BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF051A22

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011087938.1|  PREDICTED: uncharacterized protein LOC105169271  60.5    3e-09   
emb|CDO97396.1|  unnamed protein product                              59.7    5e-09   Coffea canephora [robusta coffee]
ref|XP_003526532.1|  PREDICTED: uncharacterized protein LOC100816828  59.3    6e-09   
ref|XP_006594677.1|  PREDICTED: uncharacterized protein LOC100815607  59.3    6e-09   
ref|NP_001117513.1|  conserved peptide upstream open reading fram...  59.3    6e-09   
ref|XP_011092448.1|  PREDICTED: uncharacterized protein LOC105172626  59.3    7e-09   
ref|XP_010266138.1|  PREDICTED: uncharacterized protein LOC104603734  58.9    9e-09   
ref|XP_010272927.1|  PREDICTED: uncharacterized protein LOC104608593  58.9    9e-09   
ref|XP_003545714.1|  PREDICTED: uncharacterized protein LOC100775889  58.9    1e-08   
gb|KJB29351.1|  hypothetical protein B456_005G096100                  58.5    2e-08   Gossypium raimondii
ref|XP_007137647.1|  hypothetical protein PHAVU_009G144000g           57.4    4e-08   Phaseolus vulgaris [French bean]
emb|CDY29161.1|  BnaC09g15580D                                        57.0    4e-08   Brassica napus [oilseed rape]
ref|XP_006578261.1|  PREDICTED: uncharacterized protein LOC100789691  56.2    7e-08   
ref|XP_004501629.1|  PREDICTED: uncharacterized protein LOC101506975  55.8    1e-07   
ref|XP_003544825.1|  PREDICTED: uncharacterized protein LOC100804939  55.5    2e-07   
ref|XP_003602935.1|  hypothetical protein MTR_3g100550                59.7    2e-07   
emb|CDP11490.1|  unnamed protein product                              53.9    5e-07   Coffea canephora [robusta coffee]
ref|XP_010664378.1|  PREDICTED: uncharacterized protein LOC100854825  53.9    7e-07   
ref|XP_007226906.1|  hypothetical protein PRUPE_ppa016217mg           58.2    7e-07   
ref|XP_010099469.1|  hypothetical protein L484_011169                 58.2    9e-07   
ref|XP_007141256.1|  hypothetical protein PHAVU_008G180700g           52.4    2e-06   Phaseolus vulgaris [French bean]
ref|XP_008775000.1|  PREDICTED: uncharacterized protein LOC103695444  52.4    2e-06   
ref|XP_007018202.1|  Uncharacterized protein TCM_034490               54.7    1e-05   
ref|XP_003615269.1|  hypothetical protein MTR_5g065970                53.9    2e-05   
ref|XP_003633240.1|  PREDICTED: uncharacterized protein LOC100853920  49.3    3e-05   
ref|XP_004504834.1|  PREDICTED: uncharacterized protein LOC101508056  48.9    4e-05   
ref|XP_002301090.2|  hypothetical protein POPTR_0002s10470g           50.8    2e-04   
emb|CBI19248.3|  unnamed protein product                              50.1    4e-04   Vitis vinifera
ref|XP_008782192.1|  PREDICTED: uncharacterized protein LOC103701796  46.2    4e-04   
gb|AAG50763.1|AC079131_8  hypothetical protein                        49.7    6e-04   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_011087938.1| PREDICTED: uncharacterized protein LOC105169271 [Sesamum indicum]
Length=36

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  RIR+LL LW + RS+RVALVGGNHTAARFC+R
Sbjct  1    MEIARIRQLLLLWCTTRSTRVALVGGNHTAARFCTR  36



>emb|CDO97396.1| unnamed protein product [Coffea canephora]
Length=36

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  RIRELL LW   RS+RVALVGGNHTAARFC+R
Sbjct  1    MEIARIRELLLLWCRARSTRVALVGGNHTAARFCTR  36



>ref|XP_003526532.1| PREDICTED: uncharacterized protein LOC100816828 [Glycine max]
Length=36

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+RELL LWS+++ +RVALVGGNHTAARFC+R
Sbjct  1    MEVQRMRELLKLWSTLQINRVALVGGNHTAARFCTR  36



>ref|XP_006594677.1| PREDICTED: uncharacterized protein LOC100815607 [Glycine max]
Length=36

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME +R+R+L+ +W  +RS+RVALVGGNHTAARFCSR
Sbjct  1    MEVERVRQLMLMWCRIRSNRVALVGGNHTAARFCSR  36



