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1    MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWNKVSAGGGEDPISPDSDNPAMLTL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+ V ++ +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCCLS YS LV
Sbjct  61   GRPMLLVVPVSTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCCLSWYSFLV  120

Query  565  illilvelGAAAFIFFDE  618
            ILLILVEL AAAFIFFD 
Sbjct  121  ILLILVELAAAAFIFFDH  138



>ref|XP_010933519.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=283

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  EC+LKLLNFLLT+ GL MVGYG+YL VE+   S    D PI     + E  +L
Sbjct  1    MACRGFWECMLKLLNFLLTIIGLAMVGYGVYLLVEWNKISSGDGDGPISPVSDNYEFTKL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
             RPML  V+L+ +I D LP  WF+YLFIGIGV+LFVISCFGCIGA TRNGCCLS YS LV
Sbjct  61   RRPMLAVVTLSESILDKLPNAWFIYLFIGIGVILFVISCFGCIGALTRNGCCLSFYSFLV  120

Query  565  illilvelGAAAFIFFDE  618
            ILLILVELGAAAFIFFD 
Sbjct  121  ILLILVELGAAAFIFFDH  138



>ref|XP_006305495.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38393.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=256

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = +1

Query  277  MVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LVQLGRPMLVAVSLANNIFDNLPKEW  450
            M+GYGIYLFVEYK  +    D+ + F P +G+   V  GRPML+AV++++N+FDNLPK W
Sbjct  1    MIGYGIYLFVEYKRAT----DNSVTFDPVNGDQSFVSFGRPMLMAVAMSSNVFDNLPKAW  56

Query  451  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFD  615
            F+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+L+ILLILVELG AAFIFFD
Sbjct  57   FIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSLLLILLILVELGVAAFIFFD  111



>ref|XP_008238361.1| PREDICTED: tobamovirus multiplication protein 2A [Prunus mume]
Length=281

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 16/145 (11%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  363
            MAC+GC ECLLKLLNF+LTL GL MVGYGIYL VEY   + +       GD+        
Sbjct  1    MACRGCWECLLKLLNFVLTLVGLAMVGYGIYLLVEYLKAADTVAMSSLVGDNQ-------  53

Query  364  SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  543
               L+QL RPML+ VSL++NI+DNLPK WF+Y+FIGIG ++FVISCFGC+ A TRNGCCL
Sbjct  54   --ALIQLSRPMLMTVSLSSNIWDNLPKAWFIYVFIGIGAIIFVISCFGCVAAMTRNGCCL  111

Query  544  scysvlvillilvelGAAAFIFFDE  618
            SCYSVL+ILLILVEL  AAFIFFD+
Sbjct  112  SCYSVLLILLILVELAGAAFIFFDK  136



>ref|XP_009397919.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=284

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 113/140 (81%), Gaps = 3/140 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG--ELV  378
            MACKG  ECLLKLLNF+LTLAGL MVGYG+YL VE+ N   SG D   P  P+S   E +
Sbjct  1    MACKGFWECLLKLLNFILTLAGLAMVGYGVYLLVEW-NKVASGSDGEDPASPTSSDSEFL  59

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            +LGRP+LVAVSL+++  D LPK WF+YLFIGIGV+LFVISCFGCIGA TRNGCCLSCY+ 
Sbjct  60   KLGRPILVAVSLSSSFLDYLPKAWFIYLFIGIGVVLFVISCFGCIGAVTRNGCCLSCYAF  119

Query  559  lvillilvelGAAAFIFFDE  618
            LVILL+L EL AAAFIFFD 
Sbjct  120  LVILLVLAELAAAAFIFFDH  139



>emb|CDY01278.1| BnaC05g24540D [Brassica napus]
Length=281

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  375
            MAC+GCLECLLKLLNFLL +AGLG++ YGIYLFV +K  +    DH + F P++      
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGIIAYGIYLFVVFKRAT----DHSVSFIPTNVNDQSY  56

Query  376  VQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscys  555
            V  GRPML+AV+L++N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CCLSCYS
Sbjct  57   VSFGRPMLMAVALSSNVFDNLPKAWFVYLFIGIGVVLFVTSCCGCVGTCSRSICCLSCYS  116

Query  556  vlvillilvelGAAAFIFFD  615
            +L+ILLIL ELGAAAFIFFD
Sbjct  117  LLLILLILAELGAAAFIFFD  136



>ref|XP_002893721.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69980.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            M  +GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1    MTFRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRVT----DNSVTFDSTNGDQSYV  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
              GRPML+AVSL++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57   SFGRPMLMAVSLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  116

Query  559  lvillilvelGAAAFIFFD  615
            L+ILLILVELG AAFIFFD
Sbjct  117  LLILLILVELGFAAFIFFD  135



>ref|XP_003611445.1| GMFP4 [Medicago truncatula]
Length=294

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 93/127 (73%), Gaps = 14/127 (11%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHP--IPFP---PSSGE--LVQLGRPMLVAVSLANNIFD  432
             +VGYGIYL V +   S   DD P   P P   P SG+  L+Q GRPML+AVSL++NIFD
Sbjct  25   AIVGYGIYLLVAFAKAS--DDDKPDISPTPDISPVSGDSALIQFGRPMLMAVSLSDNIFD  82

Query  433  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNG-----cclscysvlvillilvelGAA  597
             LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNG       LS YS+LV LLILVELG A
Sbjct  83   KLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCCLICVSLSNYSILVALLILVELGCA  142

