BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050P23

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776114.1|  PREDICTED: guanine nucleotide-binding protei...    328   4e-109   Nicotiana sylvestris
emb|CAA96528.1|  G protein beta-subunit-like protein                    326   2e-108   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABB86277.1|  ArcA2 protein-like                                      326   2e-108   Solanum tuberosum [potatoes]
ref|XP_009600162.1|  PREDICTED: guanine nucleotide-binding protei...    326   3e-108   Nicotiana tomentosiformis
ref|XP_006341557.1|  PREDICTED: guanine nucleotide-binding protei...    326   3e-108   
gb|AJE63428.1|  transcription factor ArcA1                              323   2e-107   Capsicum annuum
ref|NP_001233881.1|  ArcA2 protein                                      323   3e-107   
ref|XP_009624187.1|  PREDICTED: guanine nucleotide-binding protei...    322   6e-107   Nicotiana tomentosiformis
ref|XP_004252271.1|  PREDICTED: guanine nucleotide-binding protei...    319   3e-106   Solanum lycopersicum
ref|XP_009778426.1|  PREDICTED: guanine nucleotide-binding protei...    320   7e-106   Nicotiana sylvestris
ref|XP_006353816.1|  PREDICTED: guanine nucleotide-binding protei...    319   1e-105   Solanum tuberosum [potatoes]
ref|XP_004252270.1|  PREDICTED: guanine nucleotide-binding protei...    319   1e-105   Solanum lycopersicum
ref|NP_001233876.1|  ArcA1 protein                                      318   2e-105   
sp|P49026.1|GBLP_TOBAC  RecName: Full=Guanine nucleotide-binding ...    318   2e-105   Nicotiana tabacum [American tobacco]
ref|XP_006365404.1|  PREDICTED: guanine nucleotide-binding protei...    318   3e-105   Solanum tuberosum [potatoes]
ref|XP_009611065.1|  PREDICTED: guanine nucleotide-binding protei...    318   4e-105   Nicotiana tomentosiformis
ref|XP_009780116.1|  PREDICTED: guanine nucleotide-binding protei...    318   4e-105   Nicotiana sylvestris
sp|P93340.1|GBLP_NICPL  RecName: Full=Guanine nucleotide-binding ...    317   6e-105   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011084467.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    313   1e-103   Sesamum indicum [beniseed]
gb|ACR77528.1|  heterotrimeric G protein beta 1 subunit                 313   2e-103   Nicotiana benthamiana
gb|EYU40229.1|  hypothetical protein MIMGU_mgv1a008949mg                311   3e-102   Erythranthe guttata [common monkey flower]
gb|EYU17645.1|  hypothetical protein MIMGU_mgv1a009858mg                310   4e-102   Erythranthe guttata [common monkey flower]
ref|XP_011072970.1|  PREDICTED: guanine nucleotide-binding protei...    310   7e-102   Sesamum indicum [beniseed]
gb|KHG17882.1|  Guanine nucleotide-binding protein subunit beta-l...    307   7e-101   Gossypium arboreum [tree cotton]
gb|KJB53022.1|  hypothetical protein B456_008G288800                    306   1e-100   Gossypium raimondii
gb|ACJ85349.1|  unknown                                                 305   1e-100   Medicago truncatula
gb|ACJ85009.1|  unknown                                                 302   2e-100   Medicago truncatula
gb|KJB37175.1|  hypothetical protein B456_006G192600                    306   2e-100   Gossypium raimondii
ref|XP_004503304.1|  PREDICTED: guanine nucleotide-binding protei...    305   2e-100   Cicer arietinum [garbanzo]
ref|XP_003631071.1|  Guanine nucleotide-binding protein subunit b...    305   2e-100   Medicago truncatula
gb|KHG00880.1|  Guanine nucleotide-binding protein subunit beta-l...    305   2e-100   Gossypium arboreum [tree cotton]
gb|AFK36580.1|  unknown                                                 305   2e-100   Medicago truncatula
gb|KDP37901.1|  hypothetical protein JCGZ_05340                         305   5e-100   Jatropha curcas
ref|XP_002281279.1|  PREDICTED: guanine nucleotide-binding protei...    304   6e-100   Vitis vinifera
ref|XP_006451669.1|  hypothetical protein CICLE_v10008909mg             304   7e-100   Citrus clementina [clementine]
ref|XP_011039103.1|  PREDICTED: guanine nucleotide-binding protei...    304   1e-99    Populus euphratica
ref|XP_007036696.1|  Transducin/WD40 repeat-like superfamily protein    303   1e-99    Theobroma cacao [chocolate]
ref|XP_011039104.1|  PREDICTED: guanine nucleotide-binding protei...    303   1e-99    Populus euphratica
ref|NP_001241455.1|  uncharacterized protein LOC100778205               303   2e-99    Glycine max [soybeans]
ref|NP_001235369.1|  guanine nucleotide-binding protein subunit b...    303   2e-99    Glycine max [soybeans]
gb|AGV54321.1|  RACK1                                                   303   2e-99    Phaseolus vulgaris [French bean]
ref|XP_007160506.1|  hypothetical protein PHAVU_002G327500g             303   2e-99    Phaseolus vulgaris [French bean]
ref|XP_002318528.1|  GTP-binding protein beta chain                     303   3e-99    Populus trichocarpa [western balsam poplar]
sp|O24076.1|GBLP_MEDSA  RecName: Full=Guanine nucleotide-binding ...    302   4e-99    Medicago sativa [alfalfa]
ref|XP_002321505.1|  GTP-binding protein beta chain                     302   4e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010678120.1|  PREDICTED: guanine nucleotide-binding protei...    302   4e-99    Beta vulgaris subsp. vulgaris [field beet]
emb|CDO98381.1|  unnamed protein product                                324   4e-99    Coffea canephora [robusta coffee]
ref|XP_011000479.1|  PREDICTED: guanine nucleotide-binding protei...    302   4e-99    Populus euphratica
gb|KHG29145.1|  Guanine nucleotide-binding protein subunit beta-l...    302   6e-99    Gossypium arboreum [tree cotton]
gb|ACJ24167.1|  Rack                                                    301   7e-99    Phaseolus vulgaris [French bean]
ref|XP_004299548.1|  PREDICTED: guanine nucleotide-binding protei...    301   7e-99    Fragaria vesca subsp. vesca
ref|XP_002529557.1|  receptor for activated protein kinase C, put...    300   2e-98    Ricinus communis
gb|KJB08186.1|  hypothetical protein B456_001G069800                    299   6e-98    Gossypium raimondii
ref|XP_008240184.1|  PREDICTED: guanine nucleotide-binding protei...    299   1e-97    Prunus mume [ume]
ref|XP_010032559.1|  PREDICTED: guanine nucleotide-binding protei...    298   2e-97    Eucalyptus grandis [rose gum]
gb|AFV60006.1|  heterotrimeric guanine nucleotide-binding protein...    297   4e-97    Eschscholzia californica
ref|XP_007209348.1|  hypothetical protein PRUPE_ppa008536mg             297   5e-97    Prunus persica
ref|XP_010036939.1|  PREDICTED: guanine nucleotide-binding protei...    297   5e-97    Eucalyptus grandis [rose gum]
ref|XP_004137327.1|  PREDICTED: guanine nucleotide-binding protei...    296   9e-97    Cucumis sativus [cucumbers]
gb|KFK43977.1|  guanine nucleotide-binding protein subunit beta-l...    296   1e-96    Arabis alpina [alpine rockcress]
ref|XP_009117627.1|  PREDICTED: guanine nucleotide-binding protei...    296   1e-96    Brassica rapa
ref|XP_008453452.1|  PREDICTED: guanine nucleotide-binding protei...    296   1e-96    Cucumis melo [Oriental melon]
ref|XP_008374821.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    296   2e-96    Malus domestica [apple tree]
emb|CBI15540.3|  unnamed protein product                                316   2e-96    Vitis vinifera
ref|XP_009360100.1|  PREDICTED: guanine nucleotide-binding protei...    295   2e-96    Pyrus x bretschneideri [bai li]
ref|XP_010487724.1|  PREDICTED: guanine nucleotide-binding protei...    295   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_008393404.1|  PREDICTED: guanine nucleotide-binding protei...    295   4e-96    Malus domestica [apple tree]
ref|XP_010243791.1|  PREDICTED: guanine nucleotide-binding protei...    294   5e-96    Nelumbo nucifera [Indian lotus]
ref|XP_010506450.1|  PREDICTED: guanine nucleotide-binding protei...    294   5e-96    Camelina sativa [gold-of-pleasure]
ref|XP_006837182.1|  hypothetical protein AMTR_s00105p00058690          293   9e-96    Amborella trichopoda
ref|XP_010256121.1|  PREDICTED: guanine nucleotide-binding protei...    293   1e-95    Nelumbo nucifera [Indian lotus]
emb|CDX92200.1|  BnaA05g22070D                                          293   2e-95    
dbj|BAH56896.1|  AT1G18080                                              291   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149259.1|  PREDICTED: guanine nucleotide-binding protei...    293   2e-95    Brassica rapa
ref|NP_188441.1|  receptor for activated C kinase 1C                    293   2e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CDX95784.1|  BnaC05g35350D                                          293   2e-95    
emb|CDY18497.1|  BnaA01g26980D                                          292   3e-95    Brassica napus [oilseed rape]
ref|XP_010097592.1|  Guanine nucleotide-binding protein subunit b...    292   3e-95    Morus notabilis
ref|XP_006416642.1|  hypothetical protein EUTSA_v10008183mg             292   4e-95    Eutrema salsugineum [saltwater cress]
ref|XP_002890259.1|  hypothetical protein ARALYDRAFT_889221             292   5e-95    Arabidopsis lyrata subsp. lyrata
gb|EPS70887.1|  hypothetical protein M569_03871                         292   6e-95    Genlisea aurea
ref|XP_006297909.1|  hypothetical protein CARUB_v10013951mg             293   6e-95    
ref|XP_010498185.1|  PREDICTED: guanine nucleotide-binding protei...    292   6e-95    Camelina sativa [gold-of-pleasure]
gb|AAB82647.1|  WD-40 repeat protein                                    291   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_173248.1|  guanine nucleotide-binding protein subunit beta...    291   7e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923802.1|  PREDICTED: guanine nucleotide-binding protei...    291   7e-95    Elaeis guineensis
ref|XP_010476972.1|  PREDICTED: guanine nucleotide-binding protei...    291   9e-95    Camelina sativa [gold-of-pleasure]
emb|CDX95554.1|  BnaC01g34460D                                          291   1e-94    
ref|XP_010924141.1|  PREDICTED: guanine nucleotide-binding protei...    291   1e-94    Elaeis guineensis
ref|XP_010500401.1|  PREDICTED: guanine nucleotide-binding protei...    291   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009110365.1|  PREDICTED: guanine nucleotide-binding protei...    291   2e-94    Brassica rapa
ref|XP_010479287.1|  PREDICTED: guanine nucleotide-binding protei...    290   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009145932.1|  PREDICTED: guanine nucleotide-binding protei...    290   2e-94    Brassica rapa
ref|XP_010461692.1|  PREDICTED: guanine nucleotide-binding protei...    290   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002894122.1|  hypothetical protein ARALYDRAFT_474002             290   2e-94    
ref|XP_002885240.1|  guanine nucleotide-binding family protein          290   3e-94    Arabidopsis lyrata subsp. lyrata
gb|AAM65407.1|  guanine nucleotide-binding protein, putative            290   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175296.1|  receptor for activated C kinase 1B                    290   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803271.1|  PREDICTED: guanine nucleotide-binding protei...    290   3e-94    Phoenix dactylifera
ref|XP_010916329.1|  PREDICTED: guanine nucleotide-binding protei...    290   4e-94    Elaeis guineensis
ref|XP_006305339.1|  hypothetical protein CARUB_v10009720mg             290   5e-94    Capsella rubella
sp|Q39336.1|GBLP_BRANA  RecName: Full=Guanine nucleotide-binding ...    289   6e-94    Brassica napus [oilseed rape]
gb|KFK39137.1|  guanine nucleotide-binding protein subunit beta-l...    289   7e-94    Arabis alpina [alpine rockcress]
ref|XP_010540016.1|  PREDICTED: guanine nucleotide-binding protei...    289   8e-94    Tarenaya hassleriana [spider flower]
ref|XP_006406649.1|  hypothetical protein EUTSA_v10021128mg             289   9e-94    Eutrema salsugineum [saltwater cress]
ref|XP_010537487.1|  PREDICTED: guanine nucleotide-binding protei...    288   1e-93    Tarenaya hassleriana [spider flower]
ref|XP_009380503.1|  PREDICTED: guanine nucleotide-binding protei...    288   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010465892.1|  PREDICTED: guanine nucleotide-binding protei...    288   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_009400497.1|  PREDICTED: guanine nucleotide-binding protei...    287   3e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405003.1|  PREDICTED: guanine nucleotide-binding protei...    287   4e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006305354.1|  hypothetical protein CARUB_v10009733mg             287   4e-93    Capsella rubella
gb|ABK26798.1|  unknown                                                 285   2e-92    Picea sitchensis
ref|XP_006393380.1|  hypothetical protein EUTSA_v10011646mg             285   3e-92    Eutrema salsugineum [saltwater cress]
ref|XP_010549078.1|  PREDICTED: guanine nucleotide-binding protei...    284   5e-92    Tarenaya hassleriana [spider flower]
ref|XP_001780288.1|  predicted protein                                  283   1e-91    
ref|XP_010926201.1|  PREDICTED: guanine nucleotide-binding protei...    281   4e-91    Elaeis guineensis
ref|XP_008812615.1|  PREDICTED: guanine nucleotide-binding protei...    281   6e-91    
ref|XP_009113515.1|  PREDICTED: guanine nucleotide-binding protei...    281   8e-91    Brassica rapa
ref|XP_008811978.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    281   8e-91    Phoenix dactylifera
ref|XP_001779496.1|  predicted protein                                  280   1e-90    
ref|XP_010549077.1|  PREDICTED: guanine nucleotide-binding protei...    281   1e-90    Tarenaya hassleriana [spider flower]
ref|XP_010551145.1|  PREDICTED: guanine nucleotide-binding protei...    280   1e-90    Tarenaya hassleriana [spider flower]
pdb|3DM0|A  Chain A, Maltose Binding Protein Fusion With Rack1 Fr...    291   2e-90    Escherichia coli K-12
ref|XP_001754916.1|  predicted protein                                  279   3e-90    
ref|XP_009145001.1|  PREDICTED: guanine nucleotide-binding protei...    279   4e-90    Brassica rapa
gb|ABK25010.1|  unknown                                                 275   2e-88    Picea sitchensis
gb|ACN41093.1|  unknown                                                 275   2e-88    Picea sitchensis
ref|XP_009147950.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    275   2e-88    Brassica rapa
ref|XP_001421096.1|  Receptor of activated protein kinase C 1A, c...    270   1e-86    Ostreococcus lucimarinus CCE9901
emb|CEG00110.1|  G-protein beta WD-40 repeat                            269   4e-86    Ostreococcus tauri
ref|XP_004969582.1|  PREDICTED: guanine nucleotide-binding protei...    268   1e-85    Setaria italica
ref|NP_001056254.1|  Os05g0552300                                       266   1e-84    
emb|CAA06154.1|  arcA 3                                                 264   1e-84    Nicotiana tabacum [American tobacco]
ref|NP_001043910.1|  Os01g0686800                                       265   2e-84    
ref|XP_006654750.1|  PREDICTED: guanine nucleotide-binding protei...    265   3e-84    Oryza brachyantha
ref|XP_007508318.1|  predicted protein                                  264   3e-84    Bathycoccus prasinos
ref|XP_003567944.1|  PREDICTED: guanine nucleotide-binding protei...    264   5e-84    Brachypodium distachyon [annual false brome]
gb|AEN80883.1|  AT1G18080-like protein                                  259   6e-84    Capsella rubella
gb|ABA01155.1|  G protein beta subunit-like polypeptide                 260   2e-83    Chlamydomonas incerta
ref|XP_003060952.1|  predicted protein                                  261   4e-83    Micromonas pusilla CCMP1545
gb|ADG37904.1|  AT1G18080-like protein                                  256   6e-83    Neslia paniculata [ball mustard]
gb|ABA01128.1|  G protein beta subunit-like polypeptide                 259   6e-83    Chlamydomonas incerta
ref|XP_002456166.1|  hypothetical protein SORBIDRAFT_03g031520          260   1e-82    Sorghum bicolor [broomcorn]
ref|XP_001698065.1|  receptor of activated protein kinase C 1           259   2e-82    Chlamydomonas reinhardtii
ref|NP_001146976.1|  LOC100280585                                       259   3e-82    Zea mays [maize]
gb|ADG37898.1|  AT1G18080-like protein                                  254   3e-82    Capsella grandiflora
gb|ADG37903.1|  AT1G18080-like protein                                  254   5e-82    Capsella grandiflora
gb|KIY98327.1|  Guanine nucleotide-binding protein subunit beta-l...    258   5e-82    Monoraphidium neglectum
ref|NP_001136800.1|  guanine nucleotide-binding protein beta subu...    259   6e-82    Zea mays [maize]
ref|XP_002502835.1|  predicted protein                                  258   6e-82    Micromonas commoda
ref|XP_002945887.1|  hypothetical protein VOLCADRAFT_78914              258   1e-81    Volvox carteri f. nagariensis
gb|ACL54313.1|  unknown                                                 258   2e-81    Zea mays [maize]
gb|EMT31237.1|  hypothetical protein F775_29537                         256   2e-81    
ref|XP_006644561.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    257   2e-81    Oryza brachyantha
emb|CDM83867.1|  unnamed protein product                                257   3e-81    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ98167.1|  predicted protein                                      256   4e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002440202.1|  hypothetical protein SORBIDRAFT_09g027690          256   5e-81    Sorghum bicolor [broomcorn]
ref|XP_002960209.1|  hypothetical protein SELMODRAFT_266532             255   7e-81    
ref|XP_002967499.1|  hypothetical protein SELMODRAFT_144795             255   7e-81    Selaginella moellendorffii
emb|CBN79872.2|  guanine nucleotide binding protein beta polypept...    250   2e-80    Ectocarpus siliculosus
ref|XP_004961307.1|  PREDICTED: guanine nucleotide-binding protei...    254   2e-80    Setaria italica
ref|XP_005652002.1|  WD40 repeat-like protein                           254   2e-80    Coccomyxa subellipsoidea C-169
dbj|BAJ90663.1|  predicted protein                                      253   7e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003082627.1|  GTP-binding regulatory protein beta chain ho...    258   8e-80    
gb|AEF79971.1|  receptor of activated protein kinase C 1                253   1e-79    Dunaliella salina
ref|XP_005703361.1|  hypothetical protein Gasu_55280                    251   3e-79    Galdieria sulphuraria
ref|XP_003569582.1|  PREDICTED: guanine nucleotide-binding protei...    252   3e-79    Brachypodium distachyon [annual false brome]
gb|AEO44580.1|  receptor for activated C kinase 1                       251   5e-79    Dunaliella salina
gb|KDO62873.1|  hypothetical protein CISIN_1g048118mg                   249   1e-78    Citrus sinensis [apfelsine]
ref|XP_009836542.1|  guanine nucleotide-binding protein subunit b...    248   5e-78    Aphanomyces astaci
gb|ABC75581.1|  guanine nucleotide binding protein beta 2               245   5e-78    Ictalurus punctatus
dbj|BAC56715.1|  receptor for activated protein kinase C homolog        246   2e-77    Mamestra brassicae
ref|NP_001187435.1|  guanine nucleotide-binding protein subunit b...    246   3e-77    Ictalurus punctatus
gb|EXX68230.1|  Asc1p                                                   246   4e-77    Rhizophagus irregularis DAOM 197198w
ref|XP_005072032.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-77    
gb|ESA03866.1|  hypothetical protein GLOINDRAFT_336518                  246   5e-77    
gb|AAT01086.1|  putative activated protein kinase C receptor            246   5e-77    Homalodisca vitripennis
emb|CDX81860.1|  BnaC08g37410D                                          243   8e-77    
ref|XP_011334834.1|  PREDICTED: guanine nucleotide-binding protei...    245   1e-76    Ooceraea biroi
ref|XP_011049912.1|  PREDICTED: guanine nucleotide-binding protei...    244   1e-76    Acromyrmex echinatior
emb|CDY21720.1|  BnaA09g44710D                                          242   1e-76    Brassica napus [oilseed rape]
gb|AAM88902.1|  guanine nucleotide-binding protein                      243   1e-76    Branchiostoma lanceolatum [common lancelet]
gb|ADO33039.1|  receptor for activated protein kinase C RACK isof...    244   1e-76    Biston betularia [peppered moth]
ref|NP_001041703.1|  receptor for activated protein kinase C RACK...    244   1e-76    Bombyx mori [silk moth]
ref|NP_001291517.1|  guanine nucleotide-binding protein subunit b...    244   1e-76    Solenopsis invicta [imported red fire ant]
ref|XP_007244608.1|  PREDICTED: guanine nucleotide-binding protei...    244   1e-76    Astyanax mexicanus [blind cave fish]
gb|AAZ29605.1|  activated C kinase 1 receptor                           244   1e-76    Choristoneura fumiferana [spruce budworm]
ref|XP_011145304.1|  PREDICTED: guanine nucleotide-binding protei...    244   1e-76    Harpegnathos saltator
ref|XP_008873892.1|  guanine nucleotide-binding protein subunit b...    244   1e-76    Aphanomyces invadans
gb|AEB26318.1|  receptor for activated protein kinase C                 244   1e-76    Helicoverpa armigera [American bollworm]
gb|ACR19030.1|  receptor for activated protein kinase C                 244   1e-76    Bombyx mori [silk moth]
dbj|BAM17717.1|  receptor of activated protein kinase C 1               244   2e-76    Papilio xuthus [Chinese swallowtail]
emb|CAG01204.1|  unnamed protein product                                244   2e-76    Tetraodon nigroviridis
emb|CDY60778.1|  BnaC05g50130D                                          241   2e-76    Brassica napus [oilseed rape]
dbj|BAD52259.1|  receptor for activated protein kinase C homolog        244   2e-76    Plutella xylostella [cabbage moth]
emb|CDY26186.1|  BnaA06g12310D                                          241   3e-76    Brassica napus [oilseed rape]
gb|KDR18184.1|  Guanine nucleotide-binding protein subunit beta-l...    244   3e-76    Zootermopsis nevadensis
gb|ABX55886.1|  activated C kinase 1 receptor                           244   3e-76    Spodoptera exigua [pigweed caterpillar]
ref|XP_004697224.1|  PREDICTED: guanine nucleotide-binding protei...    241   3e-76    Echinops telfairi [lesser hedgehog tenrec]
gb|ACO09909.1|  Guanine nucleotide-binding protein subunit beta 2...    243   4e-76    Osmerus mordax
gb|EHJ73733.1|  receptor for activated protein kinase C-like protein    243   4e-76    
gb|AGM32571.1|  WD40 domain containing protein                          242   4e-76    Coptotermes formosanus
ref|XP_003394799.1|  PREDICTED: guanine nucleotide-binding protei...    243   5e-76    Bombus terrestris [large earth bumblebee]
gb|KDO19117.1|  guanine nucleotide-binding protein subunit beta-2...    243   5e-76    Saprolegnia parasitica CBS 223.65
ref|XP_392962.1|  PREDICTED: receptor of activated protein kinase...    243   6e-76    Apis mellifera [bee]
ref|XP_011259045.1|  PREDICTED: guanine nucleotide-binding protei...    243   6e-76    Camponotus floridanus
gb|AAX54700.1|  receptor of activated protein kinase C 1                243   6e-76    Branchiostoma belcheri tsingtauense
pdb|4AOW|A  Chain A, Crystal Structure Of The Human Rack1 Protein...    243   6e-76    Homo sapiens [man]
ref|XP_008608530.1|  guanine nucleotide-binding protein subunit b...    243   6e-76    Saprolegnia diclina VS20
gb|ACV53651.1|  guanine nucleotide-binding protein beta polypepti...    243   6e-76    Paramisgurnus dabryanus
ref|XP_002735015.1|  PREDICTED: guanine nucleotide-binding protei...    243   7e-76    Saccoglossus kowalevskii
ref|NP_001266445.1|  guanine nucleotide-binding protein subunit b...    242   8e-76    Oreochromis niloticus
ref|XP_004540947.1|  PREDICTED: guanine nucleotide-binding protei...    242   8e-76    Maylandia zebra
gb|ACQ83470.1|  receptor of activated protein kinase C                  242   9e-76    Platynereis dumerilii
gb|ADO27998.1|  guanine nucleotide-binding protein subunit beta-2...    242   1e-75    Ictalurus furcatus
ref|XP_005711409.1|  receptor for activated protein kinase C            242   1e-75    Chondrus crispus [carageen]
gb|ACH70647.1|  guanine nucleotide binding protein (G protein) be...    242   1e-75    Salmo salar
ref|XP_001631784.1|  predicted protein                                  242   1e-75    Nematostella vectensis
ref|XP_001600152.1|  PREDICTED: guanine nucleotide-binding protei...    242   1e-75    Nasonia vitripennis
gb|ABI63548.1|  receptor for activated protein kinase C-like            242   1e-75    Blattella germanica
ref|XP_006679085.1|  hypothetical protein BATDEDRAFT_33248              242   1e-75    Batrachochytrium dendrobatidis JAM81
gb|AHG98209.1|  guanine nucleotide-binding protein subunit beta-2...    242   1e-75    Oncorhynchus mykiss
ref|NP_571519.1|  guanine nucleotide-binding protein subunit beta...    242   1e-75    Danio rerio [leopard danio]
ref|NP_001086465.1|  uncharacterized protein LOC446289                  242   1e-75    Xenopus laevis [clawed frog]
gb|AAI50408.1|  Guanine nucleotide binding protein (G protein), b...    242   1e-75    Danio rerio [leopard danio]