>ref|NP_001117513.1| conserved peptide upstream open reading frame 45 [Arabidopsis 
thaliana]
 gb|AEE33502.1| conserved peptide upstream open reading frame 45 [Arabidopsis 
thaliana]
Length=36

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+R+L++LWS+++SSRV+L GGNHTAARFC+R
Sbjct  1    MEIQRMRQLMSLWSNLKSSRVSLTGGNHTAARFCTR  36



>ref|XP_011092448.1| PREDICTED: uncharacterized protein LOC105172626 [Sesamum indicum]
Length=36

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  RIR+LL LW  +RS+RVALVGGNHTAARFC+R
Sbjct  1    MEIARIRDLLLLWCRIRSNRVALVGGNHTAARFCTR  36



>ref|XP_010266138.1| PREDICTED: uncharacterized protein LOC104603734 [Nelumbo nucifera]
Length=36

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+++L+ LWS +R++RVALVGGNHTAARFC+R
Sbjct  1    MEVQRLKQLMLLWSGMRTTRVALVGGNHTAARFCTR  36



>ref|XP_010272927.1| PREDICTED: uncharacterized protein LOC104608593 [Nelumbo nucifera]
Length=36

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+R+L+ LWS V+S RVALVGGNHTAARFC+R
Sbjct  1    MEVQRMRQLMLLWSGVQSIRVALVGGNHTAARFCTR  36



>ref|XP_003545714.1| PREDICTED: uncharacterized protein LOC100775889 [Glycine max]
Length=36

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME +R+R+L+ +W  +RS+RVALVGGNHTAARFCSR
Sbjct  1    MEVERMRQLMLMWCRIRSNRVALVGGNHTAARFCSR  36



>gb|KJB29351.1| hypothetical protein B456_005G096100 [Gossypium raimondii]
Length=49

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R++ELL LWS  +S+RVALVGGNHTAARFC+R
Sbjct  14   MEVQRMKELLLLWSRFQSNRVALVGGNHTAARFCTR  49



>ref|XP_007137647.1| hypothetical protein PHAVU_009G144000g [Phaseolus vulgaris]
 gb|ESW09641.1| hypothetical protein PHAVU_009G144000g [Phaseolus vulgaris]
Length=36

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+R+LL LWS++++ RVA VGGNHTAARFC+R
Sbjct  1    MEVQRMRDLLTLWSTLKTKRVAHVGGNHTAARFCTR  36



>emb|CDY29161.1| BnaC09g15580D [Brassica napus]
Length=36

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            M  +R+R+L++LWS+++SSRV+L GGNHTAARFC+R
Sbjct  1    MAIERMRQLMSLWSNLKSSRVSLTGGNHTAARFCNR  36



>ref|XP_006578261.1| PREDICTED: uncharacterized protein LOC100789691 [Glycine max]
Length=36

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+RELL LWS+++ + VALVGGNHTAARFC+R
Sbjct  1    MEVLRMRELLTLWSTLQINNVALVGGNHTAARFCTR  36



>ref|XP_004501629.1| PREDICTED: uncharacterized protein LOC101506975 [Cicer arietinum]
Length=36

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+R L+ LWSS++ +RVALVGGNHTA+RFC+R
Sbjct  1    MEVQRMRALMTLWSSLQINRVALVGGNHTASRFCTR  36



>ref|XP_003544825.1| PREDICTED: uncharacterized protein LOC100804939 [Glycine max]
Length=36

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+RELL LWSS  S  ++LVGGNHTAARFC+R
Sbjct  1    MEMQRMRELLLLWSSFESEGMSLVGGNHTAARFCTR  36



>ref|XP_003602935.1| hypothetical protein MTR_3g100550 [Medicago truncatula]
 gb|AES73186.1| peptide upstream ORF protein [Medicago truncatula]
Length=419

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCS  239
            MEF R++EL+ LWSS++ +RVALVGGNHTA+RFC+
Sbjct  1    MEFQRMKELMTLWSSLQINRVALVGGNHTASRFCT  35



>emb|CDP11490.1| unnamed protein product [Coffea canephora]
Length=36

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  RI+ELL L + ++S+RV+LVGGNHTAARFC+R
Sbjct  1    MEVQRIQELLLLCTRLQSNRVSLVGGNHTAARFCTR  36



>ref|XP_010664378.1| PREDICTED: uncharacterized protein LOC100854825 [Vitis vinifera]
Length=40