Query  598  AFIFFDE  618
            AF+FFD+
Sbjct  143  AFLFFDK  149



>ref|XP_010934869.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Elaeis 
guineensis]
Length=267

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1    MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWIKVSSGGGEDPISPVSDNPVMLTL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+   ++ +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCCLSCYS LV
Sbjct  61   GRPMLLVAPISTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCCLSCYSFLV  120

Query  565  illilvelGAAAFIFFDE  618
            ILLILVEL AAAFIFFD 
Sbjct  121  ILLILVELAAAAFIFFDH  138



>ref|XP_010934868.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Elaeis 
guineensis]
Length=280

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1    MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWIKVSSGGGEDPISPVSDNPVMLTL  60

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRPML+   ++ +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCCLSCYS LV
Sbjct  61   GRPMLLVAPISTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCCLSCYSFLV  120

Query  565  illilvelGAAAFIFFDE  618
            ILLILVEL AAAFIFFD 
Sbjct  121  ILLILVELAAAAFIFFDH  138



>ref|XP_009398578.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDD-HPIPFPPSSGELVQ  381
            MAC+G  ECLLKLLNFLLTL GL MVGYG YL VE+   S S DD  PI     + E + 
Sbjct  1    MACRGLWECLLKLLNFLLTLTGLAMVGYGAYLLVEWNRVSSSDDDDEPISPTGDNPEFLT  60

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
             GRPMLVAVSL+++  D LPK WF+YL IGIGV+LF+ISCFG IGA +RNGCCLSCYS L
Sbjct  61   FGRPMLVAVSLSSSFLDKLPKAWFIYLIIGIGVVLFIISCFGFIGAVSRNGCCLSCYSFL  120

Query  562  villilvelGAAAFIFFDE  618
            VILLILVELGAAAFIFFD 
Sbjct  121  VILLILVELGAAAFIFFDH  139



>ref|XP_010104372.1| hypothetical protein L484_023325 [Morus notabilis]
 gb|EXB99792.1| hypothetical protein L484_023325 [Morus notabilis]
Length=251

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 85/115 (74%), Gaps = 14/115 (12%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHS-----PSGDDHPIPFPPSSG  369
            MAC+GCLECLLKLLNFLLTL GL +VGYGIYL VEY   +     P GDDH         
Sbjct  1    MACRGCLECLLKLLNFLLTLVGLAIVGYGIYLLVEYTKSTDDTAPPVGDDH---------  51

Query  370  ELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNG  534
              +QLGRPML+A S++  IFD LPK WF+YLFIG+G +LFVISCFGC+GA TRNG
Sbjct  52   NSMQLGRPMLMAASMSAGIFDKLPKAWFIYLFIGLGAILFVISCFGCVGAVTRNG  106



>ref|XP_004509001.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004509002.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
Length=280

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  ECLLKLLNFLLT+ GL MVGYGIYL VE+   S S  +  +        LVQL
Sbjct  1    MACRGFWECLLKLLNFLLTVTGLAMVGYGIYLLVEFSKASDSSLN--VSTVSDGQTLVQL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
            GRP+L+AV L+++ FD+LPK WF+YLFIG+G +LFVISCFGCI + TRNGCCLSCYSVLV
Sbjct  59   GRPLLMAVPLSDSFFDDLPKAWFIYLFIGVGAVLFVISCFGCIASVTRNGCCLSCYSVLV  118

Query  565  illilvelGAAAFIFFDE  618
            +LLILVELG AAF+FFD+
Sbjct  119  VLLILVELGCAAFVFFDK  136



>ref|XP_008352453.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=198

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 115/145 (79%), Gaps = 16/145 (11%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  363
            MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GDDH       
Sbjct  1    MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRASDSTVMSSPVGDDH-------  53

Query  364  SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  543
              +LVQL RP+L+ VSL+ ++ DNLPK WF+YLFIGIG ++F+ISCFGC+GA TRNGCCL
Sbjct  54   --DLVQLSRPLLMTVSLSTSVLDNLPKAWFIYLFIGIGAIIFIISCFGCVGAMTRNGCCL  111

Query  544  scysvlvillilvelGAAAFIFFDE  618
            SCYSVLVILLILVELGAAAFIFFD+
Sbjct  112  SCYSVLVILLILVELGAAAFIFFDK  136



>gb|AAF81337.1|AC007767_17 Contains similarity to GMFP4 from Glycine max gb|U64915. ESTs 
gb|AV442477, gb|AV441037, gb|AV534954, gb|AV560678 and gb|AV518757 
come from this gene [Arabidopsis thaliana]
Length=252

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 86/106 (81%), Gaps = 6/106 (6%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRVT----DNSVTFDLTNGDQSYV  56

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIG  516
              GRP+L+AVSL++NIFDNLPK WF+YLFIGIGV LFVISC GC+ 
Sbjct  57   SFGRPILMAVSLSSNIFDNLPKAWFIYLFIGIGVALFVISCCGCVA  102



>ref|XP_009391069.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391140.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391209.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391294.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  381
            MACKG  E LLKLLNFLLTL GL MVGYG+YL +EY   S  GD      P S+  +   
Sbjct  1    MACKGFWEYLLKLLNFLLTLTGLAMVGYGVYLLMEYNKVSSGGDGDDQVAPTSNDPKFWM  60