ref|XP_009037831.1|  hypothetical protein AURANDRAFT_37768              242   1e-75    Aureococcus anophagefferens
ref|XP_003970442.1|  PREDICTED: guanine nucleotide-binding protei...    242   1e-75    Takifugu rubripes [tiger puffer]
ref|XP_004343796.1|  guanine nucleotide-binding protein                 242   2e-75    Capsaspora owczarzaki ATCC 30864
emb|CDX96736.1|  BnaA08g22790D                                          239   2e-75    
ref|XP_004341795.1|  guanine nucleotide-binding protein beta subu...    242   2e-75    Acanthamoeba castellanii str. Neff
emb|CDX83869.1|  BnaC08g17760D                                          239   2e-75    
ref|XP_011301856.1|  PREDICTED: guanine nucleotide-binding protei...    241   2e-75    Fopius arisanus
ref|XP_006631768.1|  PREDICTED: guanine nucleotide-binding protei...    241   2e-75    Lepisosteus oculatus
gb|ACN10148.1|  Guanine nucleotide-binding protein subunit beta-2...    241   2e-75    Salmo salar
ref|XP_008550735.1|  PREDICTED: guanine nucleotide-binding protei...    238   2e-75    
ref|XP_009448629.1|  PREDICTED: guanine nucleotide-binding protei...    241   3e-75    
emb|CEG67117.1|  Putative Guanine nucleotide-binding protein subu...    241   3e-75    Rhizopus microsporus
dbj|BAE93065.1|  guanine nucleotide binding protein beta polypept...    241   3e-75    Lethenteron camtschaticum [Japanese lamprey]
ref|XP_008955163.1|  PREDICTED: guanine nucleotide-binding protei...    241   3e-75    
ref|XP_005847990.1|  hypothetical protein CHLNCDRAFT_31033              241   3e-75    Chlorella variabilis
gb|AAU84924.1|  putative activated protein kinase C receptor            241   3e-75    Aphis citricidus
tpg|DAA27596.1|  TPA: guanine nucleotide-binding protein subunit ...    240   3e-75    Bos taurus [bovine]
gb|EIE76651.1|  guanine nucleotide-binding protein subunit beta-2...    241   3e-75    Rhizopus delemar RA 99-880
ref|NP_001004946.1|  guanine nucleotide binding protein (G protei...    241   3e-75    Xenopus tropicalis [western clawed frog]
ref|XP_004073369.1|  PREDICTED: guanine nucleotide-binding protei...    241   3e-75    Oryzias latipes [Japanese rice fish]
ref|NP_001280259.1|  guanine nucleotide-binding protein subunit b...    241   3e-75    Acyrthosiphon pisum
ref|XP_004780256.1|  PREDICTED: guanine nucleotide-binding protei...    241   3e-75    Mustela putorius furo [black ferret]
ref|XP_010780163.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-75    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006987199.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-75    
ref|XP_003701723.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-75    Megachile rotundata
gb|KFO76552.1|  Guanine nucleotide-binding protein subunit beta-2...    241   4e-75    Cuculus canorus
gb|AAG29506.1|  activated protein kinase C receptor                     240   4e-75    Mus musculus [mouse]
gb|AAZ29606.1|  activated C kinase 1 receptor                           241   4e-75    Choristoneura fumiferana [spruce budworm]
ref|XP_002613759.1|  hypothetical protein BRAFLDRAFT_84515              240   5e-75    Branchiostoma floridae
gb|AAA18951.1|  protein kinase C receptor                               240   5e-75    Rattus norvegicus [brown rat]
dbj|BAA06185.1|  G protein beta subuit like                             240   5e-75    Mus musculus [mouse]
ref|XP_005534099.1|  PREDICTED: guanine nucleotide-binding protei...    240   5e-75    Pseudopodoces humilis [Tibetan ground-jay]
ref|NP_006089.1|  guanine nucleotide-binding protein subunit beta...    240   5e-75    Homo sapiens [man]
ref|XP_007229955.1|  PREDICTED: guanine nucleotide-binding protei...    240   5e-75    
gb|AAP36938.1|  Homo sapiens guanine nucleotide binding protein (...    240   5e-75    synthetic construct
dbj|BAE35378.1|  unnamed protein product                                240   5e-75    Mus musculus [mouse]
dbj|BAD96208.1|  guanine nucleotide binding protein (G protein), ...    240   5e-75    Homo sapiens [man]
ref|XP_007431363.1|  PREDICTED: guanine nucleotide-binding protei...    240   5e-75    Python bivittatus
gb|AAK51552.1|AF368031_1  receptor for activated protein kinase C...    240   6e-75    Heliothis virescens
emb|CCQ18636.1|  G protein beta subunit-like protein                    240   7e-75    Sycon ciliatum
gb|EFX70343.1|  hypothetical protein DAPPUDRAFT_231635                  240   7e-75    Daphnia pulex
ref|XP_002903189.1|  guanine nucleotide-binding protein subunit b...    240   8e-75    Phytophthora infestans T30-4
gb|AAO21313.1|  lung cancer oncogene 7                                  241   8e-75    Homo sapiens [man]
gb|EAW53696.1|  guanine nucleotide binding protein (G protein), b...    241   9e-75    Homo sapiens [man]
ref|XP_008325350.1|  PREDICTED: guanine nucleotide-binding protei...    239   9e-75    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_973579.1|  PREDICTED: guanine nucleotide-binding protein s...    239   1e-74    Tribolium castaneum [rust-red flour beetle]
gb|ABX90099.1|  receptor for activated C kinase 1                       239   1e-74    Sander vitreus
ref|XP_007548404.1|  PREDICTED: guanine nucleotide-binding protei...    239   1e-74    Poecilia formosa
ref|XP_005862397.1|  PREDICTED: guanine nucleotide-binding protei...    241   1e-74    
ref|XP_006766909.1|  PREDICTED: guanine nucleotide-binding protei...    241   1e-74    
ref|NP_001279371.1|  uncharacterized protein LOC103175775               239   1e-74    Callorhinchus milii [Australian ghost shark]
ref|XP_001663282.1|  AAEL013069-PA                                      239   1e-74    Aedes aegypti
gb|ETM44908.1|  guanine nucleotide-binding protein subunit beta-l...    240   1e-74    Phytophthora parasitica
ref|XP_008681951.1|  PREDICTED: guanine nucleotide-binding protei...    241   1e-74    Ursus maritimus [white bear]
gb|ETN66388.1|  activated protein kinase C receptor                     239   1e-74    
emb|CEP13972.1|  hypothetical protein                                   239   1e-74    
ref|XP_004387229.1|  PREDICTED: guanine nucleotide-binding protei...    239   1e-74    
gb|KFB40051.1|  AGAP010173-PA-like protein                              239   1e-74    
ref|XP_007899557.1|  PREDICTED: guanine nucleotide-binding protei...    239   2e-74    
ref|XP_009065209.1|  hypothetical protein LOTGIDRAFT_184120             239   2e-74    
gb|AAI02287.2|  GNB2L1 protein                                          239   2e-74    
gb|AEE62785.1|  unknown                                                 239   2e-74    
ref|NP_001291025.1|  guanine nucleotide binding protein (G protei...    239   2e-74    
ref|XP_009531042.1|  hypothetical protein PHYSODRAFT_355000             239   2e-74    
ref|XP_005795376.1|  PREDICTED: guanine nucleotide-binding protei...    239   2e-74    
ref|XP_008156879.1|  PREDICTED: guanine nucleotide-binding protei...    241   2e-74    
dbj|BAE40059.1|  unnamed protein product                                239   2e-74    
ref|XP_319347.2|  AGAP010173-PA                                         238   3e-74    
ref|XP_008013783.1|  PREDICTED: guanine nucleotide-binding protei...    241   3e-74    
emb|CEP08121.1|  hypothetical protein                                   238   3e-74    
ref|XP_002426725.1|  receptor for activated protein kinase C, put...    238   3e-74    
ref|XP_008955153.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-74    
gb|AEZ53779.1|  guanine nucleotide binding protein (G protein), b...    235   4e-74    
gb|EAW53694.1|  guanine nucleotide binding protein (G protein), b...    241   4e-74    
ref|XP_008034536.1|  guanine nucleotide binding protein beta subunit    238   4e-74    
gb|ENN71239.1|  hypothetical protein YQE_12166                          239   4e-74    
gb|AAP20196.1|  activated protein kinase C receptor                     236   5e-74    
gb|AFU72272.1|  activated protein kinase C receptor                     235   5e-74    
ref|XP_001105066.1|  PREDICTED: guanine nucleotide-binding protei...    240   5e-74    
gb|AEZ53776.1|  guanine nucleotide binding protein (G protein), b...    235   5e-74    
emb|CDS05125.1|  Putative Guanine nucleotide-binding proteinFT su...    234   5e-74    
ref|XP_003900707.2|  PREDICTED: guanine nucleotide-binding protei...    240   5e-74    
emb|CCM01124.1|  predicted protein                                      238   6e-74    
dbj|BAN20230.1|  receptor for activated protein kinase c                238   6e-74    
ref|XP_003382489.1|  PREDICTED: guanine nucleotide-binding protei...    237   7e-74    
ref|XP_011397272.1|  Guanine nucleotide-binding protein subunit b...    238   7e-74    
ref|XP_007362000.1|  guanine nucleotide binding protein beta subunit    237   7e-74    
emb|CBQ71151.1|  probable CPC2 protein, guanine nucleotide-bindin...    237   7e-74    
ref|XP_007083117.1|  PREDICTED: guanine nucleotide-binding protei...    240   7e-74    
ref|XP_002834824.3|  PREDICTED: guanine nucleotide-binding protei...    240   7e-74    
ref|XP_006105825.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    239   8e-74    
dbj|BAL72827.1|  receptor for activated protein kinase C1               237   8e-74    
gb|ETP42980.1|  guanine nucleotide-binding protein subunit beta-l...    241   9e-74    
gb|ETI45096.1|  guanine nucleotide-binding protein subunit beta-l...    241   9e-74    
emb|CDH49357.1|  guanine nucleotide binding protein beta subunit        237   1e-73    
gb|EFZ20464.1|  hypothetical protein SINV_09390                         237   1e-73    
gb|AAT35603.1|  receptor for activated protein kinase C                 237   1e-73    
gb|ACT66700.1|  G-protein complex beta subunit                          237   1e-73    
ref|XP_008475521.1|  PREDICTED: guanine nucleotide-binding protei...    237   1e-73    
emb|CDS03837.1|  Putative Guanine nucleotide-binding proteinFT su...    237   1e-73    
ref|NP_001118140.1|  RACK1                                              237   1e-73    
emb|CDH49812.1|  guanine nucleotide binding protein beta subunit        237   1e-73    
ref|XP_006270088.1|  PREDICTED: guanine nucleotide-binding protei...    237   1e-73    
ref|NP_001279416.1|  guanine nucleotide-binding protein subunit b...    236   2e-73    
emb|CEG70023.1|  Putative Guanine nucleotide-binding protein subu...    236   2e-73    
ref|XP_004531446.1|  PREDICTED: guanine nucleotide-binding protei...    236   2e-73    
gb|ADQ73873.1|  receptor for activated protein kinase C                 236   2e-73    
ref|XP_007877264.1|  hypothetical protein PFL1_01563                    237   2e-73    
ref|XP_011506058.1|  PREDICTED: guanine nucleotide-binding protei...    236   2e-73    
ref|XP_005989393.1|  PREDICTED: guanine nucleotide-binding protei...    236   2e-73    
ref|XP_003664641.1|  hypothetical protein MYCTH_2307651                 236   2e-73    
ref|XP_011180350.1|  PREDICTED: guanine nucleotide-binding protei...    236   2e-73    
gb|ABU49887.1|  receptor for activated protein kinase c1                236   3e-73    
gb|AAD42045.1|AF105259_1  activated protein kinase C receptor           236   3e-73    
gb|EGI68372.1|  Guanine nucleotide-binding protein subunit beta-l...    236   3e-73    
gb|KIM69177.1|  hypothetical protein SCLCIDRAFT_1208600                 236   3e-73    
gb|AHX56189.1|  activated protein kinase C receptor                     236   3e-73    
dbj|BAE40068.1|  unnamed protein product                                236   4e-73    
gb|AHG98116.1|  guanine nucleotide-binding protein subunit beta-2...    235   4e-73    
gb|AHG98119.1|  guanine nucleotide-binding protein subunit beta-2...    235   4e-73    
gb|EJT47727.1|  G protein beta subunit-like protein Rkp1                235   4e-73    
ref|XP_010733915.1|  PREDICTED: guanine nucleotide-binding protei...    235   5e-73    
sp|Q93134.1|GBLP_BIOGL  RecName: Full=Guanine nucleotide-binding ...    235   5e-73    
gb|ABD49712.1|  G-protein beta subunit                                  235   5e-73    
ref|XP_005758143.1|  receptor of activated protein kinase C             235   6e-73    
gb|KIK68892.1|  hypothetical protein GYMLUDRAFT_236781                  235   6e-73    
gb|EMD37863.1|  guanine nucleotide binding protein beta subunit         235   7e-73    
gb|KII92153.1|  hypothetical protein PLICRDRAFT_104409                  235   7e-73    
ref|XP_007807134.1|  G-protein beta subunit                             233   8e-73    
ref|XP_002286095.1|  guanine nucleotide binding protein beta subu...    235   9e-73    
gb|KFH46842.1|  Guanine nucleotide-binding protein subunit beta-l...    234   9e-73    
gb|EQB48545.1|  hypothetical protein CGLO_12231                         234   9e-73    
ref|XP_006958593.1|  WD40 repeat-like protein                           234   1e-72    
gb|AAW82329.1|  guanine nucleotide binding 12.3                         234   1e-72    
gb|KFO20808.1|  Guanine nucleotide-binding protein subunit beta-2...    234   1e-72    
gb|EPT05016.1|  hypothetical protein FOMPIDRAFT_1045684                 234   1e-72    
gb|KIY44498.1|  guanine nucleotide binding protein beta subunit         234   1e-72    
ref|XP_005187516.1|  PREDICTED: guanine nucleotide-binding protei...    234   1e-72    
gb|AAP13580.2|AF407335_1  guanine nucleotide binding protein beta...    234   1e-72    
ref|XP_001796854.1|  hypothetical protein SNOG_06484                    231   1e-72    
gb|KDQ27929.1|  hypothetical protein PLEOSDRAFT_1065257                 234   1e-72    
gb|AHG98118.1|  guanine nucleotide-binding protein subunit beta-2...    234   1e-72    
gb|ACQ58047.1|  Guanine nucleotide-binding protein subunit beta-2...    234   1e-72    
gb|EST05924.1|  putative CPC2 protein, guanine nucleotide-binding...    234   1e-72    
gb|KIO09923.1|  hypothetical protein M404DRAFT_995909                   234   1e-72    
gb|ETS62557.1|  hypothetical protein PaG_03192                          235   2e-72    
ref|XP_007799385.1|  putative guanine nucleotide-binding protein ...    234   2e-72    
ref|XP_007864562.1|  WD40 repeat-like protein                           234   2e-72    
gb|ACJ06767.1|  receptor for activated C-kinase                         234   2e-72    
gb|EHB05258.1|  Guanine nucleotide-binding protein subunit beta-2...    234   2e-72    
dbj|GAC74665.1|  hypothetical protein PANT_12d00080                     235   2e-72    
ref|XP_011388829.1|  putative guanine nucleotide-binding protein ...    234   2e-72    
ref|XP_006962578.1|  cross-pathway control WD-repeat-containing p...    234   2e-72    
ref|XP_004586327.1|  PREDICTED: guanine nucleotide-binding protei...    233   2e-72    
gb|KID66925.1|  G-protein beta subunit                                  234   2e-72    
gb|ACO15464.1|  Guanine nucleotide-binding protein subunit beta-2...    233   2e-72    
gb|AAP04406.1|  G-protein beta subunit like-protein                     233   2e-72    
emb|CDI55376.1|  probable CPC2 protein, guanine nucleotide-bindin...    233   2e-72    
ref|XP_007839961.1|  Guanine nucleotide-binding protein subunit b...    233   2e-72    
ref|XP_002123107.1|  PREDICTED: guanine nucleotide-binding protei...    234   2e-72    
ref|XP_007602725.1|  guanine nucleotide-binding protein subunit b...    233   3e-72    
gb|ADV40152.1|  G protein beta subunit-like protein                     232   3e-72    
gb|EXU98607.1|  WD40 domain protein                                     233   3e-72    
ref|XP_008282647.1|  PREDICTED: guanine nucleotide-binding protei...    233   3e-72    
gb|EHK42326.1|  cross-pathway control WD-repeat protein cpc2            233   3e-72    
gb|KDQ57687.1|  hypothetical protein JAAARDRAFT_35372                   233   3e-72    
ref|XP_003002475.1|  G-protein beta subunit                             233   3e-72    
gb|KIJ67868.1|  hypothetical protein HYDPIDRAFT_25333                   233   3e-72    
gb|ENH83707.1|  g-protein beta subunit                                  233   3e-72    
ref|XP_782254.3|  PREDICTED: guanine nucleotide-binding protein s...    233   3e-72    
gb|EHK21487.1|  cross-pathway control WD-repeat protein cpc2            233   3e-72    
gb|KIM91938.1|  hypothetical protein PILCRDRAFT_57014                   233   4e-72    
gb|KDE05309.1|  guanine nucleotide-binding protein subunit beta-l...    233   4e-72    
gb|KIP05099.1|  hypothetical protein PHLGIDRAFT_74762                   233   4e-72    
ref|XP_006695086.1|  putative guanine nucleotide-binding protein        233   4e-72    
ref|XP_007849688.1|  g-protein comlpex beta subunit                     233   4e-72    
emb|CDH52094.1|  guanine nucleotide-binding protein subunit beta-...    233   5e-72    
ref|XP_007824428.1|  WD40 repeat 2                                      233   5e-72    
emb|CCA26420.1|  guanine nucleotidebinding protein subunit beta2l...    233   5e-72    
gb|KIK47181.1|  hypothetical protein CY34DRAFT_799718                   233   5e-72    
ref|XP_001830441.1|  guanine nucleotide binding protein beta subunit    233   6e-72    
ref|XP_002181732.1|  predicted protein                                  233   6e-72    
ref|XP_008600266.1|  WD domain-containing protein                       233   6e-72    
gb|KEY66722.1|  hypothetical protein S7711_06770                        233   6e-72    
ref|XP_009261603.1|  FGB1                                               233   6e-72    
emb|CEJ92213.1|  Putative Pc22g03140 protein                            232   6e-72    
emb|CDH52095.1|  guanine nucleotide-binding protein subunit beta-...    232   7e-72    
ref|XP_006665983.1|  guanine nucleotide-binding protein beta subu...    232   7e-72    
gb|EJT97430.1|  guanine nucleotide binding protein beta subunit         232   7e-72    
ref|XP_007381227.1|  guanine nucleotide binding protein beta subunit    232   7e-72    
gb|KDN52294.1|  putative CPC2 protein                                   232   8e-72    
gb|AFV15799.1|  RACK 1                                                  232   8e-72    
gb|KIK09351.1|  hypothetical protein K443DRAFT_671847                   232   8e-72    
ref|XP_003852899.1|  guanine nucleotide-binding protein subunit b...    232   8e-72    
gb|AGH70127.1|  guanine nucleotide-binding protein subunit beta-2...    229   8e-72    
gb|AGT17895.1|  guanine nucleotide binding protein beta subunit         232   8e-72    
ref|XP_009547379.1|  hypothetical protein HETIRDRAFT_418643             232   9e-72    
gb|KIM45116.1|  hypothetical protein M413DRAFT_441787                   232   9e-72    
ref|XP_007308233.1|  guanine nucleotide binding protein beta subunit    232   1e-71    
gb|ABU41071.1|  receptor for activated protein kinase C-like protein    232   1e-71    
gb|AFV81452.1|  receptor for activated protein kinase C                 232   1e-71    
emb|CCI48432.1|  unnamed protein product                                232   1e-71    
ref|XP_005658294.1|  PREDICTED: guanine nucleotide binding protei...    231   1e-71    
gb|AAM88904.1|  guanine nucleotide-binding protein                      232   1e-71    
emb|CCT69414.1|  probable CPC2 protein                                  232   1e-71    
gb|KIK28004.1|  hypothetical protein PISMIDRAFT_148977                  232   1e-71    
ref|XP_003051079.1|  predicted protein                                  232   1e-71    
ref|XP_007408997.1|  hypothetical protein MELLADRAFT_116221             231   1e-71    
gb|KHJ35931.1|  putative guanine nucleotide-binding protein subun...    231   1e-71    
gb|KIO29426.1|  hypothetical protein M407DRAFT_242642                   231   1e-71    
gb|EPY85923.1|  guanine nucleotide binding protein, beta polypept...    232   1e-71    
dbj|BAD44728.1|  G-protein beta like WD repeat protein                  231   1e-71    
ref|XP_002051653.1|  GJ16744                                            231   2e-71    
ref|XP_002003756.1|  GI18083                                            231   2e-71    
sp|Q01369.1|GBLP_NEUCR  RecName: Full=Guanine nucleotide-binding ...    231   2e-71    
ref|XP_001988833.1|  GH11378                                            231   2e-71    
ref|XP_001970202.1|  GG23503                                            231   2e-71    
ref|NP_477269.1|  receptor of activated protein kinase C 1, isofo...    231   2e-71    
gb|EME46889.1|  hypothetical protein DOTSEDRAFT_70743                   231   2e-71    
gb|KIJ49590.1|  hypothetical protein M422DRAFT_205027                   231   2e-71    
gb|KEQ62286.1|  WD40 repeat-like protein                                231   2e-71    
ref|XP_002087998.1|  Rack1                                              231   2e-71    
gb|KJA27671.1|  hypothetical protein HYPSUDRAFT_156920                  231   2e-71    
dbj|GAC98631.1|  hypothetical protein PHSY_006225                       233   2e-71    
gb|AAB72148.1|  RACK1                                                   231   2e-71    
gb|ERS97367.1|  guanine nucleotide-binding protein subunit beta-l...    231   2e-71    
gb|KIV99542.1|  guanine nucleotide-binding protein subunit beta-l...    231   2e-71    
ref|XP_008020415.1|  hypothetical protein SETTUDRAFT_85587              231   2e-71    
ref|XP_001932022.1|  WD repeat containing protein 51A                   231   2e-71    
gb|KEZ40620.1|  hypothetical protein SAPIO_CDS8541                      231   2e-71    
gb|KDR18185.1|  Guanine nucleotide-binding protein subunit beta-2...    231   2e-71    
ref|XP_003301795.1|  hypothetical protein PTT_13386                     231   3e-71    
ref|XP_007397219.1|  hypothetical protein PHACADRAFT_258442             231   3e-71    
emb|CCO34704.1|  Guanine nucleotide-binding protein subunit beta-...    231   3e-71    
gb|ABM55530.1|  putative activated C kinase 1 receptor                  231   3e-71    
gb|KIL96127.1|  guanine nucleotide-binding protein subunit beta-l...    231   3e-71    
gb|EKG14448.1|  hypothetical protein MPH_08297                          231   3e-71    
ref|XP_001226350.1|  guanine nucleotide-binding protein beta subu...    231   3e-71    
gb|KDN41366.1|  Guanine nucleotide-binding protein subunit beta-l...    231   3e-71    
ref|XP_003710816.1|  guanine nucleotide-binding protein subunit b...    231   3e-71    
ref|XP_003029882.1|  guanine nucleotide binding protein beta subunit    231   3e-71    
ref|XP_003651077.1|  hypothetical protein THITE_2169762                 231   3e-71    
emb|CCA74715.1|  probable CPC2 protein, guanine nucleotide-bindin...    231   3e-71    
ref|XP_001746605.1|  hypothetical protein                               231   3e-71    
gb|EUC54970.1|  guanine nucleotide-binding protein subunit beta-l...    231   3e-71    
gb|AAM88905.1|  guanine nucleotide-binding protein                      230   4e-71    
emb|CCF48119.1|  probable CPC2 protein, guanine nucleotide-bindin...    230   4e-71    
ref|XP_007582921.1|  putative g-protein comlpex beta subunit protein    230   4e-71    
ref|XP_007317684.1|  hypothetical protein SERLADRAFT_465902             230   4e-71    
ref|XP_007915760.1|  putative guanine nucleotide-binding protein ...    230   4e-71    
ref|XP_960070.1|  guanine nucleotide-binding protein subunit beta...    230   4e-71    
ref|XP_007783846.1|  guanine nucleotide-binding protein subunit b...    230   4e-71    
gb|EFX03206.1|  g-protein beta subunit                                  230   5e-71    
gb|KDQ21830.1|  hypothetical protein BOTBODRAFT_123721                  230   5e-71    
ref|NP_001274728.1|  guanine nucleotide-binding protein subunit b...    230   5e-71    
gb|KDR75340.1|  hypothetical protein GALMADRAFT_249381                  230   5e-71    
gb|AID16303.1|  receptor for activated protein kinase C1                230   6e-71    
ref|XP_001903663.1|  hypothetical protein                               230   6e-71    
gb|KFH73669.1|  guanine nucleotide-binding protein subunit beta-l...    230   7e-71    
dbj|GAM85656.1|  hypothetical protein ANO11243_036630                   230   7e-71    
ref|XP_007680411.1|  hypothetical protein BAUCODRAFT_38509              229   7e-71    
ref|XP_001239490.1|  hypothetical protein CIMG_09111                    229   8e-71    
gb|KFQ81036.1|  Guanine nucleotide-binding protein subunit beta-2...    229   8e-71    
emb|CCX15458.1|  Similar to Guanine nucleotide-binding protein su...    231   8e-71    
gb|AEZ53777.1|  guanine nucleotide binding protein (G protein), b...    226   9e-71    
gb|KIL68896.1|  hypothetical protein M378DRAFT_158035                   229   9e-71    
ref|XP_011445926.1|  PREDICTED: guanine nucleotide-binding protei...    229   9e-71    
ref|XP_007925889.1|  G protein beta subunit                             229   9e-71    
ref|XP_005094913.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    229   1e-70    
ref|XP_661767.1|  GBLP_NEUCR Guanine nucleotide-binding protein b...    229   1e-70    
gb|EMF14147.1|  WD repeat-containing protein 51A                        229   1e-70    
gb|AAS49532.1|  guanine nucleotide binding protein beta polypepti...    228   2e-70    
ref|XP_006460934.1|  hypothetical protein AGABI2DRAFT_192506            229   2e-70    
gb|AGN75114.1|  receptor for activated C kinase 1                       229   2e-70    
gb|ACU33969.1|  receptor of activated kinase C                          228   2e-70    