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  RI+ L+  W  V+S+RVALVGGNHTAARFC+R
Sbjct  5    MEGQRIKNLMLPWFRVKSTRVALVGGNHTAARFCTR  40



>ref|XP_007226906.1| hypothetical protein PRUPE_ppa016217mg [Prunus persica]
 gb|EMJ28105.1| hypothetical protein PRUPE_ppa016217mg [Prunus persica]
Length=416

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCS  239
            ME  R+R+L+ LWS ++S+RVALVGGNHTAARFC+
Sbjct  1    MEVQRMRQLMLLWSRIQSNRVALVGGNHTAARFCT  35



>ref|XP_010099469.1| hypothetical protein L484_011169 [Morus notabilis]
 gb|EXB78544.1| hypothetical protein L484_011169 [Morus notabilis]
Length=496

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARF  233
            MEF RIR+LL LW  +RS+RVALVGGNHTAARF
Sbjct  1    MEFQRIRQLLFLWCRIRSTRVALVGGNHTAARF  33



>ref|XP_007141256.1| hypothetical protein PHAVU_008G180700g [Phaseolus vulgaris]
 gb|ESW13250.1| hypothetical protein PHAVU_008G180700g [Phaseolus vulgaris]
Length=36

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R+RELL+L  S  S R++LVGGNHTAARFC+R
Sbjct  1    MEMQRMRELLSLVLSFESKRMSLVGGNHTAARFCTR  36



>ref|XP_008775000.1| PREDICTED: uncharacterized protein LOC103695444 [Phoenix dactylifera]
Length=36

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME +R+R+L+ LW+   S+RV LVGGNHTAARFC+R
Sbjct  1    MEAERMRQLMLLWARSFSTRVGLVGGNHTAARFCTR  36



>ref|XP_007018202.1| Uncharacterized protein TCM_034490 [Theobroma cacao]
 gb|EOY15427.1| Uncharacterized protein TCM_034490 [Theobroma cacao]
Length=454

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCS  239
            ME  RIR+L+ LWS ++SSRVALVGGNHTAAR  S
Sbjct  1    MEVQRIRQLMLLWSRLQSSRVALVGGNHTAARLLS  35



>ref|XP_003615269.1| hypothetical protein MTR_5g065970 [Medicago truncatula]
Length=478

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCS  239
            ME  R++ELL+L  + +S+RVALVGGNHTAARFCS
Sbjct  1    MEIQRMKELLSLLLAFKSNRVALVGGNHTAARFCS  35



>ref|XP_003633240.1| PREDICTED: uncharacterized protein LOC100853920 [Vitis vinifera]
Length=36

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  R  +L+ L+  ++S+RVALVGGNHT++RFC+R
Sbjct  1    MEPQRFTQLMLLYCRIQSTRVALVGGNHTSSRFCTR  36



>ref|XP_004504834.1| PREDICTED: uncharacterized protein LOC101508056 [Cicer arietinum]
Length=36

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME +R+++L+ L    +S+RVALVGGNHT ARFC+R
Sbjct  1    MEEERVKQLMLLSFGKQSTRVALVGGNHTTARFCTR  36



>ref|XP_002301090.2| hypothetical protein POPTR_0002s10470g [Populus trichocarpa]
 gb|EEE80363.2| hypothetical protein POPTR_0002s10470g [Populus trichocarpa]
Length=384

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAAR  230
            ME  R+R+L+ LWS ++S+RVALVGGNHTAAR
Sbjct  1    MEVQRLRQLMLLWSRIQSTRVALVGGNHTAAR  32



>emb|CBI19248.3| unnamed protein product [Vitis vinifera]
Length=358

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR*IFV  254
            ME  RI+ L+  W  V+S+RVALVGGNHTAARF    +F+
Sbjct  1    MEGQRIKNLMLPWFRVKSTRVALVGGNHTAARFPDSGLFL  40



>ref|XP_008782192.1| PREDICTED: uncharacterized protein LOC103701796 [Phoenix dactylifera]
Length=36

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAARFCSR  242
            ME  RI++++ L     S+R ALVGGNHTAARFC+R
Sbjct  1    MEARRIKQMMLLSLRTPSARAALVGGNHTAARFCTR  36



>gb|AAG50763.1|AC079131_8 hypothetical protein [Arabidopsis thaliana]
Length=420

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  135  MEFDRIRELLALWSSVRSSRVALVGGNHTAA  227
            ME  R+R+L++LWS+++SSRV+L GGNHTAA
Sbjct  1    MEIQRMRQLMSLWSNLKSSRVSLTGGNHTAA  31



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925