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            +GRPMLV V L+++  D+LPK WF+YLFIG+G +LFVISC GCIGA TRNGCCLSCYS L
Sbjct  61   IGRPMLVGVPLSSSFLDHLPKAWFIYLFIGVGAILFVISCIGCIGAVTRNGCCLSCYSFL  120

Query  562  villilvelGAAAFIFFDE  618
            VILLILVEL AAAFIFF+ 
Sbjct  121  VILLILVELAAAAFIFFNH  139



>ref|XP_009371175.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371176.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371177.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=280

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 115/145 (79%), Gaps = 16/145 (11%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  363
            MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY   S S       GDDH       
Sbjct  1    MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRASDSTVMSSAVGDDH-------  53

Query  364  SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  543
              +LVQL RP+L+ VSL+ +I DNLPK WF+YLFIGIG ++F+ISCFGC+GA TRNGCCL
Sbjct  54   --DLVQLSRPLLMTVSLSTSILDNLPKAWFIYLFIGIGAIIFIISCFGCVGAMTRNGCCL  111

Query  544  scysvlvillilvelGAAAFIFFDE  618
            SCYSVLVILLILVELGAAAFIFFD+
Sbjct  112  SCYSVLVILLILVELGAAAFIFFDK  136



>ref|XP_006659267.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=287

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPF--PPSSGELV  378
            MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G     P   P    EL+
Sbjct  1    MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGGGGPRASPAPPAELL  60

Query  379  QLGRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscy  552
              GRPML AV+L +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CCL CY
Sbjct  61   MFGRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCCLCCY  120

Query  553  svlvillilvelGAAAFIFFDE  618
            + LVILLILVE GAAAFIFFD 
Sbjct  121  AFLVILLILVEAGAAAFIFFDH  142



>gb|EEC83268.1| hypothetical protein OsI_28600 [Oryza sativa Indica Group]
Length=195

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 106/140 (76%), Gaps = 3/140 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G   P   P    EL+  
Sbjct  1    MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGAPPS-PAPPAELLMF  59

Query  385  GRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            GRPML AV+L +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CCL CY+ 
Sbjct  60   GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCCLCCYAF  119

Query  559  lvillilvelGAAAFIFFDE  618
            LVILLILVE GAAAFIFFDE
Sbjct  120  LVILLILVEAGAAAFIFFDE  139



>gb|EEE68396.1| hypothetical protein OsJ_26735 [Oryza sativa Japonica Group]
Length=221

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 106/140 (76%), Gaps = 3/140 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G   P   P    EL+  
Sbjct  1    MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGAPPS-PAPPAELLMF  59

Query  385  GRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            GRPML AV+L +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CCL CY+ 
Sbjct  60   GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCCLCCYAF  119

Query  559  lvillilvelGAAAFIFFDE  618
            LVILLILVE GAAAFIFFDE
Sbjct  120  LVILLILVEAGAAAFIFFDE  139



>ref|NP_001061444.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAC99958.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF23358.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAG95056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 106/140 (76%), Gaps = 3/140 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G     P P    EL+  
Sbjct  1    MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGG-GAPPSPAPPAELLMF  59

Query  385  GRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            GRPML AV+L +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CCL CY+ 
Sbjct  60   GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCCLCCYAF  119

Query  559  lvillilvelGAAAFIFFDE  618
            LVILLILVE GAAAFIFFDE
Sbjct  120  LVILLILVEAGAAAFIFFDE  139



>ref|XP_004983591.1| PREDICTED: tetraspanin-18-like isoform X1 [Setaria italica]
 ref|XP_004983592.1| PREDICTED: tetraspanin-18-like isoform X2 [Setaria italica]
Length=278

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  453
             MVGYGIYL VE+   S  G         +  E++ LGRP+L AV+L ++  D LPK WF
Sbjct  25   AMVGYGIYLLVEWMKISKGGGGG------TPAEVLVLGRPLLGAVALGDSFLDKLPKAWF  78

Query  454  LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFD  615
            +YLFIG+G ++F++S FGCIGA TRN CCL  Y+ LV+LLIL E GAAAFIFFD
Sbjct  79   IYLFIGVGAIVFLVSLFGCIGAGTRNTCCLCFYAFLVLLLILAEGGAAAFIFFD  132



>ref|NP_001150827.1| tetraspanin family protein [Zea mays]
 ref|XP_008678655.1| PREDICTED: tetraspanin family protein isoform X1 [Zea mays]
 gb|ACN27909.1| unknown [Zea mays]
 tpg|DAA46389.1| TPA: tetraspanin family protein isoform 1 [Zea mays]
 tpg|DAA46390.1| TPA: tetraspanin family protein isoform 2 [Zea mays]
Length=279

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 79/115 (69%), Gaps = 5/115 (4%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  453
             MVGYGIYL VE+   S  G    +     + E++  GRP+L AV+L ++  D LPK WF
Sbjct  25   AMVGYGIYLLVEWMKISEDGSSGGL-----TAEVLVSGRPLLGAVALGDSFLDMLPKAWF  79

Query  454  LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            +YLFIG+G  +F++S FGCIGA TRN CCL  Y+ LVILLIL E GAAAFIFFD 
Sbjct  80   IYLFIGVGATVFLVSLFGCIGAGTRNTCCLCFYAFLVILLILAEAGAAAFIFFDH  134