>ref|XP_009776114.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=328

 Score =   328 bits (840),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKS+IVW+LTKDGPQ+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDR  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P     TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HAGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSL-DAGSIIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATETSIKIWD  262



>emb|CAA96528.1| G protein beta-subunit-like protein [Nicotiana plumbaginifolia]
Length=328

 Score =   326 bits (836),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKS+IVW+LTKDGPQ+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P     TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HAGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSL-DAGSIIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATETSIKIWD  262



>gb|ABB86277.1| ArcA2 protein-like [Solanum tuberosum]
Length=327

 Score =   326 bits (836),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG Q+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P     TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D +  + ++ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DASSIIHTLCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>ref|XP_009600162.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=328

 Score =   326 bits (835),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKS+IVW LTKDGPQ+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSLIVWALTKDGPQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177


 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P     TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HGGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSL-DAGSIIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATETSIKIWD  262



>ref|XP_006341557.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=327

 Score =   326 bits (835),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG Q+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P     TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D +  + ++ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DASSIIHTLCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>gb|AJE63428.1| transcription factor ArcA1 [Capsicum annuum]
Length=330

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDGP +GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGPTYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTAR FV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARSFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P     TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHTLCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>ref|NP_001233881.1| ArcA2 protein [Solanum lycopersicum]
 dbj|BAA76896.1| LeArcA2 protein [Solanum lycopersicum]
Length=326

 Score =   323 bits (828),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG Q+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQDG  H++WVSCVRFSP+TLQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQDGHSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P     TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQDGHSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHTLCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>ref|XP_009624187.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=326

 Score =   322 bits (826),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+AHTDWVTAIA P+DNSD IV+SSRDKSIIVW++TKDGPQ+GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSITKDGPQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++I+LWNTLGECKYTIQDGD H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIRLWNTLGECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 82/187 (44%), Gaps = 26/187 (14%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRATLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V    +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  193  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-ESGSIIHSLCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD----------------GDGHNEWVSCVRFSPSTLQPT  556
             A+ + +IK+W+   E K  + D                  G N+ + C   S S    T
Sbjct  251  CAATESSIKIWDL--ESKSIVDDLKVDLKQESEMSSEGTASGKNKVIYCTSLSWSADGST  308

Query  557  IVSGSWD  577
            + SG  D
Sbjct  309  LFSGYTD  315



>ref|XP_004252271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Solanum lycopersicum]
Length=301

 Score =   319 bits (818),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTK+G Q+GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 67/132 (51%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNL+         R  L G
Sbjct  138  ECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSN-----CKLRATLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V    +S DG    SG  DG + LWDL  G      +D    + ++ FS  NR  +
Sbjct  193  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDSGSIIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>ref|XP_009778426.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=326

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+AHTDWVTAIA P+DNSD IV+SSRDKSIIVW+LTKDGPQ+GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFS DNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++I+LWNTLGECKY IQDGD H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIRLWNTLGECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC  +     +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRATLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V    +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  193  HTGYVNTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-ESGSIIHSLCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  + D
Sbjct  251  CAATESSIKIWDL--ESKTIVDD  271



>ref|XP_006353816.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=329

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTK+G Q+GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 66/132 (50%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNL+         R  L G
Sbjct  138  ECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSN-----CKLRATLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V    +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HAGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DSGSIIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>ref|XP_004252270.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Solanum lycopersicum]
Length=329

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTK+G Q+GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++IKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 66/132 (50%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNL+         R  L G
Sbjct  138  ECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSN-----CKLRATLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V    +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DSGSIIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>ref|NP_001233876.1| ArcA1 protein [Solanum lycopersicum]
 dbj|BAA76895.1| LeArcA1 protein [Solanum lycopersicum]
Length=326

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG Q+GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGSQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFV+DVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVEDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQ+ D H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G      +D    + +  FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSIIHTFCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tabacum]
 dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum]
Length=326

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+AHTDWVTAIA  +DNSD IV+SSRDKSIIVW++TKDGPQ+GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATAVDNSDMIVTSSRDKSIIVWSITKDGPQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++I+LWNTLGECKYTIQDGD H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIRLWNTLGECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 81/184 (44%), Gaps = 26/184 (14%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRLTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V    +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  193  HTGYVNTPAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-ESGSIIHSLCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD----------------GDGHNEWVSCVRFSPSTLQPT  556
             A+ + +IK+W+   E K  + D                  G N+ + C   S S    T
Sbjct  251  CAATESSIKIWDL--ESKSIVDDLKVDLKQESEMSSEGTASGKNKVIYCTSLSWSADGST  308

Query  557  IVSG  568
            + SG
Sbjct  309  LFSG  312



>ref|XP_006365404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=326

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMKAHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG  +GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGSHYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFV+DVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHGHFVEDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRDRTIKLWNTLGECKYTIQ+ D H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDRTIKLWNTLGECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHTLCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATESSIKIWD  262



>ref|XP_009611065.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=325

 Score =   318 bits (814),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDGPQ+GV RRRLTGH
Sbjct  3    ESLVLRGTMRAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
             HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   GHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRD+TIKLWNTLGECKYTI DGD H+ WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  123  ASRDKTIKLWNTLGECKYTITDGDSHSNWVSCVRFSPNNLQPTIVSGSWDRTVK  176


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 67/132 (51%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H++WV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  137  ECKYTITDGDSHSNWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHTLCFS-PNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  250  CAATESSIKIWD  261



>ref|XP_009780116.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=325

 Score =   318 bits (814),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDGPQ+GV RRRLTGH
Sbjct  3    ESLVLRGTMRAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
             HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   GHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRD+TIKLWNTLGECKYTI DGD H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  123  ASRDKTIKLWNTLGECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  176


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  137  ECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  250  CAATESSIKIWD  261



>sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana plumbaginifolia]
 emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=326

 Score =   317 bits (812),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+ E LVLRGTM+AHTDWVTAIA P+DNSD IV+SSRDKSIIVW+LTKDGPQ+GV RRRL
Sbjct  1    MSHESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFS DNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++I+LWNTLGECKY IQDGD H++WVSCVRFSP+ LQPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIRLWNTLGECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC  +     +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRATLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V    +S DG    SG  DG + LWDL  G      ++    + S+ FS  NR  +
Sbjct  193  HTGYVNTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYS-LESGSIIHSLCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  + D
Sbjct  251  CAATESSIKIWDL--ESKTIVDD  271



>ref|XP_011084467.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Sesamum indicum]
Length=318

 Score =   313 bits (803),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGT++AHTDWVTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVARRRL
Sbjct  1    MAQEQLVLRGTLRAHTDWVTAIATPIDNSDMIVTSSRDKSIILWALTKEDKTYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQ G TARRFV HTKDVLSVAFSVDNRQ
Sbjct  61   NGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQD D H++WVSCVRFSP+TLQPTIVSGSWDR  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177



>gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana]
Length=326

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+AHTDWVTAIA P+DNSD IV+SSRDKSIIVW++TKDGP +GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSITKDGPLYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDG FALSGSWDGELRLWDLQAGTTARRFV HTKDVLSVAFS DNRQ
Sbjct  61   TGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD++I+LWNTLGECK+ IQDGD H++WVSCVRFSP+ +QPTIVSGSWDR  K
Sbjct  121  IVSASRDKSIRLWNTLGECKFIIQDGDSHSDWVSCVRFSPNNIQPTIVSGSWDRTVK  177


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 71/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC  +     +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  138  ECKFIIQDGDSHSDWVSCVRFSPNNIQPTIVSGSWDRTVKIWNLTN-----CKLRATLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V    +S +G    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  193  HTGYVNTTAVSPEGSLCASGGKDGVILLWDLAEGKKLYSL-ESGSIIHSLCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  + D
Sbjct  251  CAATESSIKIWDL--ESKTIVDD  271



>gb|EYU40229.1| hypothetical protein MIMGU_mgv1a008949mg [Erythranthe guttata]
Length=357

 Score =   311 bits (798),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = +2

Query  44   QRERKMAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGV  223
              +  MAQE LVLRGTM+AHTDWVTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV
Sbjct  24   HNQSAMAQEQLVLRGTMRAHTDWVTAIATPIDNSDMIVTASRDKSIILWSLTKEDRTYGV  83

Query  224  ARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFS  403
            ARRRLTGHSHFV+DVVLSSDGQFALSGSWDGELRLWDLQ G TARRFV HTKDVLSVAFS
Sbjct  84   ARRRLTGHSHFVEDVVLSSDGQFALSGSWDGELRLWDLQTGNTARRFVGHTKDVLSVAFS  143

Query  404  VDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRP  583
            +DNRQIVSASRD+TIKLWNTLGECKYTIQD D H++WVSCVRFSP+TLQPTIVS SWD+ 
Sbjct  144  IDNRQIVSASRDKTIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSASWDKT  203

Query  584  XK  589
             K
Sbjct  204  VK  205


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S DK++ +WNLT         R  L G
Sbjct  166  ECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKIWNLTN-----CKLRSTLAG  220

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V    +S DG    SG  DG + LWDL  G   R +      +++      NR  +
Sbjct  221  HSGYVNTSAVSPDGSLCASGGKDGVILLWDLAEGK--RLYSLDAGSIINALCFSPNRYWL  278

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  279  CAATEASIKIWD  290



>gb|EYU17645.1| hypothetical protein MIMGU_mgv1a009858mg [Erythranthe guttata]
Length=329

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE L+LRGTM+AHTDWVTAIA PIDNSD IV+SSRDKS+I+WNLTK+   +GVARRRL
Sbjct  1    MAQEQLILRGTMRAHTDWVTAIATPIDNSDMIVTSSRDKSLILWNLTKEDKNYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQ G T RRFV HTKDVLSVAFSVDNRQ
Sbjct  61   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQTGATTRRFVGHTKDVLSVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVS SRD+TIKLWNTLGECKYTIQD DGH++WVSCVRFSP+ LQPTIVSGS D+  K
Sbjct  121  IVSGSRDKTIKLWNTLGECKYTIQDQDGHSDWVSCVRFSPNNLQPTIVSGSCDKTVK  177


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H+DWV+ +  +P +   TIVS S DK++ +WNLT         +  L G
Sbjct  138  ECKYTIQDQDGHSDWVSCVRFSPNNLQPTIVSGSCDKTVKIWNLTN-----CKLKSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    V +V FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGFILLWDLAEGKKLYSL-DAGSIVHAVCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ +  IK+W+
Sbjct  251  CAATEAGIKIWD  262



>ref|XP_011072970.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Sesamum indicum]
Length=329

 Score =   310 bits (793),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE L+LRGT++AHTDWVTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVARRRL
Sbjct  1    MSQEQLILRGTLRAHTDWVTAIATPIDNSDMIVTSSRDKSIILWALTKEEKSYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH HFVQDVVLSSDGQFALSGSWDGELRLWDLQ G TARRFV HTKDV+SVAFSVDNRQ
Sbjct  61   TGHGHFVQDVVLSSDGQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVISVAFSVDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQD D H++WVSCVRFSP+TLQPTIVSGSWD+  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVK  177


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 67/132 (51%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS S DK++ VWNLT         R  L+G
Sbjct  138  ECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVKVWNLTN-----CKLRSTLSG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSL-DAGSIIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  251  CAATEASIKIWD  262



>gb|KHG17882.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=326

 Score =   307 bits (786),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MAFEGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSD QFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQ
Sbjct  61   TGHSHFVQDVVLSSDSQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRDR+IKLWNTLGECKYTIQDGD H +WVSCVRFSP+ LQPTIVS SWD+  K
Sbjct  121  IVSASRDRSIKLWNTLGECKYTIQDGDAHTDWVSCVRFSPNNLQPTIVSASWDKTVK  177


 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 74/143 (52%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHTDWV+ +  +P +   TIVS+S DK++ VWNLT         R  L G
Sbjct  138  ECKYTIQDGDAHTDWVSCVRFSPNNLQPTIVSASWDKTVKVWNLTN-----CKIRNTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + S+ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSVIHSLCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  251  CAATEQSIKIWDL--ESKSIVED  271



>gb|KJB53022.1| hypothetical protein B456_008G288800 [Gossypium raimondii]
Length=326

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MAFEGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLS D QFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQ
Sbjct  61   TGHSHFVQDVVLSFDSQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRDR+IKLWNTLGECKYTIQDGD H +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  121  IVSASRDRSIKLWNTLGECKYTIQDGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 74/143 (52%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  138  ECKYTIQDGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKIRNTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G      +D    + S+ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSVIHSLCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  251  CAATEQSIKIWDL--ESKSIVED  271



>gb|ACJ85349.1| unknown [Medicago truncatula]
Length=285

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSL-DAGSIIHALCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  ++D
Sbjct  250  CAATESSIKIWDL--ESKSIVED  270



>gb|ACJ85009.1| unknown [Medicago truncatula]
Length=219

 Score =   302 bits (773),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA  IDNSD IV++SRDKSII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLVLRGTMRAHTDVVTAIATLIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 45/88 (51%), Gaps = 6/88 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRL  328
            HS +V  V +S DG    SG  DG + L
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILL  219



>gb|KJB37175.1| hypothetical protein B456_006G192600 [Gossypium raimondii]
Length=327

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GVARRRLTGH
Sbjct  5    EGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRLTGH  64

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSD QFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  65   SHFVQDVVLSSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVS  124

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  125  ASRDRTIKLWNTLGECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 73/143 (51%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  139  ECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKIRNTLAG  193

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  194  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGAVIHSLCFS-PNRYWL  251

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  252  CAATEQSIKIWDL--ESKSIVED  272



>ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cicer arietinum]
Length=317

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEEKVYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 15/143 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G  A   +       ++ FS  NR  +
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGNYAGSIIH------ALCFS-PNRYWL  244

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  ++D
Sbjct  245  CAATETSIKIWDL--ESKSIVED  265



>ref|XP_003631071.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Medicago truncatula]
 gb|AET05547.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=325

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGSIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ + +IK+W+   E K  ++D
Sbjct  249  LCAATESSIKIWDL--ESKSIVED  270



>gb|KHG00880.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GVARRRLTGH
Sbjct  5    EGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRLTGH  64

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSD QFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  65   SHFVQDVVLSSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVS  124

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  125  ASRDRTIKLWNTLGECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 73/143 (51%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  139  ECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKIRNTLAG  193

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  194  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGAVIHSLCFS-PNRYWL  251

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  252  CAATEQSIKIWDL--ESKSVVED  272



>gb|AFK36580.1| unknown [Medicago truncatula]
Length=325

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGFIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ + +IK+W+   E K  ++D
Sbjct  249  LCAATESSIKIWDL--ESKSIVED  270



>gb|KDP37901.1| hypothetical protein JCGZ_05340 [Jatropha curcas]
Length=329

 Score =   305 bits (781),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTK+   +GV RRRL
Sbjct  1    MAVEGLVLRGTMRAHTDQVTAIATPIDNSDMIVTSSRDKSIILWHLTKEEKTYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL AG +ARRFV HTKDVLSVAFS+DNRQ
Sbjct  61   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSP+T QPTIVS SWDR  K
Sbjct  121  IVSASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPNTHQPTIVSASWDRTVK  177


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P  +  TIVS+S D+++ VWNLT         R  L G
Sbjct  138  ECKYTIQDGDAHSDWVSCVRFSPNTHQPTIVSASWDRTVKVWNLTN-----CKLRCTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNL-DAGAVIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  ++D
Sbjct  251  CAATEHSIKIWDL--ESKSIVED  271



>ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Vitis vinifera]
 emb|CAN61810.1| hypothetical protein VITISV_026180 [Vitis vinifera]
Length=327

 Score =   304 bits (779),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GV RRRLTGH
Sbjct  3    ETLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDADAHSDWVSCVRFSPNNLQPTIVSASWDRTVK  176


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P +   TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDADAHSDWVSCVRFSPNNLQPTIVSASWDRTVKVWNLTN-----CKLRATLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSL-DAGAIIHALCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  250  CAATEQSIKIWDL--ESKSIVED  270



>ref|XP_006451669.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
 ref|XP_006490737.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Citrus sinensis]
 gb|ESR64909.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
Length=327

 Score =   304 bits (779),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSIIVW+LTK+   +GVARRRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDMIVTASRDKSIIVWHLTKEEKTYGVARRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLAEGKSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQ+GD H EWVSCVRFSP+TLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVK  176


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS+S D+++ VWNL+         R  L G
Sbjct  137  ECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVKVWNLSN-----CKLRATLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGAVIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ +++IK+W+   E K  ++D
Sbjct  249  LCAATEQSIKIWDL--ESKSIVED  270



>ref|XP_011039103.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E L+LRGTM+AHTD VTAIA PIDN+D IVSSSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MATETLILRGTMRAHTDQVTAIATPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS DNRQ
Sbjct  61   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVK  177


 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       ++HTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGAVINALCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  + D
Sbjct  251  CAATENSIKIWDL--ESKMVVDD  271



>ref|XP_007036696.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=327

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GV RRRLTGH
Sbjct  5    EALVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWQLTKDEKTYGVPRRRLTGH  64

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSD QFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  65   SHFVQDVVLSSDSQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQIVS  124

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDG+ H +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  125  ASRDRTIKLWNTLGECKYTIQDGEAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 75/143 (52%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       +AHTDWV+ +  +P     TIVS+S DK++ VWNLT         R  LTG
Sbjct  139  ECKYTIQDGEAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKIRNTLTG  193

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + S+ FS  NR  +
Sbjct  194  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGAVIHSLCFS-PNRYWL  251

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  252  CAATEQSIKIWDL--ESKSIVED  272



>ref|XP_011039104.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E L+LRGTM+AHTD VTAIA PIDN+D IVSSSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MATETLILRGTMRAHTDQVTAIATPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS DNRQ
Sbjct  61   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVK  177


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       ++HTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGAVINALCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  + D
Sbjct  251  CAATENSIKIWDL--ESKLVVDD  271



>ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max]
 gb|ACU23023.1| unknown [Glycine max]
Length=325

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +2

Query  74   LVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSH  253
            LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRLTGHSH
Sbjct  5    LVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGHSH  64

Query  254  FVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSAS  433
            FVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVSAS
Sbjct  65   FVQDVVLSSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSAS  124

Query  434  RDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            RDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  125  RDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGSIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ +++IK+W+   E K  ++D
Sbjct  249  LCAATEQSIKIWDL--ESKSIVED  270



>ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein 
[Glycine max]
 sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Glycine max]
 gb|AAB05941.1| G beta-like protein [Glycine max]
Length=325

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRD+SII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLVLKGTMRAHTDVVTAIATPIDNSDMIVTASRDRSIILWHLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  +R  +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSL-DAGSIIHALCFS-PSRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  250  CAATEQSIKIWDL--ESKSIVED  270



>gb|AGV54321.1| RACK1 [Phaseolus vulgaris]
Length=324

 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W LTK+   +GV RRRLTGH
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTGK  176


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D++  VWNLT         +  L G
Sbjct  137  ECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTGKVWNLTN-----CKLKNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            +S +V +V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  NSGYVNNVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGSIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ +++IK+W+   E K  ++D
Sbjct  249  LCAATEQSIKIWDL--ESKSIVED  270



>ref|XP_007160506.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
 gb|ACV72060.1| RACK1 [Phaseolus vulgaris]
 gb|ESW32500.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
Length=324

 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W LTK+   +GV RRRLTGH
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGSIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ +++IK+W+   E K  ++D
Sbjct  249  LCAATEQSIKIWDL--ESKSIVED  270



>ref|XP_002318528.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|EEE96748.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E L+LRGTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MATETLILRGTMRAHTDQVTAIATPIDNTDMIVSASRDKSIILWHLTKDEKTYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS DNRQ
Sbjct  61   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVK  177


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       ++HTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGAVINALCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  + D
Sbjct  251  CAATENSIKIWDL--ESKMVVDD  271



>sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Medicago sativa]
 emb|CAA69934.1| G protein beta subunit-like [Medicago sativa subsp. x varia]
Length=325

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSPST QPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTPQPTIVSASWDRTVK  176


 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPSTPQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGSIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ + +IK+W+   E K  ++D
Sbjct  249  LCAATESSIKIWDL--ESKSIVED  270



>ref|XP_002321505.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|ABK92879.1| unknown [Populus trichocarpa]
 gb|EEF05632.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA + LVLRGTM+AHTD VTAIA PIDNSD IVSSSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MASDTLVLRGTMRAHTDQVTAIATPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQ
Sbjct  61   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQ+ + H +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       ++HTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG + LWDL  G   R +      V++      NR  +
Sbjct  193  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGAVINALCFSPNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  + D
Sbjct  251  CAATENSIKIWDL--ESKLVVDD  271



>ref|XP_010678120.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGTM+AHTD VTAIA PIDNSD IV++SRDKSIIVWNLTK+   +GV +RRLTGH
Sbjct  3    EQLQLRGTMRAHTDMVTAIATPIDNSDMIVTASRDKSIIVWNLTKEDKIYGVPKRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AGTTARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGTTARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQD DGH +WVSCVRFSP+T+QPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDSDGHTDWVSCVRFSPNTMQPTIVSASWDKTVK  176


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 72/144 (50%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         HTDWV+ +  +P     TIVS+S DK++ +WNL+         R  L G
Sbjct  137  ECKYTIQDSDGHTDWVSCVRFSPNTMQPTIVSASWDKTVKIWNLSN-----CKLRATLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H+ +V  V +S DG    SG  D  + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDSVILLWDLAEG--KRLYSLDAGTIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ +  IK+W+   E K  ++D
Sbjct  249  LCAATESGIKIWDL--ESKSVVED  270



>emb|CDO98381.1| unnamed protein product [Coffea canephora]
Length=1395

 Score =   324 bits (830),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 172/199 (86%), Gaps = 4/199 (2%)
 Frame = +2

Query  5     FQTLRFRPPNS*SQRER----KMAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRD  172
             F   R  PP + +   R    KM+Q+ L+LRGTM+AHTDWVTAIA PIDN+D IV+SSRD
Sbjct  1044  FSIFRLSPPKNPAPHSRSSSLKMSQDQLILRGTMRAHTDWVTAIATPIDNTDMIVTSSRD  1103

Query  173   KSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTT  352
             KSII+W+LTK+   +GV RRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQ+GTT
Sbjct  1104  KSIILWSLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQSGTT  1163

Query  353   ARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRF  532
             ARRFV HTKDVLSVAFS+DNRQIVSASRD+TIKLWNTLGECKYTIQD DGH +WVSCVRF
Sbjct  1164  ARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKLWNTLGECKYTIQDADGHTDWVSCVRF  1223

Query  533   SPSTLQPTIVSGSWDRPXK  589
             SP+ LQPTIVSGSWDR  K
Sbjct  1224  SPNNLQPTIVSGSWDRTVK  1242


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 8/132 (6%)
 Frame = +2

Query  68    ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
             EC         HTDWV+ +  +P +   TIVS S D+++ +WNL+         R  L G
Sbjct  1203  ECKYTIQDADGHTDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSN-----CKMRATLAG  1257

Query  245   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
             H+ +V    +S DG    SG  DG + LWDL  G      +D    + ++ FS  NR  +
Sbjct  1258  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSIIHALCFS-PNRYWL  1315

Query  425   SASRDRTIKLWN  460
              A+ + +IK+W+
Sbjct  1316  CAATEASIKIWD  1327



>ref|XP_011000479.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA + LVLRGTM+AHTD VTAIA PIDNSD IVSSSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MASDTLVLRGTMRAHTDQVTAIATPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQ
Sbjct  61   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQ+ + H +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       ++HTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  138  ECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKLRSTLAG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG + LWDL  G   R +      V++      NR  +
Sbjct  193  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGAVINALCFSPNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  + D
Sbjct  251  CAATENSIKIWDL--ESKLVVDD  271



>gb|KHG29145.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT  241
              E L+LRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GV RRRLT
Sbjct  3    GSEGLILRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVPRRRLT  62

Query  242  GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQI  421
            GHSHFVQDVVLSSD QFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQI
Sbjct  63   GHSHFVQDVVLSSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQI  122

Query  422  VSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            VSASRDRTIKLWNTLGECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  VSASRDRTIKLWNTLGECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  139  ECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKIRNTLAG  193

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + S+ FS  NR  +
Sbjct  194  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSVIHSLCFS-PNRYWL  251

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ ++ IK+W+   E K  ++D
Sbjct  252  CAATEQGIKIWDL--ESKSIVED  272



>gb|ACJ24167.1| Rack [Phaseolus vulgaris]
Length=324

 Score =   301 bits (772),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSII+W LTK+   +GV RRRLTGH
Sbjct  3    EGLVLKGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVK  176


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGSIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ +++IK+W+   E K  ++D
Sbjct  249  LCAATEQSIKIWDL--ESKSIVED  270



>ref|XP_004299548.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Fragaria vesca subsp. vesca]
Length=326

 Score =   301 bits (772),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M  E LVL+GTM+AHTD VTAIA PIDNS+ IVS+SRDKSII+W L KD   +GV RRRL
Sbjct  1    MGSEGLVLKGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWQLNKDENSYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQ
Sbjct  61   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLAQGVSARRFVGHTKDVLSVAFSIDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRDRTIKLWNTLGECKYTIQ+ DGHN+WVSCVRFSP+TLQPTIVS SWDR  K
Sbjct  121  IVSASRDRTIKLWNTLGECKYTIQEQDGHNDWVSCVRFSPNTLQPTIVSASWDRTVK  177


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 71/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  138  ECKYTIQEQDGHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLEG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  193  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSL-DAGAIIHALCFS-PNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  251  CAATEQSIKIWDL--ESKSIVED  271



>ref|XP_002529557.1| receptor for activated protein kinase C, putative [Ricinus communis]
 gb|EEF32826.1| receptor for activated protein kinase C, putative [Ricinus communis]
Length=328

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L+L GTM+AHTD VTAIA PIDNSD IV++SRDKSII+W L KD   +GVA RRLTGH
Sbjct  3    ERLILLGTMRAHTDQVTAIATPIDNSDMIVTASRDKSIILWKLIKDEKTYGVAHRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL AG +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD HN+WVSCVRFSP+TLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHNDWVSCVRFSPNTLQPTIVSASWDRTVK  176


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTN-----CKLRCTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  +
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNL-DAGAVIHALCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  ++D
Sbjct  250  CAATENSIKIWDL--ESKSIVED  270



>gb|KJB08186.1| hypothetical protein B456_001G069800 [Gossypium raimondii]
Length=327

 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT  241
              E L+LRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GV RRRLT
Sbjct  3    GSEGLILRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVPRRRLT  62

Query  242  GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQI  421
            GHSHFVQDVVLSSD QFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSVAFS+DNRQI
Sbjct  63   GHSHFVQDVVLSSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQI  122

Query  422  VSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            VSASRDRTI+LWNTLGECKYTIQ+GD H +WVSCVRFSP+T+QPTIVS SWD+  K
Sbjct  123  VSASRDRTIRLWNTLGECKYTIQEGDAHTDWVSCVRFSPNTVQPTIVSASWDKTVK  178


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHTDWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  139  ECKYTIQEGDAHTDWVSCVRFSPNTVQPTIVSASWDKTVKVWNLTN-----CKIRNTLAG  193

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       D    + S+ FS  NR  +
Sbjct  194  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSVIHSLCFS-PNRYWL  251

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ ++ IK+W+   E K  ++D
Sbjct  252  CAATEQGIKIWDL--ESKSIVED  272



>ref|XP_008240184.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Prunus mume]
Length=327

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNS+ IVS+SRDKSII+W+LTKD   +GV RRRLTGH
Sbjct  3    ETLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECK+TIQD DGH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVK  176


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKLRCTLEG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G            + ++ FS  NR  +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSL-GAGAIIHALCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  250  CAATEQSIKIWDL--ESKQIVED  270



>ref|XP_010032559.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW83972.1| hypothetical protein EUGRSUZ_B00856 [Eucalyptus grandis]
Length=327

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L L+GTMKAHTD VTAIA PIDN+D IV+SSRDKSII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLHLKGTMKAHTDMVTAIAVPIDNADMIVTSSRDKSIILWHLTKEDKVYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQ+G+ HN+WVSCVRFSP+TLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQEGEAHNDWVSCVRFSPNTLQPTIVSASWDRTVK  176


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       +AH DWV+ +  +P     TIVS+S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQEGEAHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTN-----CKLRNTLQG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGAIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +IK+W+   E K  ++D
Sbjct  250  CAATENSIKIWDL--ESKSIVED  270



>gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein subunit beta 
[Eschscholzia californica]
Length=313

 Score =   297 bits (760),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            + LVLRGT+K H D VTAIA PIDNSD IVSSSRDKSI+VW+LTK+ P +GV RRRLTGH
Sbjct  3    DVLVLRGTLKGHDDMVTAIATPIDNSDMIVSSSRDKSILVWHLTKEDPTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSG+WDGELRLWDL  GTT RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGAWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDR+IKLWNTLGECKYTIQD D H  WVSCVRFSP+TLQPTIVSG WDR  K
Sbjct  123  ASRDRSIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTLQPTIVSGFWDRTVK  176


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 78/174 (45%), Gaps = 17/174 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +HT+WV+ +  +P     TIVS   D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDADSHTNWVSCVRFSPNTLQPTIVSGFWDRTVKVWNLTN-----CKLRSTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H  +V  V +S DG    SG  DG + LWDL  G         H   + ++ FS  NR  
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLPAGHI--IHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSG  568
            + A+    I++W+   E K  +Q+       G N+   C   + S+   T+ +G
Sbjct  249  LCAATQGDIQIWDL--ESKSLVQELKPEVTQGKNKMFYCTSLNWSSDGSTLFTG  300



>ref|XP_007209348.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
 gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
Length=327

 Score =   297 bits (760),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            + LVLRGTM+AHTD VTAIA PIDNS+ IVS+SRDKSII+W+LTKD   +GV RRRLTGH
Sbjct  3    DTLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECK+TIQD DGH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVK  176


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKLRCTLEG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G            + ++ FS  NR  +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSL-GAGAIIHALCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ +++IK+W+   E K  ++D
Sbjct  250  CAATEQSIKIWDL--ESKQIVED  270



>ref|XP_010036939.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW48591.1| hypothetical protein EUGRSUZ_K02261 [Eucalyptus grandis]
Length=326

 Score =   297 bits (760),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L+L+GTM+AHTD VTAIA PIDNSD +V+SSRDKSII+W+LTK+   +GV RRRLTGH
Sbjct  3    EGLILKGTMRAHTDMVTAIAIPIDNSDMVVTSSRDKSIILWHLTKEEKVYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQ+G+ H +WVSCVRFSP+TLQPTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQEGEAHTDWVSCVRFSPNTLQPTIVSASWDRTIK  176


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 75/145 (52%), Gaps = 14/145 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       +AHTDWV+ +  +P     TIVS+S D++I VWNLT         R  L G
Sbjct  137  ECKYTIQEGEAHTDWVSCVRFSPNTLQPTIVSASWDRTIKVWNLTN-----CKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL--SVAFSVDNRQ  418
            H+ +V  V +S DG    SG  DG + LWDL  G   +R  +     +  S+ FS  NR 
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KRLYNLEAGAIIHSLCFS-PNRY  247

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
             + A+ + +IK+W+   E K  ++D
Sbjct  248  WLCAATENSIKIWDL--ESKSIVED  270



>ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 ref|XP_004160431.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 gb|KGN63851.1| hypothetical protein Csa_1G024830 [Cucumis sativus]
Length=327

 Score =   296 bits (758),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GV +RRL GH
Sbjct  3    EGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIIMWRLTKEEKTYGVPQRRLNGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T+RRFV H+KDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGNTSRRFVGHSKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVK  176


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKLRVTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HAGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGSIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ + +IK+W+   E K  ++D
Sbjct  249  LCAATESSIKIWDL--ESKSIVED  270



>gb|KFK43977.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 158/175 (90%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L+L+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLILKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQ+ G+GH EWVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQEGGEGHTEWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + HT+WV+ +  +P     TIVS+S DK++ VWNL+         R  L GH+ +V  V 
Sbjct  147  EGHTEWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTLAGHTGYVSTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G   + +      V+       NR  + A+ ++ IK
Sbjct  202  VSPDGSLCASGGKDGVVLLWDLAEG--KKLYSLEANSVIHALCFSPNRYWLCAATEQGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSIVED  271



>ref|XP_009117627.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=327

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 158/175 (90%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 67/134 (50%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L GH+ +V  V 
Sbjct  147  EGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTLAGHTGYVSTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G   + +      V+       NR  + A+ ++ IK
Sbjct  202  VSPDGSLCASGGKDGVVLLWDLAEG--KKLYSLEANSVIHALCFSPNRYWLCAATEQGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSVVED  271



>ref|XP_008453452.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Cucumis melo]
Length=327

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GV +RRL GH
Sbjct  3    EGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWRLTKEEKTYGVPQRRLNGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T+RRFV H+KDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGLTSRRFVGHSKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVK  176


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH+DWV+ +  +P     TIVS+S DK++ VWNLT         R  L G
Sbjct  137  ECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTN-----CKLRVTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  192  HAGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGSIIHALCFS-PNRYW  248

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ + +IK+W+   E K  ++D
Sbjct  249  LCAATESSIKIWDL--ESKSIVED  270



>ref|XP_008374821.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Malus domestica]
 ref|XP_008364648.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
 ref|XP_009347770.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNS+ IVS+SRDKSII+W+L KD   +GV RRRLTGH
Sbjct  3    ENLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECK+TIQD DGH +WVSCVRFSP+T+QPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVK  176


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 64/132 (48%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L G
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSN-----CKLRNTLEG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G   R +      ++       NR  +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYHLEAGSIIHALCFSPNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ +++IK+W+
Sbjct  250  CAATEQSIKIWD  261



>emb|CBI15540.3| unnamed protein product [Vitis vinifera]
Length=1318

 Score =   316 bits (810),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +2

Query  44    QRER---KMAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ  214
             +RER   KMA E LVLRGTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   
Sbjct  1048  ERERESSKMA-ETLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDDKT  1106

Query  215   FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
             +GV RRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL AGT+ARRFV HTKDVLSV
Sbjct  1107  YGVPRRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSV  1166

Query  395   AFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSW  574
             AFSVDNRQIVSASRDRTIKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVS SW
Sbjct  1167  AFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDADAHSDWVSCVRFSPNNLQPTIVSASW  1226

Query  575   DRPXKSGI  598
             DR  K G+
Sbjct  1227  DRTVKDGV  1234



>ref|XP_009360100.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNS+ IVS+SRDKSII+W+L KD   +GV RRRLTGH
Sbjct  3    ENLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECK+TIQD DGH +WVSCVRFSPST+QPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPSTMQPTIVSASWDKTVK  176


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 64/132 (48%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L G
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPSTMQPTIVSASWDKTVKVWNLSN-----CKLRNTLEG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G   R +      ++       NR  +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYHLEAGSIIHALCFSPNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ +++IK+W+
Sbjct  250  CAATEQSIKIWD  261



>ref|XP_010487724.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +GDGH EW+SCVRFSP+TL PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVK  176



>ref|XP_008393404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
Length=326

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+AHTD VTAIA PIDNS+ IVS+SRDKSII+W+L KD   +GV RRRLTGH
Sbjct  3    ENLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G +ARRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECK+TIQD DGH +WVSCVRFSP+T+QPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVK  176


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 64/132 (48%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L G
Sbjct  137  ECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSN-----CKLRNTLEG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG + LWDL  G   R +      ++       NR  +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYHLEAGSIIHALCFSPNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ +++IK+W+
Sbjct  250  CAATEQSIKIWD  261



>ref|XP_010243791.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   294 bits (753),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTMK H+D VTAIA PIDNSD IVSSSRDKS++VW+LTK+   +GV RRRLTGH
Sbjct  3    ETLVLKGTMKGHSDMVTAIATPIDNSDMIVSSSRDKSVLVWHLTKEEGTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWD ELRLWDL  G T RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDSELRLWDLNTGVTTRRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVK  176


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 87/177 (49%), Gaps = 17/177 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +HT+WV+ +  +P     TIVS S D+++ VWNLT         R  LTG
Sbjct  137  ECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRCTLTG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H  +V  V +S DG    SG  DG   LWDL  G   R + +D    + S+ FS +   +
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLDAGAIIHSLCFSPNRYWL  249

Query  422  VSASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
             +A++D ++K+W+   E K  +QD       G N+ + C   S S+   T+ +G  D
Sbjct  250  CAATQD-SVKIWDL--ESKSIVQDLKPEATQGKNQMLYCTSLSWSSDGSTLFTGYTD  303



>ref|XP_010506450.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   294 bits (753),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +GDGH EW+SCVRFSP+TL PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVK  176



>ref|XP_006837182.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
 gb|ERN00036.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
Length=314

 Score =   293 bits (751),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTMK H+D VTAIA P+DNSD IVSSSRDKS+++W+LTK+   +GV RRRLTGH
Sbjct  3    ETLVLRGTMKGHSDMVTAIATPVDNSDVIVSSSRDKSVLLWHLTKEEGTYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVV+SSDGQFALSGSWDGELRLWDL  G T RRFV HTK+VLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVMSSDGQFALSGSWDGELRLWDLNTGMTTRRFVGHTKNVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDQDSHTNWVSCVRFSPNTYQPTIVSGSWDRTVK  176


 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 81/176 (46%), Gaps = 15/176 (9%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +HT+WV+ +  +P     TIVS S D+++ VWNLT         R  LTG
Sbjct  137  ECKYTIQDQDSHTNWVSCVRFSPNTYQPTIVSGSWDRTVKVWNLTN-----CKLRCTLTG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG   LWDL  G   R +      ++       NR  +
Sbjct  192  HAGYVNSVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLEAGGIIHALCFSPNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
             A+ + ++K+W+   E K  +QD         N+ + C   S ST   T+ +G  D
Sbjct  250  CAATEESVKIWDL--ESKSIVQDLKTDAPTNKNQMLYCTSLSWSTDGSTLFTGYTD  303



>ref|XP_010256121.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L+L+GTMK H+D VTAIA PIDNSD IVSSSRDKS++VW+LTK+   +GV RRRLTGH
Sbjct  3    ETLILKGTMKGHSDMVTAIATPIDNSDMIVSSSRDKSVLVWHLTKEEGIYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWD ELRLWDL  G T RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDSELRLWDLNTGATTRRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVK  176


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 86/177 (49%), Gaps = 17/177 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +HT+WV+ +  +P     TIVS S D+++ VWNLT         R  L G
Sbjct  137  ECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRCTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H  +V  V +S DG    SG  DG   LWDL  G   R + +D    + ++ FS +   +
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLDAGAIIHALCFSPNRYWL  249

Query  422  VSASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
             +A++D ++K+W+   E K  +QD       G N+ + C   S S+   T+ +G  D
Sbjct  250  CAATQD-SVKIWDL--ESKSIVQDLKPEATQGKNQMLYCTSLSWSSDGSTLFTGYTD  303



>emb|CDX92200.1| BnaA05g22070D [Brassica napus]
Length=325

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DW++ +  +P     TIVS+S DK++ VWNL     Q    +  L G
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLKSSLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EGGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  250  CAATESSIKIWD  261



>dbj|BAH56896.1| AT1G18080 [Arabidopsis thaliana]
Length=276

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  177



>ref|XP_009149259.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=328

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IVS+SRDKSIIVW LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDPIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD--GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +  G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIAEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 71/145 (49%), Gaps = 12/145 (8%)
 Frame = +2

Query  68   EC--LVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            EC   +  G  + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L
Sbjct  137  ECKYTIAEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTL  191

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GH+ +V  V +S DG    SG  DG + LWDL  G   + +      V+       NR 
Sbjct  192  AGHTGYVNTVAVSPDGSLCASGGKDGVVLLWDLAEGK--KLYSLEANSVIHALCFSPNRY  249

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
             + A+ ++ IK+W+   E K  ++D
Sbjct  250  WLCAATEQGIKIWDL--ESKSVVED  272



>ref|NP_188441.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
 sp|Q9LV28.1|GPLPC_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein C; AltName: Full=Receptor for activated C kinase 
1C [Arabidopsis thaliana]
 dbj|BAB02025.1| guanine nucleotide-binding protein; activated protein kinase 
C receptor; RACK1 [Arabidopsis thaliana]
 gb|AAK91355.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AAM26650.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AEE76051.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
Length=326

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+G M+AHTD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGIMRAHTDIVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G T RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +GDGH EWVSCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H +WV+ +  +P     TIVS+S DK++ VWNL     Q    R  L G
Sbjct  137  ECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLRNSLVG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +I++W+   E K  ++D
Sbjct  250  CAATENSIRIWDL--ESKSVVED  270



>emb|CDX95784.1| BnaC05g35350D [Brassica napus]
Length=325

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 64/132 (48%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DW++ +  +P     TIVS+S DK++ VWNL     Q    +  L G
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLKSSLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HLGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EGGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  250  CAATESSIKIWD  261



>emb|CDY18497.1| BnaA01g26980D [Brassica napus]
Length=326

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DW++ +  +P     TIVS+S DK++ VWNL     Q    +  L G
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLKSSLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EGGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  250  CAATESSIKIWD  261



>ref|XP_010097592.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
 gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
Length=330

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E LVLRGTM+AHTD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  1    MASEGLVLRGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWHLTKEDKAYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHSHFV+DVVLSSD QFALSGSWDGELRLWDL AG +ARRFV HTKDVLSVAFS+DNRQ
Sbjct  61   TGHSHFVEDVVLSSDSQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQ--DGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRDRTIKLWNTLGECKYTI    G+ H++WVSCVRFSPS LQPTIVS SWDR  K
Sbjct  121  IVSASRDRTIKLWNTLGECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVK  179


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 72/134 (54%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            +AH+DWV+ +  +P +   TIVS+S D+++ VWNL+         R  L+GH  +V  V 
Sbjct  149  EAHSDWVSCVRFSPSNLQPTIVSASWDRTVKVWNLSN-----CKLRNTLSGHGGYVNTVA  203

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G       D    + ++ FS  NR  + A+ + +IK
Sbjct  204  VSPDGSLCASGGKDGVILLWDLAEGKRLYSL-DAGAIIHALCFS-PNRYWLCAATENSIK  261

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  262  IWDL--ESKSIVED  273



>ref|XP_006416642.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
 gb|ESQ34995.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
Length=328

 Score =   292 bits (748),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L+L+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLILKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV H KDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGISTRRFVGHNKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +G  +GHN+WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGSEGHNDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 71/145 (49%), Gaps = 12/145 (8%)
 Frame = +2

Query  68   EC--LVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            EC   +  G  + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L
Sbjct  137  ECKYTISEGGSEGHNDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTL  191

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GH+ +V  V +S DG    SG  DG + LWDL  G   + +      V+       NR 
Sbjct  192  AGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGK--KLYSLEANSVIHALCFSPNRY  249

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
             + A+ ++ IK+W+   E K  ++D
Sbjct  250  WLCAATEQGIKIWDL--ESKSIVED  272



>ref|XP_002890259.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66518.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 67/134 (50%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L GH+ +V  V 
Sbjct  147  EGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTLAGHTGYVSTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G   + +      V+       NR  + A+ ++ IK
Sbjct  202  VSPDGSLCASGGKDGVVLLWDLAEGK--KLYSLEANSVIHALCFSPNRYWLCAATEQGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSIVED  271



>gb|EPS70887.1| hypothetical protein M569_03871 [Genlisea aurea]
Length=326

 Score =   292 bits (747),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+Q+ LVLRGTM+AHT+WVTAIA PIDNSD IV++SRDKSII+W LTK+   +GV RRRL
Sbjct  1    MSQDQLVLRGTMRAHTNWVTAIATPIDNSDMIVTASRDKSIILWALTKEDRTYGVPRRRL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGHS++VQDVVLSSDGQFALSGSWDG+LRLWDLQ G +ARRF  HTKDVLSVAFS DNRQ
Sbjct  61   TGHSNYVQDVVLSSDGQFALSGSWDGDLRLWDLQTGRSARRFAGHTKDVLSVAFSSDNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVSASRD+TIKLWNTLGECKYTIQD D H++WVSCVRFSP+T QPTIVSGSWD   K
Sbjct  121  IVSASRDKTIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNTQQPTIVSGSWDSTVK  177


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 70/139 (50%), Gaps = 9/139 (6%)
 Frame = +2

Query  92   MKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
               HT  V ++A   DN   IVS+SRDK+I +WN T    ++ +  +    HS +V  V 
Sbjct  102  FAGHTKDVLSVAFSSDNRQ-IVSASRDKTIKLWN-TLGECKYTIQDQ--DSHSDWVSCVR  157

Query  272  LSSDGQ--FALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
             S + Q    +SGSWD  +++W+L           HT  V +V+ S D     SA RD  
Sbjct  158  FSPNTQQPTIVSGSWDSTVKIWNLSNCKLRSTLAGHTGYVNAVSVSPDGSLCASAGRDGV  217

Query  446  IKLWNTLGECK--YTIQDG  496
            I LW+ L E K  Y+++ G
Sbjct  218  ILLWD-LAEGKRLYSLEAG  235



>ref|XP_006297909.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
 gb|EOA30807.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
Length=380

 Score =   293 bits (751),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 161/195 (83%), Gaps = 9/195 (5%)
 Frame = +2

Query  5    FQTLRFRPPNS*SQRERKMAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSII  184
             ++LR  P N        MA E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSII
Sbjct  45   LESLRSEPLN--------MA-EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSII  95

Query  185  VWNLTKDGPQFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF  364
            +W LTKD   +GVA+RRLTGHSHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRF
Sbjct  96   LWKLTKDDKSYGVAQRRLTGHSHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRF  155

Query  365  VDHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPST  544
            V HTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTI +GDGH EW+SCVRFSP+T
Sbjct  156  VGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNT  215

Query  545  LQPTIVSGSWDRPXK  589
              PTIVS SWD   K
Sbjct  216  NVPTIVSASWDHTVK  230


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 69/140 (49%), Gaps = 15/140 (11%)
 Frame = +2

Query  98   AHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT---GHSHFVQDV  268
             HT  V ++A  +DN   IVS+SRD++I +WN        G  +  ++   GH  ++  V
Sbjct  157  GHTKDVLSVAFSVDNRQ-IVSASRDRTIKLWN------TLGECKYTISEGDGHKEWISCV  209

Query  269  VLSSDGQFA--LSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDR  442
              S +      +S SWD  +++W+LQ        V HT  + +VA S D     S  +D 
Sbjct  210  RFSPNTNVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  269

Query  443  TIKLWNTLGECK--YTIQDG  496
             I LW+ L E K  Y+++ G
Sbjct  270  VILLWD-LAEGKKLYSLEAG  288



>ref|XP_010498185.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   292 bits (747),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDEKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD--GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +  G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 73/145 (50%), Gaps = 12/145 (8%)
 Frame = +2

Query  68   EC--LVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            EC   +  G  + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L
Sbjct  137  ECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTL  191

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GH+ +V  V +S DG    SG  DG + LWDL  G       +    + +V FS  NR 
Sbjct  192  AGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSL-EANSVIHAVCFS-PNRY  249

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
             + A+ ++ IK+W+   E K  ++D
Sbjct  250  WLCAATEQGIKIWDL--ESKTIVED  272



>gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thaliana]
Length=327

 Score =   291 bits (746),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H DWV+ +  +P     TIVS+S DK++ +WNL+         R  L GH+ +V  V 
Sbjct  147  EGHRDWVSCVRFSPNTLQPTIVSASWDKTVKMWNLSN-----CKLRSTLAGHTGYVSTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G   + +      V+       NR  + A+ +  IK
Sbjct  202  VSPDGSLCASGGKDGVVLLWDLAEGK--KLYSLEANSVIHALCFSPNRYWLCAATEHGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSIVED  271