>gb|ACG40574.1| tetraspanin family protein [Zea mays]
Length=279

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 79/115 (69%), Gaps = 5/115 (4%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  453
             MVGYGIYL VE+   S  G    +     + E++  GRP+L AV+L ++  D LPK WF
Sbjct  25   AMVGYGIYLLVEWMKISEDGSSGGL-----TAEVLVSGRPLLGAVALGDSFLDMLPKAWF  79

Query  454  LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            +YLFIG+G  +F++S FGCIGA TRN CCL  Y+ LVILLIL E GAAAFIFFD 
Sbjct  80   IYLFIGVGATVFLVSLFGCIGAGTRNTCCLCFYAFLVILLILAEAGAAAFIFFDH  134



>ref|XP_009385932.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385933.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  381
            MACKG  ECLLKLLNFLLTL GL MVGYGIYL V +   S SG    + FP     E ++
Sbjct  1    MACKGFWECLLKLLNFLLTLTGLAMVGYGIYLLVIWNKASSSGVGEDLAFPTGGDPEFLK  60

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPMLVAVSL+++  D+LPK WF+YLFIG+G+++FVISCFGCIGA TRNGCCLSCY+ L
Sbjct  61   LGRPMLVAVSLSSSFLDHLPKAWFIYLFIGVGIIIFVISCFGCIGALTRNGCCLSCYAFL  120

Query  562  villilvelGAAAFIFFDE  618
            VILL+LVE+ AAAFI FD 
Sbjct  121  VILLVLVEVAAAAFIIFDH  139



>gb|ABK22053.1| unknown [Picea sitchensis]
Length=282

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  453
            GMVGYGIY+ V+++  S S +   IP   + G+++ LGRP+L    L+ +  D LP  WF
Sbjct  24   GMVGYGIYMMVKWEQDSVSVN-SVIPATANKGDVLILGRPLLFLAPLSTSFLDKLPGAWF  82

Query  454  LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDER  621
            +YLF+ +GV+LF++SC GCI  +TR GCCL CY+VLV+LLI+VEL  A FIFFD +
Sbjct  83   IYLFMAVGVILFIVSCSGCIAVATRRGCCLCCYTVLVVLLIVVELALAGFIFFDHK  138



>ref|XP_003611446.1| GMFP4 [Medicago truncatula]
Length=220

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  394  MLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvill  573
            ML+AVSL++NIFD LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCCL CYS+LV LL
Sbjct  1    MLMAVSLSDNIFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCCLICYSILVALL  60

Query  574  ilvelGAAAFIFFDE  618
            ILVELG AAF+FFD+
Sbjct  61   ILVELGCAAFLFFDK  75



>gb|AFK47448.1| unknown [Medicago truncatula]
Length=220

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  394  MLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvill  573
            ML+AVSL++NIFD LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCCL CYS+LV LL
Sbjct  1    MLMAVSLSDNIFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCCLICYSILVALL  60

Query  574  ilvelGAAAFIFFDE  618
            ILVELG AAF+FFD+
Sbjct  61   ILVELGCAAFLFFDK  75



>ref|XP_006850026.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
 gb|ERN11607.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
Length=276

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MACKG  ECLLKLLNFLLTL GL MVGYG+YL + +K  +    D PI    S  E  +L
Sbjct  1    MACKGFFECLLKLLNFLLTLVGLAMVGYGVYLLIIWKKSTSGHTDFPIS-DGSEPEQFRL  59

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  564
             RP + A  L+ N +D LP  WF+YLFI IG +LFVISC GCIGA+TRN CCLSCYSVL+
Sbjct  60   VRPFIYAGYLSANFWDKLPTPWFIYLFIAIGAILFVISCIGCIGAATRNICCLSCYSVLL  119

Query  565  illilvelGAAAFIFFDE  618
            +LLI+VELG AAFIFFD 
Sbjct  120  VLLIVVELGLAAFIFFDH  137



>gb|KJB51696.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=219

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  394  MLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvill  573
            ML+AVSL+++IFDNLPK WFLYLFIG+GV+LF+ISCFGCIG +TRN CCL+CYS+LVILL
Sbjct  1    MLMAVSLSSSIFDNLPKAWFLYLFIGVGVVLFIISCFGCIGTATRNLCCLTCYSLLVILL  60

Query  574  ilvelGAAAFIFFDE  618
            ILVELG AAFIFFD+
Sbjct  61   ILVELGCAAFIFFDK  75



>gb|EYU17843.1| hypothetical protein MIMGU_mgv1a0124672mg, partial [Erythranthe 
guttata]
Length=221

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  382  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  561
            LGRPML+AVSLA+NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCCL+CYS+L
Sbjct  1    LGRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCCLTCYSLL  60

Query  562  villilvelGAAAFIFFDE  618
            VILLIL ELG AAFIFFD+
Sbjct  61   VILLILAELGFAAFIFFDD  79



>gb|EMS54049.1| hypothetical protein TRIUR3_29725 [Triticum urartu]
Length=285

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLAN--NIFDNLPKE  447
             MVGYGIYL VE+      G     P P    EL+  GRPML  V+L    + FD LPK 
Sbjct  25   AMVGYGIYLLVEWM-RISGGGGGAPPSPAPPAELLTFGRPMLTVVALGEGGSFFDKLPKA  83

Query  448  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            WF+YLFIG+G ++FV+S FGCIGA TRN CCL CYS LVILLIL E G AAFIFFD 
Sbjct  84   WFIYLFIGVGAVIFVVSLFGCIGAGTRNTCCLCCYSFLVILLILAEAGGAAFIFFDH  140