>ref|NP_173248.1| guanine nucleotide-binding protein subunit beta-like protein 
A [Arabidopsis thaliana]
 sp|O24456.2|GBLPA_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; AltName: Full=Receptor for activated C kinase 
1A; AltName: Full=WD-40 repeat auxin-dependent protein ARCA 
[Arabidopsis thaliana]
 gb|AAF78369.1|AC069551_2 T10O22.6 [Arabidopsis thaliana]
 gb|AAF97825.1|AC034107_8 Identical to WD-40 repeat protein (AtArcA) from Arabidopsis thaliana 
gb|U77381 and contains multiple WD (G-beta repeat) PF|00400 
domains. ESTs gb|Z17972, gb|AI099926, gb|T42961, gb|R30131, 
gb|AV541608, gb|AV532234, gb|AV543299, gb|AV440652 come 
from this gene [Arabidopsis thaliana]
 gb|AAK59512.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAL34190.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAM66016.1| WD-40 repeat protein [Arabidopsis thaliana]
 gb|AEE29673.1| WD-40 repeat ArcA-like protein [Arabidopsis thaliana]
Length=327

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 66/134 (49%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L GH+ +V  V 
Sbjct  147  EGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTLAGHTGYVSTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G   + +      V+       NR  + A+ +  IK
Sbjct  202  VSPDGSLCASGGKDGVVLLWDLAEGK--KLYSLEANSVIHALCFSPNRYWLCAATEHGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSIVED  271



>ref|XP_010923802.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 152/183 (83%), Gaps = 9/183 (5%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------QFG  220
            + L+LRGTM+ HTD VTAIA PIDNSD IVSSSRDKS++VWNLTKD P          +G
Sbjct  3    DTLILRGTMRGHTDVVTAIATPIDNSDMIVSSSRDKSVLVWNLTKDAPLSSEGAGASSYG  62

Query  221  VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAF  400
            V RRRLTGHSHFV+DVVLSSDGQFALSGSWD ELRLWDL  G T RRFV HTKDVLSVAF
Sbjct  63   VPRRRLTGHSHFVEDVVLSSDGQFALSGSWDSELRLWDLNTGVTTRRFVGHTKDVLSVAF  122

Query  401  SVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDR  580
            SVDNRQIVSASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDR
Sbjct  123  SVDNRQIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDR  182

Query  581  PXK  589
              K
Sbjct  183  TVK  185


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 17/177 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS S D+++ VWNLT         R  LTG
Sbjct  146  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVWNLTN-----CKLRCTLTG  200

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H  +V  V +S DG    SG  DG   LWDL  G   R + +D    + ++ FS +   +
Sbjct  201  HGGYVNAVAVSPDGSLCASGGKDGITLLWDLAEG--KRLYSLDAGAIIYALCFSPNRYWL  258

Query  422  VSASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
             +A++D ++K+W+   E K  +QD         N+ + C   S S    T+ +G  D
Sbjct  259  CAATQD-SVKIWDL--ESKSIVQDLKPETPTSKNQMLYCTSLSWSADGSTLFTGYTD  312



>ref|XP_010476972.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   291 bits (745),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD--GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +  G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 74/145 (51%), Gaps = 12/145 (8%)
 Frame = +2

Query  68   EC--LVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            EC   +  G  + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L
Sbjct  137  ECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTL  191

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GH+ +V  V +S DG    SG  DG + LWDL  G     F +    + ++ FS  NR 
Sbjct  192  AGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSF-EANSVIHALCFS-PNRY  249

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
             + A+ ++ IK+W+   E K  ++D
Sbjct  250  WLCAATEQGIKIWDL--ESKTIVED  272



>emb|CDX95554.1| BnaC01g34460D [Brassica napus]
Length=326

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH +W+SCVRFSP+T+ PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTVVPTIVSASWDKTVK  176


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DW++ +  +P     TIVS+S DK++ VWNL     Q    +  L G
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTVVPTIVSASWDKTVKVWNL-----QNCKLKSSLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EGGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  250  CAATESSIKIWD  261



>ref|XP_010924141.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 153/183 (84%), Gaps = 9/183 (5%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------QFG  220
            + LVLRGT++ H+D VTAIA PIDNSD IVSSSRDKSI+VW+LTKD P          +G
Sbjct  3    DTLVLRGTLRGHSDMVTAIATPIDNSDMIVSSSRDKSILVWHLTKDAPLSAEGAAASSYG  62

Query  221  VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAF  400
            V RRRLTGHSHFV+DVVLSSDGQFALSGSWDGELRLWDL  GTT RRFV HTKDVLSVAF
Sbjct  63   VPRRRLTGHSHFVEDVVLSSDGQFALSGSWDGELRLWDLNTGTTTRRFVGHTKDVLSVAF  122

Query  401  SVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDR  580
            S+DNRQIVSASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDR
Sbjct  123  SIDNRQIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAFQPTIVSASWDR  182

Query  581  PXK  589
              K
Sbjct  183  TVK  185


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 85/177 (48%), Gaps = 17/177 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS+S D+++ VWNLT         R  LTG
Sbjct  146  ECKYTIQDADAHTNWVSCVRFSPNAFQPTIVSASWDRTVKVWNLTN-----CKLRSTLTG  200

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG   LWDL  G   R + +D    + S+ FS  NR  
Sbjct  201  HSGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLDAGAIIHSLCFS-PNRYW  257

Query  422  VSASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            + A+   ++K+W+   E K  +QD         N+ + C   S S    T+ +G  D
Sbjct  258  LCAATQESVKIWDL--ESKSIVQDLKPETPTSKNQMLYCTSLSWSADGSTLFTGYTD  312



>ref|XP_010500401.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVA+RR+TGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 71/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H+DWV+ +  +P     TIVS+S DK++ VWNL     Q    R  L G
Sbjct  137  ECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSVIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +I++W+   E K  ++D
Sbjct  250  CAATENSIRIWDL--ESKTVVED  270



>ref|XP_009110365.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brassica rapa]
Length=327

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDQVTAIATPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDG+LRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGKLRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIAEGGEGHGDWVSCVRFSPNTLQPTIVSASWDKTVK  177


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 67/134 (50%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L GH+ +V  V 
Sbjct  147  EGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTLAGHTGYVNTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G   + +      V+       NR  + A+ ++ IK
Sbjct  202  VSPDGSLCASGGKDGVVLLWDLAEGK--KLYSLEANSVIHALCFSPNRYWLCAATEQGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSVVED  271



>ref|XP_010479287.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVA+RR+TGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 71/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H+DWV+ +  +P     TIVS+S DK++ VWNL     Q    R  L G
Sbjct  137  ECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSVIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +I++W+   E K  ++D
Sbjct  250  CAATENSIRIWDL--ESKTVVED  270



>ref|XP_009145932.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=325

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSW GELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWAGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DW++ +  +P     TIVS+S DK++ VWNL     Q    +  L G
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLKSSLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EGGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  250  CAATESSIKIWD  261



>ref|XP_010461692.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVA+RR+TGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 71/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H+DWV+ +  +P     TIVS+S DK++ VWNL     Q    R  L G
Sbjct  137  ECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSVIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +I++W+   E K  ++D
Sbjct  250  CAATENSIRIWDL--ESKIVVED  270



>ref|XP_002894122.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70381.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   290 bits (742),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA P+DNSD IV+SSRDKSII+W LTK+   +GVA+RR+TGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H +WV+ +  +P     TIVS+S DK++ VWNL     Q    R  L G
Sbjct  137  ECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +I++W+   E K  ++D
Sbjct  250  CAATENSIRIWDL--ESKSVVED  270



>ref|XP_002885240.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61499.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=327

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 154/175 (88%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVK  177


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H +W++ +  +P     TIVS+S D ++ VWNL     Q    R  L GHS ++  V +
Sbjct  148  GHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNL-----QNCKLRNSLVGHSGYLNTVAV  202

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG + LWDL  G       +    + S+ FS  NR  + A+ + +IK+
Sbjct  203  SPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWLCAATENSIKI  260

Query  455  WNTLGECKYTIQD  493
            W+   E K  ++D
Sbjct  261  WDL--ESKSVVED  271



>gb|AAM65407.1| guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
Length=326

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA P+DNSD IV+SSRDKSII+W LTK+   +GVA+RR+TGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H +WV+ +  +P     TIVS+S DK++ VWNL     Q    R  L G
Sbjct  137  ECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +I++W+   E K  ++D
Sbjct  250  CAATENSIRIWDL--ESKSVVED  270



>ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
 sp|Q9C4Z6.1|GPLPB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; AltName: Full=Receptor for activated C kinase 
1B [Arabidopsis thaliana]
 gb|AAG50846.1|AC074308_2 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAG60127.1|AC073555_11 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAL24080.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAM14291.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AEE32329.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
Length=326

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA P+DNSD IV+SSRDKSII+W LTK+   +GVA+RR+TGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H +WV+ +  +P     TIVS+S DK++ VWNL     Q    R  L G
Sbjct  137  ECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +I++W+   E K  ++D
Sbjct  250  CAATENSIRIWDL--ESKSVVED  270



>ref|XP_008803271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=323

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 153/183 (84%), Gaps = 9/183 (5%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------QFG  220
            + LVLRGT++ H+D VTAIAAPIDNSD IVSSSRDKSI+VWNLTKD P          +G
Sbjct  3    DTLVLRGTLRGHSDMVTAIAAPIDNSDMIVSSSRDKSILVWNLTKDAPLSAEGAAASSYG  62

Query  221  VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAF  400
            V RRRLTGHSHFV+DVVLSSDGQFALSG+WDGELRLWDL  G T RRFV HTKDVLSVAF
Sbjct  63   VPRRRLTGHSHFVEDVVLSSDGQFALSGAWDGELRLWDLNTGITTRRFVGHTKDVLSVAF  122

Query  401  SVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDR  580
            S+DNRQIVSASRDRTI+LWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDR
Sbjct  123  SIDNRQIVSASRDRTIRLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDR  182

Query  581  PXK  589
              K
Sbjct  183  TVK  185


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 86/177 (49%), Gaps = 17/177 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS+S D+++ VWNLT         R  LTG
Sbjct  146  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTVKVWNLTN-----CKLRCTLTG  200

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H  +V  V +S DG    SG  DG   LWDL  G   R + +D    + S+ FS +   +
Sbjct  201  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLDAGAIIHSLCFSPNRYWL  258

Query  422  VSASRDRTIKLWNTLGECKYTIQDGD-----GHNEWVSCVRFSPSTLQPTIVSGSWD  577
             +A++D ++K+W+   E K  +QD         N+ + C   S S    T+ +G  D
Sbjct  259  CAATQD-SVKIWDL--ESKSIVQDLKPETPISKNQMLYCTSLSWSADGSTLFTGYTD  312



>ref|XP_010916329.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=324

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 154/184 (84%), Gaps = 10/184 (5%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ----------F  217
            E LVL+GT++ H+  VTAIAAP+DNSD +VSSSRDKS++VW+LTKD P           +
Sbjct  3    ETLVLKGTLRGHSGAVTAIAAPLDNSDMVVSSSRDKSVLVWHLTKDSPAAAAGEPGGSAY  62

Query  218  GVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVA  397
            GV RRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV HTKDVLSVA
Sbjct  63   GVPRRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVA  122

Query  398  FSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            FSVDNRQIVSASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWD
Sbjct  123  FSVDNRQIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNTFQPTIVSGSWD  182

Query  578  RPXK  589
            R  K
Sbjct  183  RTVK  186


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 74/144 (51%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS S D+++ VWNLT         R  LTG
Sbjct  147  ECKYTIQDADAHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRSTLTG  201

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H  +V  V +S DG    SG  DG   LWDL  G   R + +D    + ++ FS +   +
Sbjct  202  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLDAGAIIYALCFSPNRYWL  259

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
             +A++D ++K+W+   E K  +QD
Sbjct  260  CAATQD-SVKIWDL--ESKSIVQD  280



>ref|XP_006305339.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
 gb|EOA38237.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
Length=328

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD--GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +  G+GH +WVSCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGGEGHRDWVSCVRFSPNTLHPTIVSASWDKTVK  178


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 71/145 (49%), Gaps = 12/145 (8%)
 Frame = +2

Query  68   EC--LVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            EC   +  G  + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L
Sbjct  137  ECKYTISEGGGEGHRDWVSCVRFSPNTLHPTIVSASWDKTVKVWNLSN-----CKLRSTL  191

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GH+ +V  V +S DG    SG  DG + LWDL  G   + +      V+       NR 
Sbjct  192  AGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGK--KLYSLEANSVIHALCFSPNRY  249

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
             + A+ ++ IK+W+   E K  ++D
Sbjct  250  WLCAATEQGIKIWDL--ESKSIVED  272



>sp|Q39336.1|GBLP_BRANA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Brassica napus]
 emb|CAA83924.1| guanine nucleotide regulatory protein [Brassica napus]
Length=327

 Score =   289 bits (740),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GV +RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVRQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + G+GH +WVSCVRFSP+TLQPTIVS S D+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASCDKTVK  177


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 67/134 (50%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L GH+ +V  V 
Sbjct  147  EGHRDWVSCVRFSPNTLQPTIVSASCDKTVKVWNLSN-----CKLRSTLAGHTGYVSTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G   + +      V+       NR  + A+ ++ IK
Sbjct  202  VSPDGSLCASGGKDGVVLLWDLAEG--KKLYSLEANSVIHALCFTPNRYWLCAATEQGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKTVVED  271



>gb|KFK39137.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   289 bits (739),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSII+W L KD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDQVTAIATPIDNSDIIVTASRDKSIILWKLNKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G T RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGLTTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVK  177


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H +W++ +  +P     TIVS+S D ++ VWNL     Q    R  L GHS ++  V +
Sbjct  148  GHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNL-----QNCKLRNSLAGHSGYLNTVAV  202

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG + LWDL  G       +    + S+ FS  NR  + A+ + +IK+
Sbjct  203  SPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWLCAATENSIKI  260

Query  455  WNTLGECKYTIQD  493
            W+   E K  ++D
Sbjct  261  WDL--ESKSVVED  271



>ref|XP_010540016.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   289 bits (739),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+DTIVSSSRDKS+I+W LTKD   +GV +RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADTIVSSSRDKSVILWKLTKDDKAYGVPQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  GT+ RRFV H+KDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGTSTRRFVGHSKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD--GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDR+IKLWNTLGECKYTI +  G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRSIKLWNTLGECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 74/145 (51%), Gaps = 12/145 (8%)
 Frame = +2

Query  68   EC--LVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            EC   +  G  + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L
Sbjct  137  ECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTL  191

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GH+ +V  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR 
Sbjct  192  VGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSL-EAGAVIHSLCFS-PNRY  249

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
             + A+ +++IK+W+   E K  ++D
Sbjct  250  WLCAATEQSIKIWDL--ESKSIVED  272



>ref|XP_006406649.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
 gb|ESQ48102.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
Length=327

 Score =   289 bits (739),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSII+W LTKD   +G A+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDEKSYGYAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVK  177


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H +W++ +  +P     TIVS+S D ++ VWNL     Q    +  L GHS ++  V +
Sbjct  148  GHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNL-----QNCKLKNSLAGHSGYLNTVAV  202

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG + LWDL  G       +    + S+ FS  NR  + A+ + +IK+
Sbjct  203  SPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWLCAATENSIKI  260

Query  455  WNTLGECKYTIQD  493
            W+   E K  ++D
Sbjct  261  WDL--ESKSVVED  271



>ref|XP_010537487.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDN+D IVSSSRDKSI++W LTKD   +GV +RRLTGH
Sbjct  3    EGLVLKGTMRAHTDEVTAIATPIDNADIIVSSSRDKSIVLWKLTKDEKAYGVPQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  GT+ RRFV HTKDV+SVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGTSTRRFVGHTKDVISVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD--GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDR+IKLWNTLGECKYTI +  G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  123  ASRDRSIKLWNTLGECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  178


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 73/145 (50%), Gaps = 12/145 (8%)
 Frame = +2

Query  68   EC--LVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            EC   +  G  + H DWV+ +  +P     TIVS+S DK++ VWNL          R  L
Sbjct  137  ECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLLN-----CKLRSTL  191

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GH+ +V  V +S DG    SG  DG + LWDL  G       +    + ++ FS  NR 
Sbjct  192  VGHTGYVSTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGAVIHALCFS-PNRY  249

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
             + A+ +++IK+W+   E K  ++D
Sbjct  250  WLCAATEQSIKIWDL--ESKSIVED  272



>ref|XP_009380503.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Musa acuminata subsp. malaccensis]
Length=323

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 152/184 (83%), Gaps = 10/184 (5%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP----------QF  217
            + LVLRGTM+ HTD VTAIAAPIDNSD IVSSSRDKS++VW+LTKD P           +
Sbjct  3    DTLVLRGTMRGHTDMVTAIAAPIDNSDMIVSSSRDKSVLVWHLTKDAPAASADGSGVGSY  62

Query  218  GVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVA  397
            GV RRRLTGHSHFVQDVVLSSDGQFALSGSWDG+LRLWDL  G T RRF  HTKDVLSVA
Sbjct  63   GVPRRRLTGHSHFVQDVVLSSDGQFALSGSWDGDLRLWDLSTGVTTRRFFGHTKDVLSVA  122

Query  398  FSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            FS+DNRQIVSASRD TIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWD
Sbjct  123  FSIDNRQIVSASRDGTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWD  182

Query  578  RPXK  589
            R  K
Sbjct  183  RTVK  186


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 82/177 (46%), Gaps = 17/177 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS S D+++ VWNLT         R  L G
Sbjct  147  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVWNLTN-----CKLRCTLAG  201

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H+  V  V +S DG    SG  DG   LWDL  G   R + +D    + S+ FS  NR  
Sbjct  202  HAGSVNTVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLDAGAIIHSLCFS-PNRYW  258

Query  422  VSASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            + A+   ++K+W+   E K  +QD         N+ + C   + S    T+ +G  D
Sbjct  259  LCAATQESVKIWDL--ESKSIVQDLKPEITTTKNQMLYCTSLTWSANGSTLFTGYTD  313



>ref|XP_010465892.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRD TIKLWNTLGECKYTI +GDGH EW+SCVRFSP+T  PTIVS SWD   K
Sbjct  123  ASRDCTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTHVPTIVSASWDHTVK  176


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 68/140 (49%), Gaps = 15/140 (11%)
 Frame = +2

Query  98   AHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT---GHSHFVQDV  268
             HT  V ++A  +DN   IVS+SRD +I +WN        G  +  ++   GH  ++  V
Sbjct  103  GHTKDVLSVAFSVDNRQ-IVSASRDCTIKLWN------TLGECKYTISEGDGHKEWISCV  155

Query  269  VLSSDGQFA--LSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDR  442
              S +      +S SWD  +++W+LQ        V HT  + +VA S D     S  +D 
Sbjct  156  RFSPNTHVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  443  TIKLWNTLGECK--YTIQDG  496
             I LW+ L E K  Y+++ G
Sbjct  216  VILLWD-LAEGKKLYSLEAG  234



>ref|XP_009400497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   287 bits (734),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 152/185 (82%), Gaps = 11/185 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ-----------  214
            + LVLRGTM+ HTD VTAIAAPIDNSD IVSSSRDKS++VW+LTKD P            
Sbjct  3    DTLVLRGTMRGHTDMVTAIAAPIDNSDMIVSSSRDKSVLVWHLTKDAPSASGDGTATGSS  62

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV +RRLTGHSHFVQDVVLSSDGQFALSGSWDG+LRLWDL  G T RRF  HTKDVLSV
Sbjct  63   YGVPKRRLTGHSHFVQDVVLSSDGQFALSGSWDGDLRLWDLSTGVTTRRFSGHTKDVLSV  122

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSW  574
            AFS+DNRQIVSASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVS SW
Sbjct  123  AFSIDNRQIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASW  182

Query  575  DRPXK  589
            DR  K
Sbjct  183  DRTIK  187


 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 84/177 (47%), Gaps = 17/177 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS+S D++I VWNLT         R  L G
Sbjct  148  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTIKVWNLTN-----CKLRCTLAG  202

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG   LWDL  G   R + +D    + S+ FS  NR  
Sbjct  203  HAGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLDAGAIIHSLCFS-PNRYW  259

Query  422  VSASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            + A+   ++K+W+   E K  +QD         N+ + C   + S    T+ +G  D
Sbjct  260  LCAATQESVKIWDL--ESKSIVQDLKPETTGTKNQMLYCTSLTWSADGSTLFTGYTD  314



>ref|XP_009405003.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   287 bits (734),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 153/185 (83%), Gaps = 11/185 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ-----------  214
            + LVLRGTM+ H+D VTAIAAP+DNSD IVSSSRDKS++VW+LTKD P            
Sbjct  3    DTLVLRGTMRGHSDMVTAIAAPVDNSDMIVSSSRDKSVLVWHLTKDAPAALADGSGAGSA  62

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV RRRLTGHSHFV+DVVLSSDGQFALSGSWDG+LRLWDL  G T RRF  HTKDVLSV
Sbjct  63   YGVPRRRLTGHSHFVEDVVLSSDGQFALSGSWDGDLRLWDLSTGATTRRFSGHTKDVLSV  122

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSW  574
            +FSVDNRQIVSASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVSGSW
Sbjct  123  SFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSW  182

Query  575  DRPXK  589
            DR  K
Sbjct  183  DRTIK  187


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 83/177 (47%), Gaps = 17/177 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS S D++I VWNLT         R  L G
Sbjct  148  ECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTIKVWNLTN-----CKLRSTLAG  202

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG   LWDL  G   R + +D    + S+ FS  NR  
Sbjct  203  HSGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEG--KRLYSLDAGAIIHSLCFS-PNRYW  259

Query  422  VSASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            + A+   ++K+W+   E K  +QD         N+ + C   + S    T+ +G  D
Sbjct  260  LCAATQESVKIWDL--ESKTIVQDLKPETTTTKNQMLYCTSLTWSADGSTLFTGYTD  314



>ref|XP_006305354.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
 gb|EOA38252.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
Length=326

 Score =   287 bits (734),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA P+DNSD IV+SSRDKSII+W LTK+   +GVA+RR+TGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV H KDVLSVAFS DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHKKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI +GDGH++WVSCVRFSP+T +PTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEGDGHSDWVSCVRFSPNTHEPTIVSASWDRTVK  176


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H+DWV+ +  +P  +  TIVS+S D+++ VWNL     Q    R  L G
Sbjct  137  ECKYTISEGDGHSDWVSCVRFSPNTHEPTIVSASWDRTVKVWNL-----QNCKLRNTLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+ + +I++W+   E K  ++D
Sbjct  250  CAATENSIRIWDL--ESKSVVED  270



>gb|ABK26798.1| unknown [Picea sitchensis]
 gb|ACN40746.1| unknown [Picea sitchensis]
 gb|ACN40912.1| unknown [Picea sitchensis]
Length=316

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGTM+ HTD VTAIA PIDNSD IVSSSRDKSI++WNLTK+  ++GV RRRLTGH
Sbjct  3    EALVLRGTMEGHTDAVTAIATPIDNSDMIVSSSRDKSILLWNLTKEPEKYGVPRRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVV+SSDGQFALSGSWD ELRLWDL  G T RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVISSDGQFALSGSWDSELRLWDLNTGLTTRRFVGHTKDVLSVAFSIDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQ-DGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQ D +GH+ W+SCVRFSPS   PTIVS SWDR  K
Sbjct  123  ASRDRTIKLWNTLGECKYTIQPDAEGHSNWISCVRFSPSATNPTIVSCSWDRTVK  177


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (8%)
 Frame = +2

Query  68   EC-LVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT  241
            EC   ++   + H++W++ +  +P   + TIVS S D+++ VWNLT         R  L 
Sbjct  137  ECKYTIQPDAEGHSNWISCVRFSPSATNPTIVSCSWDRTVKVWNLTN-----CKLRNTLV  191

Query  242  GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQI  421
            GH  +V    +S DG    SG  DG   LWDL  G   R +     D++       NR  
Sbjct  192  GHGGYVNTAAVSPDGSLCASGGKDGVTMLWDLAEG--KRLYSLDAGDIIYALCFSPNRYW  249

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+  + +K+W+   E K  + D
Sbjct  250  LCAATQQCVKIWDL--ESKSIVAD  271



>ref|XP_006393380.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
 gb|ESQ30666.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
Length=327

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKEDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV H+KDVLSVAFS DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHSKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI D GDGH EWVSCVRFSP+ L PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISDQGDGHKEWVSCVRFSPNMLVPTIVSASWDHTVK  177


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H +WV+ +  +P     TIVS+S D ++ VWNL     Q    +  L GHS ++  V +
Sbjct  148  GHKEWVSCVRFSPNMLVPTIVSASWDHTVKVWNL-----QNCKLKNTLAGHSGYLNTVAV  202

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG + LWDL  G       +    + S+ FS  NR  + A+ + +I++
Sbjct  203  SPDGSLCASGGKDGVILLWDLAEGKKLYSL-EAGSVIHSLCFS-PNRYWLCAATESSIRI  260

Query  455  WNTLGECKYTIQD  493
            W+   E K  ++D
Sbjct  261  WDL--ESKSVVED  271



>ref|XP_010549078.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   284 bits (727),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA P+DN+D IVSSSRDKSI++W LTKD   +GV +RRLTGH
Sbjct  3    EGLVLKGTMRAHTDAVTAIATPVDNADFIVSSSRDKSIVLWKLTKDDKSYGVPQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI D  +GH EWVSCVRFSP+TL PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISDQSEGHREWVSCVRFSPNTLVPTIVSASWDHTVK  177


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 67/134 (50%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H +WV+ +  +P     TIVS+S D ++ VWNL     Q    R  L GHS ++  V 
Sbjct  147  EGHREWVSCVRFSPNTLVPTIVSASWDHTVKVWNL-----QNCKLRNTLVGHSGYLNTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G       D    + S+ FS  NR  + A+ +  IK
Sbjct  202  VSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGAVIHSLCFS-PNRYWLCAATEHGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSIVED  271



>ref|XP_001780288.1| predicted protein [Physcomitrella patens]
 gb|EDQ54847.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGT+K H++WVTAIA P+DN D I+SSSRDKSIIVW LT++   +GVARRRLTGH
Sbjct  3    ETLVLRGTLKGHSNWVTAIACPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            +HFVQDVV+SSDGQFALSGSWDG LRLWDL  GTT RRF+ HTKDVLSVAFSVDNRQIVS
Sbjct  63   AHFVQDVVISSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLGECKYTIQD DGH  WVSCVRFSP T  P IVSG WD+  K
Sbjct  123  GSRDKTIKLWNTLGECKYTIQDVDGHTGWVSCVRFSPVTANPIIVSGGWDKVVK  176


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 64/133 (48%), Gaps = 10/133 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC      +  HT WV+ +  +P+  +  IVS   DK + VWNLT         R  L G
Sbjct  137  ECKYTIQDVDGHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCK-----IRTNLVG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL-SVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG   LWDL  G   R +     D++ S+ FS  NR  
Sbjct  192  HTGYVNTVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDAGDIIHSLCFS-PNRYW  248

Query  422  VSASRDRTIKLWN  460
            + A+    IK+W+
Sbjct  249  LCAATQSCIKIWD  261



>ref|XP_010926201.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=299

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 151/188 (80%), Gaps = 14/188 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP------------  211
            E LV +GTM+ H+D VTAIA P+DNSD IVSSSRDKS++VW+LTK  P            
Sbjct  3    ETLVFKGTMRGHSDVVTAIATPLDNSDMIVSSSRDKSVLVWHLTKASPVAVAGDSSATSA  62

Query  212  --QFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDV  385
               +GV RRRLTGHSHFV+DVVLSSDGQFALSGSWDGELRLWDL  GTT RRFV H+KDV
Sbjct  63   VPSYGVPRRRLTGHSHFVEDVVLSSDGQFALSGSWDGELRLWDLATGTTTRRFVGHSKDV  122

Query  386  LSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVS  565
            LSV  SVDNRQIVSASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVS
Sbjct  123  LSVVLSVDNRQIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNTSQPTIVS  182

Query  566  GSWDRPXK  589
            GSWDR  K
Sbjct  183  GSWDRTVK  190


 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 14/145 (10%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P  +  TIVS S D+++ VWNLT         R  LTG
Sbjct  151  ECKYTIQDADAHTNWVSCVRFSPNTSQPTIVSGSWDRTVKVWNLTS-----CKLRSTLTG  205

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF--VDHTKDVLSVAFSVDNRQ  418
            H  +V  V +S DG    SG  DG   LWDL  G   RR   +D    +  + FS     
Sbjct  206  HGGYVNAVAVSPDGSLCASGGKDGVALLWDLAEG---RRLYSLDAGAIIHGLCFSPSRYW  262

Query  419  IVSASRDRTIKLWNTLGECKYTIQD  493
            + +A++D ++K+W+   E K  +QD
Sbjct  263  LCAATQD-SVKIWDL--ESKSIVQD  284



>ref|XP_008812615.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=331

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 152/191 (80%), Gaps = 17/191 (9%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------QFG  220
            + L+LRGTM+ H+D VT IA PIDNSD IVSSSRDKSI+VW+LTKD P          +G
Sbjct  3    DTLILRGTMRGHSDVVTGIATPIDNSDMIVSSSRDKSILVWHLTKDAPLSTDGAAASSYG  62

Query  221  VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAF  400
            V RRRLTGHSHFV+DVVLSSDGQFALSGSWDGELRLWDL  G T RRFV HTKDVLSVAF
Sbjct  63   VPRRRLTGHSHFVEDVVLSSDGQFALSGSWDGELRLWDLNTGATTRRFVGHTKDVLSVAF  122

Query  401  SVDNRQIVSASRDRTIKLWNTLGECKYTIQ--------DGDGHNEWVSCVRFSPSTLQPT  556
            SVDNRQIVSASRDRTIKLWNTLGECKYTIQ        D DGH  WVSCVRFSP+  QP 
Sbjct  123  SVDNRQIVSASRDRTIKLWNTLGECKYTIQDADGHTNWDADGHTNWVSCVRFSPNAFQPI  182

Query  557  IVSGSWDRPXK  589
            IVSGSWDR  K
Sbjct  183  IVSGSWDRTVK  193


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 80/167 (48%), Gaps = 17/167 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             HT+WV+ +  +P      IVS S D+++ VWNLT         R  L GH  +V  V +
Sbjct  164  GHTNWVSCVRFSPNAFQPIIVSGSWDRTVKVWNLTN-----CKLRCTLAGHGGYVSAVAV  218

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            S DG    SG  DG   LWDL  G   R + +D    + ++ FS +   + +A++D ++K
Sbjct  219  SPDGSLCASGGKDGITLLWDLAEG--KRLYSLDAGAIIHALCFSPNRYWLCAATQD-SVK  275

Query  452  LWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            +W+   E K  +QD         N+ + C   S S    T+ +G  D
Sbjct  276  IWDL--ENKSIVQDLKPETPTSKNQMLYCTSLSWSADGSTLFTGYTD  320



>ref|XP_009113515.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=326

 Score =   281 bits (719),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLS  GQFALSGSWDGELRLWDL  G + RRFV HTK VLSVAFSV NRQI S
Sbjct  63   SHFVEDVVLSPAGQFALSGSWDGELRLWDLATGVSTRRFVGHTKYVLSVAFSVANRQIAS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+  K
Sbjct  123  ASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVK  176


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         H DW++ +  +P     TIVS+S DK++ VWNL     Q    +  L G
Sbjct  137  ECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNL-----QNCKLKSSLAG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  +
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-EGGSIIHSLCFS-PNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  250  CAATESSIKIWD  261



>ref|XP_008811978.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A [Phoenix dactylifera]
Length=316

 Score =   281 bits (718),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 151/184 (82%), Gaps = 10/184 (5%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFG---------  220
            E LVL+GT++ H+  VTAIAAP+DNSD IVSSSRDKS++VW+LTKD P            
Sbjct  3    ETLVLKGTLRGHSGPVTAIAAPLDNSDMIVSSSRDKSVLVWHLTKDSPAAAAGEPGGAAY  62

Query  221  -VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVA  397
             + RRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV HTKDVLSVA
Sbjct  63   GIPRRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVA  122

Query  398  FSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            FS+DNRQIVSASRDRTIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWD
Sbjct  123  FSIDNRQIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNNFQPTIVSGSWD  182

Query  578  RPXK  589
            R  K
Sbjct  183  RTVK  186


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 81/176 (46%), Gaps = 23/176 (13%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P +   TIVS S D+++ VWNLT         R  LTG
Sbjct  147  ECKYTIQDADAHTNWVSCVRFSPNNFQPTIVSGSWDRTVKVWNLTN-----CKLRSTLTG  201

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG   LWDL          +      S+ FS +   + 
Sbjct  202  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDL---------AEEKDXGHSLCFSPNRYWLC  252

Query  425  SASRDRTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            +A++D ++K+W+   E K  +QD         N+ + C   S S    T+ +G  D
Sbjct  253  AATQD-SVKIWDL--ESKSIVQDLRPETPTSKNQILYCTSLSWSADGSTLFTGYTD  305



>ref|XP_001779496.1| predicted protein [Physcomitrella patens]
 gb|EDQ55672.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGT+K H++WVTAIA P+DN D I+SSSRDKSIIVW LT++   +GVARRRLTGH
Sbjct  3    ETLVLRGTLKGHSNWVTAIACPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            +HFVQDVV+SSDGQFALSGSWDG LRLWDL  GTT RRF+ HTKDVLSVAFSVDNRQIVS
Sbjct  63   AHFVQDVVISSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLGECKYTIQD D H  WVSCVRFSP T  P IVSG WD+  K
Sbjct  123  GSRDKTIKLWNTLGECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVK  176


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 65/133 (49%), Gaps = 10/133 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC      + AHT WV+ +  +P+  +  IVS   DK + VWNLT         R  L G
Sbjct  137  ECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTN-----CKIRSNLVG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL-SVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG   LWDL  G   R +     D++ S+ FS  NR  
Sbjct  192  HTGYVNTVTVSPDGSLCASGGKDGVAMLWDLSEG--KRLYSLDAGDIIHSLCFS-PNRYW  248

Query  422  VSASRDRTIKLWN  460
            + A+    IK+W+
Sbjct  249  LCAATQSCIKIWD  261



>ref|XP_010549077.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 150/175 (86%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AH D VTAIA P+DN+D IVSSSRDKSI+VW L+KD   +GV +RRLTGH
Sbjct  3    EGLVLKGTMRAHADAVTAIATPVDNADFIVSSSRDKSIVVWKLSKDDKSYGVPQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVQDVVLSSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI D  +GH EWVSCVRFSP+ L PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISDQSEGHREWVSCVRFSPNMLVPTIVSASWDHTVK  177


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 66/134 (49%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H +WV+ +  +P     TIVS+S D ++ VWNL          R  L GHS +V  V 
Sbjct  147  EGHREWVSCVRFSPNMLVPTIVSASWDHTVKVWNL-----HNCKLRNTLVGHSGYVNTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G       D    + S+ FS  NR  + A+ +  IK
Sbjct  202  VSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGAVIHSLCFS-PNRYWLCAATEHGIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSIVED  271



>ref|XP_010551145.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AH D VTAIA P+DN+D IVSSSRDKSI++W LTK+   +GV +RRLTGH
Sbjct  3    EGLVLKGTMRAHADAVTAIATPVDNADFIVSSSRDKSIVLWKLTKEDKSYGVPQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDV LSSDGQFALSGSWDGELRLWDL  G ++RRFV HTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVQDVALSSDGQFALSGSWDGELRLWDLATGVSSRRFVGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTI D  +GH EWVSCVRFSP+TL PTIVS SWD   K
Sbjct  123  ASRDRTIKLWNTLGECKYTISDQSEGHREWVSCVRFSPNTLVPTIVSASWDHTVK  177


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H +WV+ +  +P     TIVS+S D ++ VWNL     Q    R  L GHS ++  V 
Sbjct  147  EGHREWVSCVRFSPNTLVPTIVSASWDHTVKVWNL-----QNCKLRNTLVGHSGYLNTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G      +D    + S+ FS  NR  + A+ +++IK
Sbjct  202  VSPDGSLCASGGKDGMILLWDLAEGKKLYS-LDAGDVIHSLCFS-PNRYWLCAATEQSIK  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSVVED  271



>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana
Length=694

 Score =   291 bits (744),  Expect = 2e-90, Method: Composition-based stats.
 Identities = 141/173 (82%), Positives = 156/173 (90%), Gaps = 1/173 (1%)
 Frame = +2

Query  74   LVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSH  253
            LVL+GTM+AHTD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGHSH
Sbjct  372  LVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSH  431

Query  254  FVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSAS  433
            FV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVSAS
Sbjct  432  FVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVSAS  491

Query  434  RDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            RDRTIKLWNTLGECKYTI + G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  492  RDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  544


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 44/134 (33%), Positives = 66/134 (49%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H DWV+ +  +P     TIVS+S DK++ VWNL+         R  L GH+ +V  V 
Sbjct  514  EGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSN-----CKLRSTLAGHTGYVSTVA  568

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G   + +      V+       NR  + A+ +  IK
Sbjct  569  VSPDGSLCASGGKDGVVLLWDLAEGK--KLYSLEANSVIHALCFSPNRYWLCAATEHGIK  626

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  627  IWDL--ESKSIVED  638



>ref|XP_001754916.1| predicted protein [Physcomitrella patens]
 gb|EDQ80370.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVLRGT+K H +WVTAIA P+DN D I+SSSRDKSIIVW+L+++   +GVARRRLTGH
Sbjct  3    ETLVLRGTLKGHANWVTAIACPLDNPDLILSSSRDKSIIVWHLSREEGNYGVARRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            +HFVQDVV+SSDGQFALSGSWDG LRLWDL  GTT RRF+ HTKDVLSVAFSVDNRQIVS
Sbjct  63   AHFVQDVVISSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLGECKYTIQD D H  WVSCVRFSP T  P IVSG WD+  K
Sbjct  123  GSRDKTIKLWNTLGECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVK  176


 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 65/133 (49%), Gaps = 10/133 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC      + AHT WV+ +  +P+  +  IVS   DK + VWNLT         R  L G
Sbjct  137  ECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCK-----IRTNLVG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL-SVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG   LWDL  G   R +     D++ S+ FS  NR  
Sbjct  192  HTGYVNTVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDAGDIIHSLCFS-PNRYW  248

Query  422  VSASRDRTIKLWN  460
            + A+    IK+W+
Sbjct  249  LCAATQTCIKIWD  261



>ref|XP_009145001.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Brassica rapa]
Length=327

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 149/173 (86%), Gaps = 1/173 (1%)
 Frame = +2

Query  74   LVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSH  253
            LVL+GTM AHTD VTAIA P+DNSD IV+SSRDKSII+W L +D   +GVA+RRLTGHSH
Sbjct  5    LVLKGTMCAHTDMVTAIATPVDNSDMIVTSSRDKSIILWKLNRDEKSYGVAQRRLTGHSH  64

Query  254  FVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSAS  433
            FV+DVVLSSDGQFALSGSWDGELRLWDL  G + RRFV HTKDVLSVAFS DNRQIVSAS
Sbjct  65   FVEDVVLSSDGQFALSGSWDGELRLWDLATGASTRRFVGHTKDVLSVAFSTDNRQIVSAS  124

Query  434  RDRTIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            RD TIKLWNTLGECKYTI D G+GH +WVSCVRFSP+TL PTIVS SWD   K
Sbjct  125  RDGTIKLWNTLGECKYTISDQGEGHKQWVSCVRFSPNTLVPTIVSASWDHTVK  177


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 10/134 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H  WV+ +  +P     TIVS+S D ++ VWNL          R  L GHS ++  V 
Sbjct  147  EGHKQWVSCVRFSPNTLVPTIVSASWDHTVKVWNLAN-----CKLRNTLAGHSGYLNTVA  201

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG + LWDL  G       +    + S+ FS  NR  + A+ + +I+
Sbjct  202  VSPDGSLCASGGKDGAILLWDLAEGKKLYSL-EAGSIIHSLCFS-PNRYWLCAATENSIR  259

Query  452  LWNTLGECKYTIQD  493
            +W+   E K  ++D
Sbjct  260  IWDL--ESKSVVED  271



>gb|ABK25010.1| unknown [Picea sitchensis]
 gb|ACN41136.1| unknown [Picea sitchensis]
Length=321

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 149/180 (83%), Gaps = 6/180 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ------FGVAR  229
            E LVLRGTMK H +WVT+IA PIDNSD I+S SRDKSI+VW+LTK+         +GVA+
Sbjct  3    ETLVLRGTMKGHDNWVTSIATPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAK  62

Query  230  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVD  409
            RRLTGHSHF+ DVV+SSDGQFALSGSWD  LRLWDL  G T RRFV H+KDVLSVAFS D
Sbjct  63   RRLTGHSHFIHDVVISSDGQFALSGSWDATLRLWDLNVGITTRRFVGHSKDVLSVAFSAD  122

Query  410  NRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            NRQIVSASRDR+IKLWNTLGECKYTIQD D H+ WVSCVRFSPST+ P IVSGSWDR  K
Sbjct  123  NRQIVSASRDRSIKLWNTLGECKYTIQDADAHSNWVSCVRFSPSTVNPMIVSGSWDRTVK  182


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 69/143 (48%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH++WV+ +  +P   +  IVS S D+++ VWNL          R  LTG
Sbjct  143  ECKYTIQDADAHSNWVSCVRFSPSTVNPMIVSGSWDRTVKVWNLAN-----CKLRTTLTG  197

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++    +S DG    SG  DG   LWDL  G   R +   + D+++      NR  +
Sbjct  198  HSGYINTCTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDSGDIINSLCFSPNRYWL  255

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+  + +K+W+   E K  +++
Sbjct  256  CAATQQCVKIWDL--ESKSVVEE  276



>gb|ACN41093.1| unknown [Picea sitchensis]
Length=321

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 148/180 (82%), Gaps = 6/180 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ------FGVAR  229
            E LVLRGTMK H +WVT+IA PIDNSD I+S SRDKSI+VW+LTK+         +GVA+
Sbjct  3    ETLVLRGTMKGHDNWVTSIATPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAK  62

Query  230  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVD  409
            RRLTGHSHF+ DVV+SSDGQFALSGSWD  LRLWDL  G T RRFV H+KDVLSVAFS D
Sbjct  63   RRLTGHSHFIHDVVISSDGQFALSGSWDATLRLWDLNVGITTRRFVGHSKDVLSVAFSAD  122

Query  410  NRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            NRQIVSASRDR+IKLWNTLGECKYTIQD D H  WVSCVRFSPST+ P IVSGSWDR  K
Sbjct  123  NRQIVSASRDRSIKLWNTLGECKYTIQDADAHTNWVSCVRFSPSTVNPMIVSGSWDRTVK  182


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 69/143 (48%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P   +  IVS S D+++ VWNL          R  LTG
Sbjct  143  ECKYTIQDADAHTNWVSCVRFSPSTVNPMIVSGSWDRTVKVWNLAN-----CKLRTTLTG  197

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++    +S DG    SG  DG   LWDL  G   R +   + D+++      NR  +
Sbjct  198  HSGYINTCTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDSGDIINSLCFSPNRYWL  255

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+  + +K+W+   E K  +++
Sbjct  256  CAATQQCVKIWDL--ESKSVVEE  276



>ref|XP_009147950.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein B [Brassica rapa]
Length=328

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM AHTD VTAIA PID+SDTIV+SSRDKSII+  LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDSSDTIVTSSRDKSIILXKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DV LSSDGQFALSGSWD ELRLWDL  G + RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVEDVALSSDGQFALSGSWDDELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRD TIKLWNTLGECKYTI    GDGH +WVSCVRFSP+TL PTIVSGSWD+  K
Sbjct  123  ASRDGTIKLWNTLGECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVK  178


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 66/133 (50%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H  WV+ +  +P     TIVS S D+++ VWNL     Q    R  L GHS ++  V +
Sbjct  149  GHKQWVSCVRFSPNTLVPTIVSGSWDQTVKVWNL-----QNCKIRNTLAGHSGYLNTVAV  203

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG + LWDL  G       +    + S+ FS  NR  + A+ + +I++
Sbjct  204  SPDGSLCASGGKDGAILLWDLAEGKKLYSL-EAGAIIHSLCFS-PNRYWLCAATENSIRI  261

Query  455  WNTLGECKYTIQD  493
            W+   E K  ++D
Sbjct  262  WDL--ESKSVVED  272



>ref|XP_001421096.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422858.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99389.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP01217.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
Length=321

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = +2

Query  74   LVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSH  253
            + LRG +K H +WVT+IA P+DNSD ++SSSRDK++I+WNLT++   +G  RR L GHSH
Sbjct  5    MQLRGVLKGHENWVTSIATPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSLHGHSH  64

Query  254  FVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSAS  433
            FVQDVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFSVDNRQIVS S
Sbjct  65   FVQDVVISSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGS  124

Query  434  RDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            RD+TIKLWNTLGECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+  K
Sbjct  125  RDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTSNPIIVSGGWDKLVK  176


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 63/132 (48%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH++WV+ +  +P+ ++  IVS   DK + VWNLT         R  L G
Sbjct  137  ECKYTIQDADAHSEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTN-----CKIRTNLVG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ ++  V +S DG    SG  DG   LWDL  G   R +     D++       NR  +
Sbjct  192  HTGYINAVTVSPDGSLCASGGKDGVAMLWDLGEG--KRLYSLDAGDIIYGLCFSPNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ +  +K+W+
Sbjct  250  CAATESCVKIWD  261



>emb|CEG00110.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=319

 Score =   269 bits (687),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = +2

Query  74   LVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSH  253
            + LRG +K H +WVT+IA P+DNSD ++SSSRDK++I+WNLT++   +G  RR L GHSH
Sbjct  5    MQLRGVLKGHENWVTSIATPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSLHGHSH  64

Query  254  FVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSAS  433
            +VQ+VV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFSVDNRQIVS S
Sbjct  65   YVQEVVISSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGS  124

Query  434  RDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            RD+TIKLWNTLGECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+  K
Sbjct  125  RDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVK  176


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (47%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH++WV+ +  +P+  +  IVS   DK + VWNLT         R  L G
Sbjct  137  ECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNLTN-----CKIRTNLVG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ ++  V +S DG    SG  DG   LWDL  G   R +     D++       NR  +
Sbjct  192  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLGEG--KRLYSLDAGDIIYGLCFSPNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+ +  +K+W+
Sbjct  250  CAATESCVKIWD  261



>ref|XP_004969582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 151/189 (80%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK------DG---PQ  214
            AQE LVL G M+ H D VTAIAAPIDNS  IVSSSRDKS++VW+LT       DG     
Sbjct  4    AQETLVLAGVMRGHNDVVTAIAAPIDNSPFIVSSSRDKSLLVWDLTNPVHVAGDGTTTAD  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVLSV
Sbjct  64   YGVPFRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIV  562
            AFS+DNRQIVSASRD+TIKLWNTLGECKYTI       +GH+ WVSCVRFSP+T+QPTIV
Sbjct  124  AFSIDNRQIVSASRDKTIKLWNTLGECKYTIGGDHGASEGHSGWVSCVRFSPNTIQPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRSVK  192


 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 81/171 (47%), Gaps = 15/171 (9%)
 Frame = +2

Query  83   RGTMKAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFV  259
             G  + H+ WV+ +  +P     TIVS S D+S+ VWNLT         R  L GH  +V
Sbjct  158  HGASEGHSGWVSCVRFSPNTIQPTIVSGSWDRSVKVWNLTN-----CKLRSNLQGHGGYV  212

Query  260  QDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRD  439
              V +S DG    SG  D    LWDL  G      +D    + S+ FS +   + +A++D
Sbjct  213  NAVAVSPDGSLCASGGKDNVTLLWDLTEGKRLYA-LDAGSIIHSLCFSPNRYWLCAATQD  271

Query  440  RTIKLWNTLGECKYTIQD-----GDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
             +IK+W+   E K+ +QD       G N+ + C   S S    T+ +G  D
Sbjct  272  -SIKIWDL--ESKHIVQDLRPEVSAGKNQILYCTSLSWSADGSTLYAGYTD  319



>ref|NP_001056254.1| Os05g0552300 [Oryza sativa Japonica Group]
 sp|Q6L4F8.1|GBLPB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; Short=GPB-LR; AltName: Full=Receptor for activated 
C kinase 1B [Oryza sativa Japonica Group]
 gb|AAT39277.1| putative guanine nucleotide-binding protein beta subunit [Oryza 
sativa Japonica Group]
 gb|AAT85192.1| putative guanine nucleotide binding protein beta subunit [Oryza 
sativa Japonica Group]
 dbj|BAF18168.1| Os05g0552300 [Oryza sativa Japonica Group]
 dbj|BAG88240.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89443.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64615.1| hypothetical protein OsJ_19467 [Oryza sativa Japonica Group]
Length=336

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 148/191 (77%), Gaps = 15/191 (8%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDG-----------  208
             QE L L G ++ H D VTAIAAPIDNS  IVSSSRDKS++VW++T              
Sbjct  3    GQESLTLAGVLRGHNDMVTAIAAPIDNSPFIVSSSRDKSLLVWDITNPSTAVATDPEAAP  62

Query  209  PQFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL  388
            P++GV+ RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV HTKDVL
Sbjct  63   PEYGVSYRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGRTTRRFVGHTKDVL  122

Query  389  SVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQD----GDGHNEWVSCVRFSPSTLQPT  556
            SVAFSVDNRQIVSA+RD TIKLWNTLGECKYTI      G+GH  WVSCVRFSP+ + PT
Sbjct  123  SVAFSVDNRQIVSAARDNTIKLWNTLGECKYTIGGDHGAGEGHTGWVSCVRFSPNPMAPT  182

Query  557  IVSGSWDRPXK  589
            IVSGSWDR  K
Sbjct  183  IVSGSWDRSVK  193


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 72/138 (52%), Gaps = 10/138 (7%)
 Frame = +2

Query  83   RGTMKAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFV  259
             G  + HT WV+ +  +P   + TIVS S D+S+ VWNLT         R +L GH+ +V
Sbjct  159  HGAGEGHTGWVSCVRFSPNPMAPTIVSGSWDRSVKVWNLTN-----CKLRTKLEGHNGYV  213

Query  260  QDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRD  439
              V +S DG    SG  DG   LWDL  G    + +D    + S+ FS  NR  + A+ +
Sbjct  214  NAVAVSPDGSLCASGGKDGTTLLWDLTEGKMLYK-LDAGAIIHSLCFS-PNRYWLCAATE  271