>emb|CDP12960.1| unnamed protein product [Coffea canephora]
Length=221

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  400  VAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillil  579
            +AVSLA NIFD LPK WF+YLFIG+GV+LFVISCFGCIGA+TRNGCCLSCY+VLVILLIL
Sbjct  1    MAVSLAANIFDKLPKAWFIYLFIGVGVVLFVISCFGCIGAATRNGCCLSCYAVLVILLIL  60

Query  580  velGAAAFIFFDE  618
            +ELG AAFIFFD+
Sbjct  61   IELGVAAFIFFDK  73



>ref|XP_003573849.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=283

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 5/117 (4%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANN--IFDNLPKE  447
             MVGYGIYL VE+   S        P P    +L+  GRPML  V LA+    FD LPK 
Sbjct  25   AMVGYGIYLLVEWMRISGG---GAPPSPAPPADLLLFGRPMLTVVGLADGGGFFDKLPKA  81

Query  448  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            WF+YLFIG+G ++F++S FGCIGA TRN CCL CYS L+ILLILVE GAAAFIFFD 
Sbjct  82   WFIYLFIGVGAVVFIVSLFGCIGAGTRNTCCLCCYSFLIILLILVEAGAAAFIFFDH  138



>gb|KCW71821.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=260

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1    MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  385  GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLF  489
            GRPML AVSL+++IFD+LPK WF+YLF+G+GV+LF
Sbjct  59   GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILF  93



>gb|AFW87795.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
 gb|AFW87796.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=169

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  453
             MVGYGIYL VE+   S  G         S+ E++  GRP+L AV L ++  DNLPK WF
Sbjct  25   AMVGYGIYLLVEWMKISEDGIG-----GASTAEVLVSGRPLLGAVILGDSFLDNLPKAWF  79

Query  454  LYLFIGIGVLLFVISCFGCIGASTRN  531
            +YLFI +G ++ ++S FGCIGA TRN
Sbjct  80   IYLFICVGTIVILVSLFGCIGAGTRN  105



>dbj|BAK04010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLAN--NIFDNLPKE  447
             MVGYGIYL  E+   S  G     P P    EL+  GRPML  V+L    + FD LP+ 
Sbjct  25   AMVGYGIYLLAEWMRISGGGG-GAPPSPAPPAELLMFGRPMLTVVALGEGGSFFDKLPEA  83

Query  448  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            WF+YLFIG+G ++F++S FGCIGA TRN CCL CYS LVILLIL E G AAFIFFD 
Sbjct  84   WFIYLFIGVGAVIFIVSLFGCIGAGTRNTCCLCCYSFLVILLILAEAGGAAFIFFDH  140



>ref|XP_006847670.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
 gb|ERN09251.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
Length=284

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  453
             M+GYGIYL VE+KN S +     +    S+  +++LGRP+L    L+++I   L + WF
Sbjct  24   AMIGYGIYLLVEWKNDSSTVTLISVL---SNQPMIKLGRPLLHMGPLSSSILTELSEAWF  80

Query  454  LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            +Y FI +GV+L VISCFGCIGA TR+GCCLSCYSVL+ILLI+VELG A FIFFD 
Sbjct  81   VYSFIVVGVILCVISCFGCIGAFTRHGCCLSCYSVLLILLIIVELGLAGFIFFDH  135



>ref|NP_001146619.1| hypothetical protein [Zea mays]
 gb|ACF86508.1| unknown [Zea mays]
 gb|ACR38384.1| unknown [Zea mays]
 gb|AFW87797.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=279

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  453
             MVGYGIYL VE+   S  G         S+ E++  GRP+L AV L ++  DNLPK WF
Sbjct  25   AMVGYGIYLLVEWMKISEDGIGGA-----STAEVLVSGRPLLGAVILGDSFLDNLPKAWF  79

Query  454  LYLFIGIGVLLFVISCFGCIGASTRN  531
            +YLFI +G ++ ++S FGCIGA TRN
Sbjct  80   IYLFICVGTIVILVSLFGCIGAGTRN  105



>emb|CBI33948.3| unnamed protein product [Vitis vinifera]
Length=217

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  400  VAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillil  579
            +AV+L+++I DNLPK WF+Y F  IGV+LFVISCFGC+GA TRNGCCLSCY+VLVILLIL
Sbjct  1    MAVTLSSSILDNLPKAWFIYCFFAIGVILFVISCFGCVGAVTRNGCCLSCYAVLVILLIL  60

Query  580  velGAAAFIFFDE  618
            +ELG AAFIFFD+
Sbjct  61   IELGCAAFIFFDK  73



>ref|XP_006436787.1| hypothetical protein CICLE_v10033213mg [Citrus clementina]
 ref|XP_006436788.1| hypothetical protein CICLE_v10033213mg [Citrus clementina]
 gb|ESR50027.1| hypothetical protein CICLE_v10033213mg [Citrus clementina]
 gb|ESR50028.1| hypothetical protein CICLE_v10033213mg [Citrus clementina]
Length=84

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 67/89 (75%), Gaps = 7/89 (8%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  378
            MAC+GCLECLLKLLNFLLT+ GL MVGYGIYLFVEYK    SG   P+     SG+   V
Sbjct  1    MACRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPV-----SGDEGFV  55

Query  379  QLGRPMLVAVSLANNIFDNLPKEWFLYLF  465
            QLGRPML+AVSLA++IFD LPK W+   F
Sbjct  56   QLGRPMLMAVSLADSIFDKLPKAWYECFF  84



>dbj|BAJ85018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=135

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLAN--NIFDNLPKE  447
             MVGYGIYL  E+   S  G   P   P    EL+  GRPML  V+L    + FD LP+ 
Sbjct  25   AMVGYGIYLLAEWMRISGGGGGAPPS-PAPPAELLMFGRPMLTVVALGEGGSFFDKLPEA  83

Query  448  WFLYLFIGIGVLLFVISCFGCIGASTRN  531
            WF+YLFIG+G ++F++S FGCIGA TRN
Sbjct  84   WFIYLFIGVGAVIFIVSLFGCIGAGTRN  111



>gb|KCW77892.1| hypothetical protein EUGRSUZ_D021562, partial [Eucalyptus grandis]
 gb|KCW77893.1| hypothetical protein EUGRSUZ_D021562, partial [Eucalyptus grandis]
 gb|KCW77894.1| hypothetical protein EUGRSUZ_D021562, partial [Eucalyptus grandis]
Length=79

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GCLEC+LKLLNFLLTL GL MVGYGIYLFVEYK  S SG     P     G  VQL
Sbjct  1    MACRGCLECVLKLLNFLLTLVGLAMVGYGIYLFVEYK-RSSSGTVGYSPIGADEGS-VQL  58

Query  385  GRPMLVAVSLANNIFDNLPK  444
            GRP+LV VSL+ +IFDNLPK
Sbjct  59   GRPLLVTVSLSASIFDNLPK  78



>gb|KHN21027.1| hypothetical protein glysoja_034149 [Glycine soja]
Length=250

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 64/89 (72%), Gaps = 15/89 (17%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-----GDDHPIPFPPSSG  369
            MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY N +P      GDD          
Sbjct  1    MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEY-NKTPDNTLTVGDDQ---------  50

Query  370  ELVQLGRPMLVAVSLANNIFDNLPKEWFL  456
             LVQLGRPMLVAVSL+N+  D+LPK  FL
Sbjct  51   TLVQLGRPMLVAVSLSNSFLDDLPKACFL  79



>gb|KHG29161.1| Stk31 [Gossypium arboreum]
Length=259

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 6/82 (7%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  378
            MAC+GCLECLLKLLNFL+T+AGL +V YGIYLFV+YK+ +    D  + F P  S  +L+
Sbjct  1    MACRGCLECLLKLLNFLVTVAGLAIVRYGIYLFVKYKDAA----DTVMLFSPVGSDQDLI  56

Query  379  QLGRPMLVAVSLANNIFDNLPK  444
            QLGRPML+AVSL+++IFDNLPK
Sbjct  57   QLGRPMLMAVSLSSSIFDNLPK  78



>ref|XP_002443902.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
 gb|EES13397.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
Length=274

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 92/142 (65%), Gaps = 6/142 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  EC+LKLLN ++   GL MVGYG YL V +   +P          PS G+LV+L
Sbjct  1    MACRGFFECVLKLLNLVVMAVGLAMVGYGAYLLVMWLQVAPPLPPPAPSPAPSGGDLVRL  60

Query  385  GRPMLVAV----SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscy  552
            GRP+L+ V    S ++   + L   WF++ FIG+G +LF+ S FGC GA  RNGCCLS Y
Sbjct  61   GRPLLLLVDASLSDSDGTAERLSSAWFIFAFIGVGAILFITSIFGCAGA--RNGCCLSIY  118

Query  553  svlvillilvelGAAAFIFFDE  618
            S L+IL ILVELGA  FIFF+ 
Sbjct  119  SFLIILFILVELGAGGFIFFNH  140



>ref|XP_003573463.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=278

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 92/145 (63%), Gaps = 7/145 (5%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS----GE  372
            MAC+G  EC+LKLLNF++ + GL M GYG YL V +              P +     G+
Sbjct  1    MACRGFFECVLKLLNFVVMVVGLAMAGYGAYLLVLWLQVLSPPLPPSPAPPAAVAPSGGD  60

Query  373  LVQLGRPMLVAVSLA---NNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  543
            LV+LGRPML+ +  +   N   + L   WF++ FIGIGV+LF+ S FGC GASTR+GCCL
Sbjct  61   LVRLGRPMLLLLDASLSDNGTVERLSSAWFIFAFIGIGVILFITSIFGCAGASTRSGCCL  120

Query  544  scysvlvillilvelGAAAFIFFDE  618
            S YS L+IL ILVEL A  FIFFD 
Sbjct  121  STYSFLIILFILVELAAGCFIFFDH  145



>gb|AFW61168.1| hypothetical protein ZEAMMB73_111506 [Zea mays]
Length=126

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 5/113 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  381
            MAC+G  EC+LKLLN ++   GL MVGYG +L V + +              P SGELV+
Sbjct  1    MACRGFFECVLKLLNLVVMAVGLAMVGYGAFLLVTWLQVAPLPPPSSSPDAVPPSGELVR  60

Query  382  LGRPMLVAV--SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNG  534
            LGRP+L+ V  SL++   + L   WF++ FIG+G +LFV S FGC GA  RNG
Sbjct  61   LGRPLLLFVDASLSDGTAERLSSAWFIFAFIGVGAILFVTSIFGCAGA--RNG  111