Query  440  RTIKLWNTLGECKYTIQD  493
             ++K+W+   E K  +QD
Sbjct  272  DSVKIWDL--ESKLVMQD  287



>emb|CAA06154.1| arcA 3 [Nicotiana tabacum]
Length=290

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  164  SRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQA  343
            SRDKSIIVW+LTKDGPQ+GV RRRLTGH HFVQDVVLSSDG FALSGSWDGELRLWDLQA
Sbjct  1    SRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVLSSDGMFALSGSWDGELRLWDLQA  60

Query  344  GTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSC  523
            GTTARRFV HTKDVLSVAFS+DNRQIVSASRD+TIKLWNTLGECKYTI DGD H++WVSC
Sbjct  61   GTTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKLWNTLGECKYTITDGDSHSDWVSC  120

Query  524  VRFSPSTLQPTIVSGSWDRPXK  589
            VRFSP+ LQPTIVSGSWDR  K
Sbjct  121  VRFSPNNLQPTIVSGSWDRTVK  142


 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 68/132 (52%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +H+DWV+ +  +P +   TIVS S D+++ +WNLT         R  L G
Sbjct  103  ECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTN-----CKLRSTLAG  157

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  DG + LWDL  G      ++    + S+ FS  NR  +
Sbjct  158  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYS-LEAGSIIHSLCFS-PNRYWL  215

Query  425  SASRDRTIKLWN  460
             A+ + +IK+W+
Sbjct  216  CAATESSIKIWD  227


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 67/139 (48%), Gaps = 13/139 (9%)
 Frame = +2

Query  98   AHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT---GHSHFVQDV  268
             HT  V ++A  IDN   IVS+SRDK+I +WN        G  +  +T    HS +V  V
Sbjct  69   GHTKDVLSVAFSIDNRQ-IVSASRDKTIKLWN------TLGECKYTITDGDSHSDWVSCV  121

Query  269  VLSSDG--QFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDR  442
              S +      +SGSWD  +++W+L           H+  V +VA S D     S  +D 
Sbjct  122  RFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGYVNTVAVSPDGSLCASGGKDG  181

Query  443  TIKLWNTL-GECKYTIQDG  496
             I LW+   G+  Y+++ G
Sbjct  182  VILLWDLAEGKKLYSLEAG  200



>ref|NP_001043910.1| Os01g0686800 [Oryza sativa Japonica Group]
 sp|P49027.1|GBLPA_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; Short=GPB-LR; AltName: Full=RWD; AltName: Full=Receptor 
for activated C kinase 1A [Oryza sativa Japonica 
Group]
 dbj|BAA07404.1| q group of receptor for activated C-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF05824.1| Os01g0686800 [Oryza sativa Japonica Group]
 gb|EAY75412.1| hypothetical protein OsI_03315 [Oryza sativa Indica Group]
 gb|EAZ13132.1| hypothetical protein OsJ_03054 [Oryza sativa Japonica Group]
 dbj|BAG93799.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87442.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 148/189 (78%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK---------DGPQ  214
            AQE LVL G M  H D VTAIA PIDNS  IVSSSRDKS++VW+LT             +
Sbjct  4    AQESLVLAGVMHGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPVQNVGEGAGASE  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVLSV
Sbjct  64   YGVPFRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHDKDVLSV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIV  562
            AFSVDNRQIVSASRDRTIKLWNTLGECKYTI      G+GHN WVSCVRFSP+T QPTIV
Sbjct  124  AFSVDNRQIVSASRDRTIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRTVK  192


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            H  WV+ +  +P     TIVS S D+++ VWNLT         R  L GH  +V  V +S
Sbjct  164  HNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRCNLEGHGGYVNAVAVS  218

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D +IK+W
Sbjct  219  PDGSLCASGGKDGVTLLWDLAEGKRLYS-LDAGSIIHSLCFSPNRYWLCAATQD-SIKIW  276

Query  458  NTLGECKYTIQD  493
            +   E K+ +QD
Sbjct  277  DL--ESKHIVQD  286



>ref|XP_006654750.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B-like [Oryza brachyantha]
Length=336

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 147/191 (77%), Gaps = 15/191 (8%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP----------  211
             QE L L G ++ H D VTAIAAPIDNS  +VSSSRDKS++VW+++   P          
Sbjct  3    GQESLTLAGVLRGHNDVVTAIAAPIDNSPFVVSSSRDKSLMVWDISNPAPAVATDPDSAP  62

Query  212  -QFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL  388
             ++GV  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVL
Sbjct  63   PEYGVPFRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGATTRRFVGHAKDVL  122

Query  389  SVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQD----GDGHNEWVSCVRFSPSTLQPT  556
            SVAFSVDNRQIVSASRD TIKLWNTLGECKYTI      GDGH+ WVSCVRFSP+ L PT
Sbjct  123  SVAFSVDNRQIVSASRDNTIKLWNTLGECKYTIGGDLGAGDGHSGWVSCVRFSPNPLMPT  182

Query  557  IVSGSWDRPXK  589
            IVSGSWDR  K
Sbjct  183  IVSGSWDRSVK  193


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 69/137 (50%), Gaps = 10/137 (7%)
 Frame = +2

Query  86   GTMKAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQ  262
            G    H+ WV+ +  +P     TIVS S D+S+ VWNLT         R +L GH  +V 
Sbjct  160  GAGDGHSGWVSCVRFSPNPLMPTIVSGSWDRSVKVWNLTN-----CKLRTKLEGHGGYVN  214

Query  263  DVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDR  442
             V +S DG    SG  DG   LWDL  G    + ++    + S+ FS  NR  + A+ + 
Sbjct  215  AVAVSPDGSLCASGGKDGVTLLWDLTEGKMLYK-LEAGAIIHSLCFS-PNRYWLCAATED  272

Query  443  TIKLWNTLGECKYTIQD  493
            ++K+W+   E K  +QD
Sbjct  273  SVKIWDL--ESKLVMQD  287



>ref|XP_007508318.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20422.1| predicted protein [Bathycoccus prasinos]
Length=318

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  65   QECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
             E L LRG ++ H  WVT+IA P+DNSD +++SSRDKS+I+W LT++   +G  RRRL G
Sbjct  1    METLTLRGVLEGHEGWVTSIATPLDNSDILLTSSRDKSVILWTLTREEGNYGYPRRRLHG  60

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQFALSGSWDG LRLWDL +GTT RRFV H+KDVLSVAFSVDNRQIV
Sbjct  61   HSHFVQDVVISSDGQFALSGSWDGTLRLWDLNSGTTTRRFVGHSKDVLSVAFSVDNRQIV  120

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD+TIKLWNTLGECKYTIQ+ +GH EWVSCVRFSP+   P IVS  WD+  K
Sbjct  121  SGSRDKTIKLWNTLGECKYTIQEHEGHTEWVSCVRFSPAPSNPIIVSCGWDKLVK  175


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       + HT+WV+ +  +P  ++  IVS   DK + VWNL          R  L G
Sbjct  136  ECKYTIQEHEGHTEWVSCVRFSPAPSNPIIVSCGWDKLVKVWNLNN-----CKLRTNLVG  190

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ ++  V +S DG    SG  DG   LWDL  G      +D    + S+ FS  NR  +
Sbjct  191  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYS-LDAGDIIYSMCFS-PNRYWL  248

Query  425  SASRDRTIKLWN  460
             A+    +K+W+
Sbjct  249  CAATQSCVKIWD  260



>ref|XP_003567944.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=333

 Score =   264 bits (674),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 149/190 (78%), Gaps = 13/190 (7%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ--------  214
            MAQE L L GTM+ H D VTAIAAPIDN+  IVSSSRDKS++VW+LT   P         
Sbjct  1    MAQESLSLVGTMRGHNDVVTAIAAPIDNTAFIVSSSRDKSVLVWDLTNPAPSPADGTVAT  60

Query  215  -FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLS  391
             +GV  RRLTGH HFVQDVV+SSDGQFALSGSWDGELRLWDL  G T RRFV HTKDV+S
Sbjct  61   DYGVPFRRLTGHGHFVQDVVISSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHTKDVIS  120

Query  392  VAFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTI  559
            VAFSVDNRQIVSASRD TIKLWNTLGECKYTI      G+GH  WVSCVRFSP+T QPTI
Sbjct  121  VAFSVDNRQIVSASRDNTIKLWNTLGECKYTIGGDLGGGEGHTGWVSCVRFSPNTFQPTI  180

Query  560  VSGSWDRPXK  589
            VSGSWD+  K
Sbjct  181  VSGSWDKTVK  190


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 68/132 (52%), Gaps = 10/132 (8%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            HT WV+ +  +P     TIVS S DK++ VWNLT         R  L GH  +V  V +S
Sbjct  162  HTGWVSCVRFSPNTFQPTIVSGSWDKTVKVWNLTN-----CKLRNTLAGHGGYVNAVAVS  216

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G    + ++    + S+ FS  NR  + A+ + ++K+W
Sbjct  217  PDGSLCASGGKDGVTLLWDLAEGKRLYQ-LEAGSIIHSLCFS-PNRYWLCAATEDSVKIW  274

Query  458  NTLGECKYTIQD  493
            +   E K+ +QD
Sbjct  275  DL--ESKHVVQD  284



>gb|AEN80883.1| AT1G18080-like protein, partial [Capsella rubella]
 gb|AEN80884.1| AT1G18080-like protein, partial [Capsella rubella]
 gb|AEN80885.1| AT1G18080-like protein, partial [Capsella rubella]
 gb|AEN80886.1| AT1G18080-like protein, partial [Capsella rubella]
 gb|AEN80887.1| AT1G18080-like protein, partial [Capsella rubella]
 gb|AEN80888.1| AT1G18080-like protein, partial [Capsella rubella]
 gb|AEN80889.1| AT1G18080-like protein, partial [Capsella rubella]
 gb|AEN80890.1| AT1G18080-like protein, partial [Capsella rubella]
Length=188

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLSSDGQFALSG  304
            A PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGHSHFV+DVVLSSDGQFALSG
Sbjct  1    ATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVLSSDGQFALSG  60

Query  305  SWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYT  484
            SWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVSASRDRTIKLWNTLGECKYT
Sbjct  61   SWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVSASRDRTIKLWNTLGECKYT  120

Query  485  IQD--GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            I +  G+GH +WVSCVRFSP+TL PTIVS SWD+  K
Sbjct  121  ISEGGGEGHRDWVSCVRFSPNTLHPTIVSASWDKTVK  157



>gb|ABA01155.1| G protein beta subunit-like polypeptide [Chlamydomonas incerta]
Length=258

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E L LR T+K HT+WVTAIA P+D +S+T++S+SRDKS++VW L +    +G AR+ L G
Sbjct  3    ETLTLRATLKGHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKALRG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQF L+GSWDG LRLWDL  GTT RRFV HTKDVLSVAFSVDNRQIV
Sbjct  63   HSHFVQDVVISSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD+TIKLWNTLGECKYTI + +GH EWVSCVRFSP T  P IVSG WD+  K
Sbjct  123  SGSRDKTIKLWNTLGECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVK  177


 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 58/128 (45%), Gaps = 8/128 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC    G  + HT+WV+ +  +P+  +  IVS   DK + VWNLT         +  L G
Sbjct  138  ECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVKVWNLTN-----CKLKNNLVG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG   LWDL  G   R +     DV+       NR  +
Sbjct  193  HHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEG--KRLYSLDAGDVIHCLCFSPNRYWL  250

Query  425  SASRDRTI  448
             A+   +I
Sbjct  251  CAATQSSI  258


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 72/152 (47%), Gaps = 13/152 (9%)
 Frame = +2

Query  98   AHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
             HT  V ++A  +DN   IVS SRDK+I +WN T    ++ +      GH+ +V  V  S
Sbjct  104  GHTKDVLSVAFSVDNRQ-IVSGSRDKTIKLWN-TLGECKYTIGEPE--GHTEWVSCVRFS  159

Query  278  --SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
              +     +SG WD  +++W+L         V H   V +V  S D     S  +D    
Sbjct  160  PMTTNPIIVSGGWDKMVKVWNLTNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAM  219

Query  452  LWNTLGECK--YTIQDGDGHNEWVSCVRFSPS  541
            LW+ L E K  Y++  GD     + C+ FSP+
Sbjct  220  LWD-LAEGKRLYSLDAGDV----IHCLCFSPN  246



>ref|XP_003060952.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54602.1| predicted protein [Micromonas pusilla CCMP1545]
Length=325

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+K H  WVT++A P+DNSD ++SSSRDK++I+W LT++   +G   R L GH
Sbjct  3    ESLNLRGTLKGHEGWVTSLACPLDNSDMLLSSSRDKTVILWTLTREEGNYGYPLRSLRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVV+SSDGQFALSGSWDG LRLWDL  G+T RRFV H KDVLSVAFSVDNRQIVS
Sbjct  63   SHFVQDVVISSDGQFALSGSWDGTLRLWDLNTGSTTRRFVGHGKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLGECKYTIQ+ +GH EWVSCVRFSP T  P IVSG WD+  K
Sbjct  123  GSRDKTIKLWNTLGECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVK  176


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (47%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       + HT+WV+ +  +P+ ++  IVS   DK + VWNLT         R  L G
Sbjct  137  ECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTN-----CKLRTNLVG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ ++  V +S DG    SG  DG   LWDL  G   R +     D++       NR  +
Sbjct  192  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYTLDAGDIIYALCFSPNRYWL  249

Query  425  SASRDRTIKLWN  460
             A+    +K+W+
Sbjct  250  CAATQSCVKIWD  261



>gb|ADG37904.1| AT1G18080-like protein [Neslia paniculata]
Length=182

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 2/154 (1%)
 Frame = +2

Query  134  IDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWD  313
            IDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGHSHFV+DVVLSSDGQFALSGSWD
Sbjct  1    IDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVLSSDGQFALSGSWD  60

Query  314  GELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQD  493
            GELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVSASRDRTIKLWNTLGECKYTI +
Sbjct  61   GELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVSASRDRTIKLWNTLGECKYTISE  120

Query  494  --GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
              G+GH +WVSCVRFSP+TLQPTIVS SWD+  K
Sbjct  121  GGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVK  154



>gb|ABA01128.1| G protein beta subunit-like polypeptide, partial [Chlamydomonas 
incerta]
Length=278

 Score =   259 bits (662),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E L LR T+K HT+WVTAIA P+D +S+T++S+SRDKS++VW L +    +G AR+ L G
Sbjct  3    ETLTLRATLKGHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKALRG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQF L+GSWDG LRLWDL  GTT RRFV HTKDVLSVAFSVDNRQIV
Sbjct  63   HSHFVQDVVISSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD+TIKLWNTLGECKYTI + +GH EWVSCVRFSP T  P IVSG WD+  K
Sbjct  123  SGSRDKTIKLWNTLGECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVK  177


 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 66/143 (46%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC    G  + HT+WV+ +  +P+  +  IVS   DK + VWNLT         +  L G
Sbjct  138  ECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVKVWNLTN-----CKLKNNLVG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG   LWDL  G   R +     DV+       NR  +
Sbjct  193  HHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEG--KRLYSLDAGDVIHCLCFSPNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+   +IK+W+   E K  + D
Sbjct  251  CAATQSSIKIWDL--ESKSVVDD  271



>ref|XP_002456166.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
 gb|EES01286.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
Length=332

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 146/189 (77%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNL------TKDG---PQ  214
            AQE LVL G M+ H   VTAIA PIDNSD IVSSSRDKS++VW+L        DG     
Sbjct  4    AQETLVLAGVMRGHNGVVTAIATPIDNSDLIVSSSRDKSLLVWDLRNPVQAAGDGTTTAD  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV  RRLTGHSHFVQDVVLSSDGQFALSGSWDG+LRLW+L  G T  RFV H KDVLSV
Sbjct  64   YGVPLRRLTGHSHFVQDVVLSSDGQFALSGSWDGDLRLWNLTTGETTCRFVGHEKDVLSV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIV  562
            AFS DNRQIVSASRDRTIKLWNTLGECKYTI       +GHN WVSCVRFSP+T QPTIV
Sbjct  124  AFSADNRQIVSASRDRTIKLWNTLGECKYTIGGDLGGAEGHNGWVSCVRFSPNTYQPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRSVK  192


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 68/138 (49%), Gaps = 12/138 (9%)
 Frame = +2

Query  86   GTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQ  262
            G  + H  WV+ +  +P     TIVS S D+S+ VWNLT         R  L GH  +V 
Sbjct  159  GGAEGHNGWVSCVRFSPNTYQPTIVSGSWDRSVKVWNLTN-----CKLRCTLQGHGGYVN  213

Query  263  DVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL-SVAFSVDNRQIVSASRD  439
             V +S DG    SG  D    LWDL  G   R +     D++ S+ FS  NR  + A+  
Sbjct  214  AVAVSPDGSLCASGGKDHVTLLWDLTEG--KRLYALDAGDIIHSLCFS-PNRYWLCAATQ  270

Query  440  RTIKLWNTLGECKYTIQD  493
             +IK+W+   E K+ +QD
Sbjct  271  ESIKIWDL--ESKHVVQD  286



>ref|XP_001698065.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
 sp|P25387.1|GBLP_CHLRE RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Chlamydomonas reinhardtii]
 emb|CAA37638.1| putative protein has homology to G protein beta subunit [Chlamydomonas 
reinhardtii]
 gb|EDO99650.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
Length=318

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E L LR T+K HT+WVTAIA P+D +S+T++S+SRDKS++VW L +    +G AR+ L G
Sbjct  3    ETLTLRATLKGHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKALRG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQF L+GSWDG LRLWDL  GTT RRFV HTKDVLSVAFSVDNRQIV
Sbjct  63   HSHFVQDVVISSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD+TIKLWNTLGECKYTI + +GH EWVSCVRFSP T  P IVSG WD+  K
Sbjct  123  SGSRDKTIKLWNTLGECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVK  177


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 62/132 (47%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC    G  + HT+WV+ +  +P+  +  IVS   DK + VWNLT         +  L G
Sbjct  138  ECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVKVWNLTN-----CKLKNNLVG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG   LWDL  G   R +     DV+       NR  +
Sbjct  193  HHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEG--KRLYSLDAGDVIHCLCFSPNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+   +IK+W+
Sbjct  251  CAATQSSIKIWD  262



>ref|NP_001146976.1| LOC100280585 [Zea mays]
 gb|ACG24854.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW79043.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 149/189 (79%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK---DGPQ------  214
            AQE L L GTM+ H   VTAIA PIDNS  IVSSSRDKS++VW+LT      P+      
Sbjct  4    AQESLSLVGTMRGHNGEVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPVHSTPESGATAD  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVLSV
Sbjct  64   YGVPFRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIV  562
            AFSVDNRQIVSASRD+TIKLWNTLGECKYTI      G+GHN WVSCVRFSP+T QPTIV
Sbjct  124  AFSVDNRQIVSASRDKTIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRTVK  192


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 78/165 (47%), Gaps = 15/165 (9%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            H  WV+ +  +P     TIVS S D+++ VWNLT         R  L GH  +V  V +S
Sbjct  164  HNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRCTLDGHGGYVNAVAVS  218

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D ++K+W
Sbjct  219  PDGSLCASGGKDGVTLLWDLAEGKRLYS-LDAGSIIHSLCFSPNRYWLCAATQD-SVKIW  276

Query  458  NTLGECKYTIQDGD-----GHNEWVSCVRFSPSTLQPTIVSGSWD  577
            +   E K+ +QD         N+ + C   S S    T+ +G  D
Sbjct  277  DL--ESKHVVQDLKPDIQISKNQILYCTSLSWSADGSTLYTGYTD  319



>gb|ADG37898.1| AT1G18080-like protein [Capsella grandiflora]
 gb|ADG37899.1| AT1G18080-like protein [Capsella grandiflora]
 gb|ADG37900.1| AT1G18080-like protein [Capsella grandiflora]
 gb|ADG37901.1| AT1G18080-like protein [Capsella grandiflora]
 gb|ADG37902.1| AT1G18080-like protein [Capsella grandiflora]
Length=182

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  134  IDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWD  313
            IDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGHSHFV+DVVLSSDGQFALSGSWD
Sbjct  1    IDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVLSSDGQFALSGSWD  60

Query  314  GELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQD  493
            GELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVSASRDRTIKLWNTLGECKYTI +
Sbjct  61   GELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVSASRDRTIKLWNTLGECKYTISE  120

Query  494  --GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
              G+GH +WVSCVRFSP+TL PTIVS SWD+  K
Sbjct  121  GGGEGHRDWVSCVRFSPNTLHPTIVSASWDKTVK  154



>gb|ADG37903.1| AT1G18080-like protein [Capsella grandiflora]
Length=182

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 136/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  134  IDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWD  313
            IDN+D IVS+SRDKSII+W LTKD   +GVA+RRLTGHSHFV+DVVLSSDGQFALSGSWD
Sbjct  1    IDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVLSSDGQFALSGSWD  60

Query  314  GELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQD  493
            GELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVSASRDRTIKLWNTLGECKYTI +
Sbjct  61   GELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVSASRDRTIKLWNTLGECKYTISE  120

Query  494  --GDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
              G+GH +WVSCVRFSP TL PTIVS SWD+  K
Sbjct  121  GGGEGHRDWVSCVRFSPXTLHPTIVSASWDKTVK  154



>gb|KIY98327.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Monoraphidium neglectum]
Length=319

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E L  R T+K H  WVTAIA P+D N+D I+S+SRDK++IVW L +    +GVA + L G
Sbjct  3    ETLTHRATLKGHRGWVTAIATPLDPNADVILSASRDKTVIVWKLDRSETNYGVAHKALKG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQFALSGSWDG LRLWDLQ GTT RRFV HTKDVLSVAFSVDNRQIV
Sbjct  63   HSHFVQDVVISSDGQFALSGSWDGTLRLWDLQQGTTTRRFVGHTKDVLSVAFSVDNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S +RD+TIKLWNTLGECKYTI + +GH+EWVSCVRFSP T  P IVSG WD+  K
Sbjct  123  SGARDKTIKLWNTLGECKYTIAEPEGHSEWVSCVRFSPMTNNPIIVSGGWDKLVK  177


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       + H++WV+ +  +P+ N+  IVS   DK + V+NL+         +  L G
Sbjct  138  ECKYTIAEPEGHSEWVSCVRFSPMTNNPIIVSGGWDKLVKVFNLSN-----CKLKCNLVG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL-SVAFSVDNRQI  421
            H+ ++  V +S DG    SG  DG   LWDL  G   R +     D++ S+ FS  NR  
Sbjct  193  HAGYINTVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDAGDIIHSLVFS-PNRYW  249

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+   +IK+W+   E K  + D
Sbjct  250  LCAATQTSIKIWDL--ESKSVVDD  271



>ref|NP_001136800.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|ACF82664.1| unknown [Zea mays]
 gb|ACG34796.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW81011.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   259 bits (661),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 149/189 (79%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK---DGPQ------  214
            AQE L L GTM+ H   VTAIA PIDNS  IVSSSRDKS++VW+LT      P+      
Sbjct  4    AQESLSLVGTMRGHNGEVTAIATPIDNSPFIVSSSRDKSVLVWDLTNPVHSTPESGVTAD  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDV+SV
Sbjct  64   YGVPFRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVISV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIV  562
            AFSVDNRQIVSASRD+TIKLWNTLGECKYTI      G+GHN WVSCVRFSP+T QPTIV
Sbjct  124  AFSVDNRQIVSASRDKTIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRTVK  192


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 78/165 (47%), Gaps = 15/165 (9%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            H  WV+ +  +P     TIVS S D+++ VWNLT         R  L GH  +V  V +S
Sbjct  164  HNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRCTLDGHGGYVNAVAVS  218

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D ++K+W
Sbjct  219  PDGSLCASGGKDGVTLLWDLAEGKRLYS-LDAGSIIHSLCFSPNRYWLCAATQD-SVKIW  276

Query  458  NTLGECKYTIQDGD-----GHNEWVSCVRFSPSTLQPTIVSGSWD  577
            +   E K+ +QD         N+ + C   S S    T+ +G  D
Sbjct  277  DL--ESKHVVQDLKPDIQVSKNQILYCTSLSWSADGSTLYTGYTD  319



>ref|XP_002502835.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64093.1| predicted protein [Micromonas sp. RCC299]
Length=324

 Score =   258 bits (660),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDN-SDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E L LRG +K H  WVT++A P+DN SD ++SSSRDK++I+W LT++   +G A++ L G
Sbjct  3    ETLSLRGVLKGHEGWVTSLATPLDNNSDMLLSSSRDKTVILWTLTREEGNYGYAQKALRG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQFALSGSWDG LRLWDL  G+T RRFV H+KDVLSVAFSVDNRQIV
Sbjct  63   HSHFVQDVVISSDGQFALSGSWDGTLRLWDLNTGSTTRRFVGHSKDVLSVAFSVDNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD+TIKLWNTLGECKYTIQ+ +GH EWVSCVRFSP T  P IVSG WD+  K
Sbjct  123  SGSRDKTIKLWNTLGECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVK  177