>ref|NP_001146674.1| uncharacterized protein LOC100280274 [Zea mays]
 gb|ACL54503.1| unknown [Zea mays]
Length=126

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 68/109 (62%), Gaps = 3/109 (3%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  381
            MAC+G  EC+LKLLN ++   GL MVGYG +L V + +              P SGELV+
Sbjct  1    MACRGFFECVLKLLNLVVMAVGLAMVGYGAFLLVTWLQVAPLPPPSSSPDAVPPSGELVR  60

Query  382  LGRPMLVAV--SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGAS  522
            LGRP+L+ V  SL++   + L   WF++ FIG+G +LFV S FGC GAS
Sbjct  61   LGRPLLLFVDASLSDGTAERLSSAWFIFAFIGVGAILFVTSIFGCAGAS  109



>gb|ACN35034.1| unknown [Zea mays]
 gb|AFW61169.1| hypothetical protein ZEAMMB73_111506 [Zea mays]
Length=275

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 90/141 (64%), Gaps = 5/141 (4%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  381
            MAC+G  EC+LKLLN ++   GL MVGYG +L V + +              P SGELV+
Sbjct  1    MACRGFFECVLKLLNLVVMAVGLAMVGYGAFLLVTWLQVAPLPPPSSSPDAVPPSGELVR  60

Query  382  LGRPML--VAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscys  555
            LGRP+L  V  SL++   + L   WF++ FIG+G +LFV S FGC GA  RNGCCLS YS
Sbjct  61   LGRPLLLFVDASLSDGTAERLSSAWFIFAFIGVGAILFVTSIFGCAGA--RNGCCLSIYS  118

Query  556  vlvillilvelGAAAFIFFDE  618
             L+IL ILVEL A  FIFF+ 
Sbjct  119  FLIILFILVELAAGGFIFFNH  139



>gb|KDP43415.1| hypothetical protein JCGZ_16702 [Jatropha curcas]
Length=229

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 7/112 (6%)
 Frame = +1

Query  286  YGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPM-LVAVSLANNIFDNLPKEWFLYL  462
            YGI+  V +KN   S   +      +S +  Q+  P  L+A+  ++ + + LP  WF+YL
Sbjct  29   YGIFCLVNWKNDRESHSHN------NSKKYEQIALPRALLAIEASSWLSNRLPVAWFIYL  82

Query  463  FIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
             + IG  L VISCFGC+GA+TR+ CCL  YSVL++LL + +L AAAF+FF+ 
Sbjct  83   LLVIGASLIVISCFGCVGAATRSSCCLCTYSVLLVLLFIAQLVAAAFMFFNH  134



>gb|KHN01670.1| hypothetical protein glysoja_012981 [Glycine soja]
Length=250

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 59/84 (70%), Gaps = 5/84 (6%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY        D+ + F     E VQ 
Sbjct  1    MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEYN----KAWDNTLNFSEDKTE-VQF  55

Query  385  GRPMLVAVSLANNIFDNLPKEWFL  456
            GRPMLV VSL+N+  D LPK  FL
Sbjct  56   GRPMLVVVSLSNSFLDELPKACFL  79



>ref|XP_004972786.1| PREDICTED: tetraspanin-20-like isoform X2 [Setaria italica]
Length=278

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 90/146 (62%), Gaps = 10/146 (7%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-----G  369
            MAC+G  ECLLKLLN ++   GL MVGYG YL V +    P       P P        G
Sbjct  1    MACRGFFECLLKLLNLIVMAVGLAMVGYGAYLLVMWLQVVPPPAPPLPPSPAPVVVAAGG  60

Query  370  ELVQLGRPMLVAV---SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcc  540
            ELV+LGRP+++ V   SL++   +     WF++ FIG+GV+LF+ S FGC GA  RNGCC
Sbjct  61   ELVRLGRPLMLLVDASSLSDGTAERFSSAWFIFTFIGVGVVLFITSIFGCAGA--RNGCC  118

Query  541  lscysvlvillilvelGAAAFIFFDE  618
            LS YS L+IL ILVEL    FIFF+ 
Sbjct  119  LSIYSFLIILFILVELATGGFIFFNH  144



>ref|XP_008788693.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Phoenix dactylifera]
Length=202

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 2/62 (3%)
 Frame = +1

Query  433  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFF  612
             LP+  F+YLFIGIGV+LF+ISC GC+GA+TRNGCCLS YS LVILLILVEL AAAFIFF
Sbjct  2    KLPR--FIYLFIGIGVILFIISCCGCVGATTRNGCCLSWYSFLVILLILVELAAAAFIFF  59

Query  613  DE  618
            D 
Sbjct  60   DH  61



>ref|XP_004972785.1| PREDICTED: tetraspanin-20-like isoform X1 [Setaria italica]
Length=332

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 90/146 (62%), Gaps = 10/146 (7%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-----G  369
            MAC+G  ECLLKLLN ++   GL MVGYG YL V +    P       P P        G
Sbjct  1    MACRGFFECLLKLLNLIVMAVGLAMVGYGAYLLVMWLQVVPPPAPPLPPSPAPVVVAAGG  60

Query  370  ELVQLGRPMLVAV---SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcc  540
            ELV+LGRP+++ V   SL++   +     WF++ FIG+GV+LF+ S FGC GA  RNGCC
Sbjct  61   ELVRLGRPLMLLVDASSLSDGTAERFSSAWFIFTFIGVGVVLFITSIFGCAGA--RNGCC  118

Query  541  lscysvlvillilvelGAAAFIFFDE  618
            LS YS L+IL ILVEL    FIFF+ 
Sbjct  119  LSIYSFLIILFILVELATGGFIFFNH  144



>gb|KCW77895.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
 gb|KCW77896.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=204

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            F++LFIG+GV+LF+ISCFGCIG+ TRNGCCL+CYSVLVILLILVELG AAFI+FD+
Sbjct  1    FIFLFIGVGVVLFIISCFGCIGSVTRNGCCLTCYSVLVILLILVELGCAAFIYFDK  56



>ref|NP_001061041.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAC99658.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF22955.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAG92210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91640.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68082.1| hypothetical protein OsJ_26119 [Oryza sativa Japonica Group]
Length=278

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 92/146 (63%), Gaps = 9/146 (6%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-----  369
            MAC+G  E +LKLLN ++ + GL M+GYG YL V +    PS    P     + G     
Sbjct  1    MACRGFFEWVLKLLNLVVMVVGLAMMGYGAYLLVAWLQLLPSPPPLPPAPAVAPGGGGGG  60

Query  370  ELVQLGRPMLVAV---SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcc  540
            E+V+LGRP+L+ +   SL +   + L   WF+Y FIG+GV+LF+ S FGC GAS R GCC
Sbjct  61   EMVRLGRPLLLLLDVSSLPDGTAERLSAAWFIYAFIGVGVILFITSIFGCAGAS-RGGCC  119

Query  541  lscysvlvillilvelGAAAFIFFDE  618
            LS YS L+IL ILVEL A  FIFF+ 
Sbjct  120  LSFYSFLIILFILVELAAGGFIFFNH  145



>gb|EEC82932.1| hypothetical protein OsI_27894 [Oryza sativa Indica Group]
Length=305

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-----G  369
            MAC+G  E +LKLLNF++ + GL M+GYG YL V +    PS    P P           
Sbjct  1    MACRGFFEWVLKLLNFVVMVVGLAMMGYGAYLLVAWLQLLPSPPLPPAPAVAPGGGGGGS  60

Query  370  ELVQLGRPMLVAV---SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGAS  522
            E+V+LGRP+L+ +   SL +   + L   WF+Y FIG+GV+LF+ S FGC GAS
Sbjct  61   EMVRLGRPLLLLLDVSSLPDGTAEKLSAAWFIYTFIGVGVILFITSIFGCAGAS  114



>ref|XP_010672322.1| PREDICTED: tobamovirus multiplication protein 2A-like [Beta vulgaris 
subsp. vulgaris]
Length=215

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 8/56 (14%)
 Frame = +1

Query  451  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            F+Y+FIG+GV+LFVISC GCIGAST++G          +  IL+ELG  AF+FFD 
Sbjct  22   FIYMFIGVGVVLFVISCVGCIGASTKDG--------CCLSTILLELGCVAFVFFDR  69



>gb|KCW77897.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=188

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 16/56 (29%)
 Frame = +1

Query  451  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFDE  618
            F++LFIG+GV+LF+ISCFGCIG+ TRN                VELG AAFI+FD+
Sbjct  1    FIFLFIGVGVVLFIISCFGCIGSVTRN----------------VELGCAAFIYFDK  40



>ref|XP_006659854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=250

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 85/140 (61%), Gaps = 25/140 (18%)
 Frame = +1

Query  205  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  384
            MAC+G  E +LKLLNF++ + GL MVGYG YL V +                        
Sbjct  1    MACRGFFEWVLKLLNFVVMVVGLAMVGYGAYLLVVWLQ----------------------  38

Query  385  GRPMLVA--VSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  558
            GRP+L+   VS+++ I + L   WF++ FIG+GV+LF+ S FGC GAS R GCCLS YS 
Sbjct  39   GRPLLLLLDVSMSDGIEERLSSAWFIFTFIGVGVILFITSIFGCSGAS-RGGCCLSFYSF  97

Query  559  lvillilvelGAAAFIFFDE  618
            L+IL ILVEL A  FIFF+ 
Sbjct  98   LIILFILVELAAGGFIFFNH  117



>gb|ACG25649.1| hypothetical protein [Zea mays]
Length=78

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 5/58 (9%)
 Frame = +1

Query  277  MVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEW  450
            MVGYGIYL VE+   S  G         S+ E++  GRP+L AV L ++  DNLPK W
Sbjct  26   MVGYGIYLLVEWMKISEDGIGGA-----STAEVLVSGRPLLGAVILGDSFLDNLPKAW  78



>ref|XP_011083093.1| PREDICTED: tetraspanin-18 [Sesamum indicum]
Length=263

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 68/122 (56%), Gaps = 9/122 (7%)
 Frame = +1

Query  274  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLA--NNI----FDN  435
             MV Y  Y+  ++++    GD+ P P P      + L   ++  ++LA  +N     F +
Sbjct  27   AMVIYSAYMLSQWQHR---GDEFPPPAPSHDVSGIHLSADVVNHLNLALGDNALHVNFHS  83

Query  436  LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilvelGAAAFIFFD  615
            LP  WF+Y F+GIGV++  I+C G I A + NGCCL  Y++L  + +L+E+G  A + FD
Sbjct  84   LPAPWFIYAFMGIGVIICCITCIGNIAAESINGCCLCSYALLTTVFLLLEVGLVALVAFD  143

Query  616  ER  621
              
Sbjct  144  RH  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950