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (47%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC       + HT+WV+ +  +P+ ++  IVS   DK + VWNLT         R  L G
Sbjct  138  ECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTN-----CKLRTNLVG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ ++  V +S DG    SG  DG   LWDL  G   R +     D++       NR  +
Sbjct  193  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDAGDIIYALCFSPNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+    +K+W+
Sbjct  251  CAATQSCVKIWD  262



>ref|XP_002945887.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
 gb|EFJ52882.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
Length=318

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E L LR T+K HT+WVTAIA P+D +S+T++S+SRDK+++VW L +    +G A++ L G
Sbjct  3    ETLTLRATLKGHTNWVTAIATPLDPSSNTLLSASRDKTVLVWELERSESNYGYAKKALRG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQF L+GSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIV
Sbjct  63   HSHFVQDVVISSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSADNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S +RD+TIKLWNTLGECKYTI + +GH EWVSCVRFSP+T+ P IVSG WD+  K
Sbjct  123  SGARDKTIKLWNTLGECKYTIGEPEGHTEWVSCVRFSPTTVNPIIVSGGWDKMVK  177


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 66/143 (46%), Gaps = 10/143 (7%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC    G  + HT+WV+ +  +P   +  IVS   DK + VWNLT         +  L G
Sbjct  138  ECKYTIGEPEGHTEWVSCVRFSPTTVNPIIVSGGWDKMVKVWNLTN-----CKLKNNLVG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG   LWDL  G   R +     DV+       NR  +
Sbjct  193  HTGYVNTVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDAGDVIHCLCFSPNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQD  493
             A+   TIK+W+   E K  + D
Sbjct  251  CAATQSTIKIWDL--ESKSVVDD  271



>gb|ACL54313.1| unknown [Zea mays]
Length=334

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 148/189 (78%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK---DGPQ------  214
            AQE L L GTM+ H   VT IA PIDNS  IVSSSRDKS++VW+LT      P+      
Sbjct  4    AQESLSLVGTMRGHNGEVTTIATPIDNSPFIVSSSRDKSLLVWDLTNPVHSTPESGATAD  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVLSV
Sbjct  64   YGVPFRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIV  562
            AFSVDNRQIVSASRD+TIKLWNTLGECKYTI      G+GHN WVSCVRFSP+T QPTIV
Sbjct  124  AFSVDNRQIVSASRDKTIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRTVK  192


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 78/165 (47%), Gaps = 15/165 (9%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            H  WV+ +  +P     TIVS S D+++ VWNLT         R  L GH  +V  V +S
Sbjct  164  HNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRCTLDGHGGYVNAVAVS  218

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D ++K+W
Sbjct  219  PDGSLCASGGKDGVTLLWDLAEGKRLYS-LDAGSIIHSLCFSPNRYWLCAATQD-SVKIW  276

Query  458  NTLGECKYTIQDGD-----GHNEWVSCVRFSPSTLQPTIVSGSWD  577
            +   E K+ +QD         N+ + C   S S    T+ +G  D
Sbjct  277  DL--ESKHVVQDLKPDIQISKNQILYCTSLSWSADGSTLYTGYTD  319



>gb|EMT31237.1| hypothetical protein F775_29537 [Aegilops tauschii]
Length=301

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 144/187 (77%), Gaps = 11/187 (6%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK-------DGPQFG  220
            AQE LV  G M+ H D VTAIA PIDNS  IVSSSRDKS++VW+LT           ++G
Sbjct  4    AQESLVYAGVMRGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPIQATQDSSSEYG  63

Query  221  VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAF  400
            V  RRLTGH HFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVLSVAF
Sbjct  64   VPFRRLTGHGHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAF  123

Query  401  SVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            S+DNRQIVSASRDRTIKLWNTLGECKYTI      G+GH  WVSCVRFSP+   PTIVSG
Sbjct  124  SIDNRQIVSASRDRTIKLWNTLGECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSG  183

Query  569  SWDRPXK  589
            SWDR  K
Sbjct  184  SWDRSVK  190


 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            HT WV+ +  +P + + TIVS S D+S+ VWNLT         R  L GH  +V  V +S
Sbjct  162  HTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTN-----CKLRCTLDGHGGYVSAVAVS  216

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D +IK+W
Sbjct  217  PDGSLCASGGKDGVTLLWDLTEGKRLYS-LDAGSIINSLCFSPNRYWLCAATQD-SIKIW  274

Query  458  NTLGECKYTIQD  493
            +   E K+ +QD
Sbjct  275  DL--ESKHIVQD  284



>ref|XP_006644561.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A-like [Oryza brachyantha]
Length=334

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 146/189 (77%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------Q  214
            AQE LVL G M  H D VTAIA PIDNS  IVSSSRDKS++VW+LT   P         +
Sbjct  4    AQESLVLAGVMHGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPVPVVGETASATE  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV  RRLTGHSHFVQDVVLSS+ QF LSGS DGELRLWDL  G T RRFV H KDVLSV
Sbjct  64   YGVPFRRLTGHSHFVQDVVLSSNDQFTLSGSXDGELRLWDLSTGATTRRFVGHDKDVLSV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIV  562
            AFSVDNRQIVSASRDRTIKLWNTLGECKYTI      G+GHN WVSCVRFSP+T QPTIV
Sbjct  124  AFSVDNRQIVSASRDRTIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRTVK  192


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            H  WV+ +  +P     TIVS S D+++ VWNLT         R  L GH  +V  V +S
Sbjct  164  HNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRCNLEGHGGYVNAVAVS  218

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D +IK+W
Sbjct  219  PDGSLCASGGKDGVTLLWDLAEGKRLYS-LDAGSIIHSLCFSPNRYWLCAATQD-SIKIW  276

Query  458  NTLGECKYTIQD  493
            +   E K+ +QD
Sbjct  277  DL--ESKHIVQD  286



>emb|CDM83867.1| unnamed protein product [Triticum aestivum]
Length=332

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 144/187 (77%), Gaps = 11/187 (6%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK-------DGPQFG  220
            AQE LV  G M+ H D VTAIA PIDNS  IVSSSRDKS++VW+LT           ++G
Sbjct  4    AQESLVYAGVMRGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPIQATQDSSSEYG  63

Query  221  VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAF  400
            V  RRLTGH HFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVLSVAF
Sbjct  64   VPFRRLTGHGHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAF  123

Query  401  SVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            S+DNRQIVSASRDRTIKLWNTLGECKYTI      G+GH  WVSCVRFSP+   PTIVSG
Sbjct  124  SIDNRQIVSASRDRTIKLWNTLGECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSG  183

Query  569  SWDRPXK  589
            SWDR  K
Sbjct  184  SWDRSVK  190


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            HT WV+ +  +P + + TIVS S D+S+ VWNLT         R  L GH  +V  V +S
Sbjct  162  HTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTN-----CKLRCTLDGHGGYVSAVAVS  216

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D +IK+W
Sbjct  217  PDGSLCASGGKDGVTLLWDLTEGKRLYS-LDAGSIINSLCFSPNRYWLCAATQD-SIKIW  274

Query  458  NTLGECKYTIQD  493
            +   E K+ +QD
Sbjct  275  DL--ESKHIVQD  284



>dbj|BAJ98167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 144/187 (77%), Gaps = 11/187 (6%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKD-------GPQFG  220
            AQE LV  G M+ H D VTAIA PIDNS  IVSSSRDKS++VW+LT           ++G
Sbjct  4    AQESLVYAGVMRGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPIQATQDTSSEYG  63

Query  221  VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAF  400
            V  RRLTGH HFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVLSVAF
Sbjct  64   VPFRRLTGHGHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAF  123

Query  401  SVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            S+DNRQIVSASRDRTIKLWNTLGECKYTI      G+GH  WVSCVRFSP+   PTIVSG
Sbjct  124  SIDNRQIVSASRDRTIKLWNTLGECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSG  183

Query  569  SWDRPXK  589
            SWDR  K
Sbjct  184  SWDRSVK  190


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            HT WV+ +  +P + + TIVS S D+S+ VWNLT         R  L GH  +V  V +S
Sbjct  162  HTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTN-----CKLRCTLDGHGGYVSAVAVS  216

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D +IK+W
Sbjct  217  PDGSLCASGGKDGVTLLWDLTEGKRLYS-LDAGSIINSLCFSPNRYWLCAATQD-SIKIW  274

Query  458  NTLGECKYTIQD  493
            +   E K+ +QD
Sbjct  275  DL--ESKHIVQD  284



>ref|XP_002440202.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
 gb|EES18632.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
Length=334

 Score =   256 bits (655),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 149/189 (79%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNL---TKDGPQ------  214
            AQE L L GTM+AH   VTAIA PIDNS  IVS+SRDKS+++W+L       P+      
Sbjct  4    AQESLSLVGTMRAHNGEVTAIATPIDNSPFIVSASRDKSVLLWDLENPVHSTPESGVTAD  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV +RRLTGHSHFVQDVVLSSDG FALSGSWDGELRLWDL  G T RRFV H KD+LSV
Sbjct  64   YGVPKRRLTGHSHFVQDVVLSSDGMFALSGSWDGELRLWDLSTGATTRRFVGHGKDILSV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIV  562
            AFSVDNRQI+SASRD+TIKLWNTLGECKYTI      G+GHN WVSCVRFSP+T QPTIV
Sbjct  124  AFSVDNRQIISASRDKTIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRTVK  192


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  101  HTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            H  WV+ +  +P     TIVS S D+++ VWNLT         R  L GH  +V  V +S
Sbjct  164  HNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTN-----CKLRCTLDGHGGYVNAVAVS  218

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D ++K+W
Sbjct  219  PDGSLCASGGKDGVTLLWDLAEGKRLYS-LDAGSIIHSLCFSPNRYWLCAATQD-SVKIW  276

Query  458  NTLGECKYTIQD  493
            +   E K+ +QD
Sbjct  277  DL--ESKHVVQD  286



>ref|XP_002960209.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
 gb|EFJ37748.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
Length=310

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLT-KDGPQ--FGVARRRL  238
            + LV +G M+ HTDWVTAIA P+DNSD I+S+SRDKS+++WN   KD  +  FG+ +RRL
Sbjct  3    DSLVSKGRMEGHTDWVTAIATPVDNSDIILSASRDKSVLLWNTQHKDLTEQDFGLPQRRL  62

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH+HFVQDVV+SSD QFALSGSWDG LRLWDL  G T RRFV HTKDVLSVAFS DNRQ
Sbjct  63   TGHAHFVQDVVISSDSQFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNRQ  122

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVS SRD++IKLWNTLGECKYTIQD D H  WVSCVRFSP T  P IVSG WD+  K
Sbjct  123  IVSGSRDKSIKLWNTLGECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVK  179


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 10/133 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +HT WV+ +  +P+  +  IVS   DK + VWNLT         R  L G
Sbjct  140  ECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVWNLTN-----CKLRTNLAG  194

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL-SVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG   LWDL  G   R +     D++ S+ FS  NR  
Sbjct  195  HSGYVNSVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDAGDIIHSLCFS-PNRYW  251

Query  422  VSASRDRTIKLWN  460
            + A+  + +K+W+
Sbjct  252  LCAATQQCVKIWD  264



>ref|XP_002967499.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
 gb|EFJ32098.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
Length=315

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLT-KDGPQ--FGVARRRL  238
            + LV +G M+ HTDWVTAIA P+DNSD I+S+SRDKS+++WN   KD  +  FG+ +RRL
Sbjct  3    DSLVSKGRMEGHTDWVTAIATPVDNSDIILSASRDKSVLLWNTQHKDLTEQDFGLPQRRL  62

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH+HFVQDVV+SSD QFALSGSWDG LRLWDL  G T RRFV HTKDVLSVAFS DNRQ
Sbjct  63   TGHAHFVQDVVISSDSQFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNRQ  122

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVS SRD++IKLWNTLGECKYTIQD D H  WVSCVRFSP T  P IVSG WD+  K
Sbjct  123  IVSGSRDKSIKLWNTLGECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVK  179


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 10/133 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        +HT WV+ +  +P+  +  IVS   DK + VWNLT         R  L G
Sbjct  140  ECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVWNLTN-----CKLRTNLAG  194

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL-SVAFSVDNRQI  421
            HS +V  V +S DG    SG  DG   LWDL  G   R +     D++ S+ FS  NR  
Sbjct  195  HSGYVNSVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYSLDAGDIIHSLCFS-PNRYW  251

Query  422  VSASRDRTIKLWN  460
            + A+  + +K+W+
Sbjct  252  LCAATQQCVKIWD  264



>emb|CBN79872.2| guanine nucleotide binding protein beta polypeptide 2-like 1 
(Partial) [Ectocarpus siliculosus]
Length=206

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L  RG + AH DWVT+IAA  +N D IVSSSRDKSIIVW L +   Q+G   R LTGH
Sbjct  3    EQLKFRGQLVAHEDWVTSIAATSENPDMIVSSSRDKSIIVWKLQRGEDQYGYPHRSLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV +VV+SSDGQFALSGSWDG LRLW++Q+G T RRFV H KDVLSVAFS DNRQIVS
Sbjct  63   SHFVSEVVISSDGQFALSGSWDGTLRLWEIQSGRTTRRFVGHAKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLGECKYTIQ+ DGH EWVSCVRFSPS   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGECKYTIQE-DGHTEWVSCVRFSPSPSAPVIVSAGWDKLVK  175



>ref|XP_004961307.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 145/189 (77%), Gaps = 13/189 (7%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKD---------GPQ  214
             QE L L GTM+ H   VTAIA PIDNS  IVSSSRDKS++VW+LT              
Sbjct  4    GQESLSLVGTMRGHNGEVTAIATPIDNSPFIVSSSRDKSVLVWDLTNPVHSTPDSGAAAD  63

Query  215  FGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSV  394
            +GV  RRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDV+SV
Sbjct  64   YGVPFRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVISV  123

Query  395  AFSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIV  562
            AFSVDNRQIVSASRD+TIKLWNTLGECKYTI      G+GHN WVSCVRFSP+T  PTIV
Sbjct  124  AFSVDNRQIVSASRDKTIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFAPTIV  183

Query  563  SGSWDRPXK  589
            SGSWDR  K
Sbjct  184  SGSWDRTVK  192


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 79/165 (48%), Gaps = 15/165 (9%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            H  WV+ +  +P   + TIVS S D+++ VWNLT         R  L GH  +V  V +S
Sbjct  164  HNGWVSCVRFSPNTFAPTIVSGSWDRTVKVWNLTN-----CKLRCTLDGHGGYVNAVAVS  218

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G      +D    + S+ FS +   + +A++D ++K+W
Sbjct  219  PDGSLCASGGKDGYTLLWDLTEGKRLYS-LDAGSIIHSLCFSPNRYWLCAATQD-SVKIW  276

Query  458  NTLGECKYTIQDGD-----GHNEWVSCVRFSPSTLQPTIVSGSWD  577
            +   E K+ +QD         N+ + C   S S    T+ +G  D
Sbjct  277  DL--ESKHVVQDLKPDIQISKNQILYCTSLSWSADGSTLYTGYTD  319



>ref|XP_005652002.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27458.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E L  RG+++ H  WVT+IA P+D NSDTI+SSSRDK+I+VW LT++   +G A+R L G
Sbjct  3    ETLYHRGSLEGHAGWVTSIATPLDPNSDTILSSSRDKTILVWTLTREEGNYGFAKRSLKG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFV+DVV+SSDGQFALSGSWDG LRLWDL  G T RRF+ H+KDVLSVAFS+DNRQIV
Sbjct  63   HSHFVEDVVISSDGQFALSGSWDGTLRLWDLSTGQTTRRFLGHSKDVLSVAFSMDNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD+TIKLWNT+GECKYTI + DGH EWVSCVRFSP T  P IVS  WD+  K
Sbjct  123  SGSRDKTIKLWNTIGECKYTIAEPDGHTEWVSCVRFSPVTNNPIIVSAGWDKLVK  177


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 62/132 (47%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC         HT+WV+ +  +P+ N+  IVS+  DK + VWNLT         R  L G
Sbjct  138  ECKYTIAEPDGHTEWVSCVRFSPVTNNPIIVSAGWDKLVKVWNLTN-----CKLRANLQG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS ++  V +S DG    SG  DG   LWDL  G   R +     +++       NR  +
Sbjct  193  HSGYINTVTVSPDGSLCASGGKDGVAMLWDLAEG--KRLYNLEAGEIIHALCFSPNRYWL  250

Query  425  SASRDRTIKLWN  460
             A+    IK+W+
Sbjct  251  CAATTNCIKIWD  262



>dbj|BAJ90663.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06408.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   253 bits (647),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 144/188 (77%), Gaps = 13/188 (7%)
 Frame = +2

Query  65   QECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKD---------GPQF  217
            QE L L GTM+ H D VTAIAAPIDNS  IVS SRDKS++VW+LT           G  +
Sbjct  5    QESLTLVGTMRGHNDVVTAIAAPIDNSPYIVSGSRDKSLLVWDLTNPVASLGDGTVGTDY  64

Query  218  GVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVA  397
             V  RRLTGH HFVQDVV+SSDGQFALSGSWDGELRLWDL  G T RRFV HTKDV+SVA
Sbjct  65   AVPFRRLTGHGHFVQDVVISSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHTKDVISVA  124

Query  398  FSVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIVS  565
            FSVDNRQIVSASRD TIKLWNTLGECKYTI      G+GH  WVSCVRFSP+  QPTIVS
Sbjct  125  FSVDNRQIVSASRDNTIKLWNTLGECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVS  184

Query  566  GSWDRPXK  589
            GSWD+  K
Sbjct  185  GSWDKTVK  192


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 78/165 (47%), Gaps = 15/165 (9%)
 Frame = +2

Query  101  HTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLS  277
            HT WV+ +  +P     TIVS S DK++ VWNL          R  L GH  +V  V +S
Sbjct  164  HTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLAN-----CKLRSTLAGHGGYVNAVAVS  218

Query  278  SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLW  457
             DG    SG  DG   LWDL  G    + ++    + S+ FS  NR  + A+ + +IK+W
Sbjct  219  PDGSLCASGGKDGVTLLWDLSEGKRLYQ-LEAGSIIHSLCFS-PNRYWLCAATEESIKIW  276

Query  458  NTLGECKYTIQDGD-----GHNEWVSCVRFSPSTLQPTIVSGSWD  577
            +   E K+ +QD         N+ + C   S S    T+ +G  D
Sbjct  277  DL--ESKHVVQDLKPEVQVSKNQMLYCTSLSWSADGSTLYTGYTD  319



>ref|XP_003082627.1| GTP-binding regulatory protein beta chain homolog-Ch (ISS) [Ostreococcus 
tauri]
Length=483

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  44   QRERKMAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGV  223
            +R R     C       +A  +WVT+IA P+DNSD ++SSSRDK++I+WNLT++   +G 
Sbjct  160  ERNRDTKTYCDYFSLAFQAR-NWVTSIATPLDNSDILLSSSRDKTVILWNLTREEENYGY  218

Query  224  ARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFS  403
             RR L GHSH+VQ+VV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS
Sbjct  219  PRRSLHGHSHYVQEVVISSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFS  278

Query  404  VDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRP  583
            VDNRQIVS SRD+TIKLWNTLGECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ 
Sbjct  279  VDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKL  338

Query  584  XK  589
             K
Sbjct  339  VK  340


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (47%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AH++WV+ +  +P+  +  IVS   DK + VWNLT         R  L G
Sbjct  301  ECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNLTN-----CKIRTNLVG  355

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ ++  V +S DG    SG  DG   LWDL  G   R +     D++       NR  +
Sbjct  356  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLGEG--KRLYSLDAGDIIYGLCFSPNRYWL  413

Query  425  SASRDRTIKLWN  460
             A+ +  +K+W+
Sbjct  414  CAATESCVKIWD  425



>gb|AEF79971.1| receptor of activated protein kinase C 1 [Dunaliella salina]
Length=318

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E LV R T+K H+ WVTA+AAP+D +S+ ++S+SRDKS+IVW L + G  +G  ++ L G
Sbjct  3    ETLVPRATLKGHSGWVTALAAPLDPSSNVLLSASRDKSVIVWELERGGDSYGYPKKSLRG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQF LSGSWDG LRLWDL  G T RRFV HTKDVLSVAFSVDNRQIV
Sbjct  63   HSHFVQDVVISSDGQFCLSGSWDGTLRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD+TI+LWNTLGECKY+I + +GH+EWVSCVRFSP T  P IVSG WD+  K
Sbjct  123  SGSRDKTIRLWNTLGECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVK  177


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 74/170 (44%), Gaps = 14/170 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC    G  + H++WV+ +  +P+  +  IVS   DK + VWNLT         +  L G
Sbjct  138  ECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVKVWNLTN-----CKLKNNLIG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG   LWDL  G   R +     D++       NR  +
Sbjct  193  HMGYVNTVTVSPDGSLCASGGKDGVGMLWDLAEG--KRLYSLDAGDIIHALCFSPNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSW  574
             A+   +IK+W+   E K  +   D   EW     F      P  VS +W
Sbjct  251  CAATSSSIKIWDL--ESKSVVD--DLRPEWNK--EFKKKATVPYCVSLAW  294



>ref|XP_005703361.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
 gb|EME26841.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
Length=315

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 139/174 (80%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LV RG +K H +WVT+I  P+DNSD IVS SRD+ I++W +T++   FGV R+ LTGH
Sbjct  3    ETLVYRGALKGHGNWVTSICTPLDNSDFIVSCSRDRKIMIWQITREEGAFGVPRKSLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ D+VLSSDGQFALS SWD  LRLWDL  G + RRFVDHTKDVLSVAFS DNRQIVS
Sbjct  63   SHFISDIVLSSDGQFALSSSWDHTLRLWDLTQGVSTRRFVDHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRDRTIKLWNT+GECKYT+ + DGH++WVSCVRFSPST  P IVS  WD+  K
Sbjct  123  GSRDRTIKLWNTIGECKYTLTE-DGHSDWVSCVRFSPSTATPLIVSCGWDKMVK  175


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 59/125 (47%), Gaps = 8/125 (6%)
 Frame = +2

Query  89   TMKAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQD  265
            T   H+DWV+ +  +P   +  IVS   DK + VWNL+         R  L  H+ ++  
Sbjct  143  TEDGHSDWVSCVRFSPSTATPLIVSCGWDKMVKVWNLSN-----CKIRSNLASHTGYLNT  197

Query  266  VVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
            V +S DG    SG  DG   LW+LQ G     +  +  D+++       R  + A+ +  
Sbjct  198  VSVSPDGSLCASGGKDGVAMLWELQEG--KHLYSLNANDIINALCFSPVRYWLCAATNTA  255

Query  446  IKLWN  460
            IK+W+
Sbjct  256  IKIWD  260



>ref|XP_003569582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=331

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 143/187 (76%), Gaps = 11/187 (6%)
 Frame = +2

Query  62   AQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK-------DGPQFG  220
             QE L   G M+ H D VTAIA PIDNS  IVSSSRDKS++VW+LT           ++G
Sbjct  3    GQESLAYAGVMRGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPIQATQDSSSEYG  62

Query  221  VARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAF  400
            +  RRLTGH HFVQDVVLSSDGQFALSGSWDGELRLWDL  G T RRFV H KDVLSVAF
Sbjct  63   IPFRRLTGHGHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAF  122

Query  401  SVDNRQIVSASRDRTIKLWNTLGECKYTI----QDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            SVDNRQIVSASRDRTIKLWNTLGECKYTI      G+GH  WVSCVRFSP+T  PTIVSG
Sbjct  123  SVDNRQIVSASRDRTIKLWNTLGECKYTIGGDHGGGEGHTGWVSCVRFSPNTFVPTIVSG  182

Query  569  SWDRPXK  589
            SWDR  K
Sbjct  183  SWDRSVK  189


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 66/129 (51%), Gaps = 10/129 (8%)
 Frame = +2

Query  110  WVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVLSSDG  286
            WV+ +  +P     TIVS S D+S+ VWNLT         R  L GH  +V  V +S DG
Sbjct  164  WVSCVRFSPNTFVPTIVSGSWDRSVKVWNLTN-----CKIRSTLDGHGGYVSAVAVSPDG  218

Query  287  QFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTL  466
                SG  DG   LWDL  G      +D    + S+ FS +   + +A++D +IK+W+  
Sbjct  219  SLCASGGKDGVTLLWDLAEGKRLYS-LDAGAIINSLCFSPNRYWLCAATQD-SIKIWDL-  275

Query  467  GECKYTIQD  493
             E K+ +QD
Sbjct  276  -ESKHVVQD  283



>gb|AEO44580.1| receptor for activated C kinase 1 [Dunaliella salina]
Length=318

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            E LV R T+K H+ WVTA+AAP+D  S+ ++S+SRDK++IVW L + G  +G  ++ L G
Sbjct  3    ETLVPRATLKGHSGWVTALAAPLDPASNVLLSASRDKTVIVWELERGGDSYGYPKKSLHG  62

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQF LSGSWDG LRLWDL  G T RRFV HTKDVLSVAFSVDNRQIV
Sbjct  63   HSHFVQDVVISSDGQFCLSGSWDGTLRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIV  122

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD+TI+LWNTLGECKY+I + +GH+EWVSCVRFSP T  P IVSG WD+  K
Sbjct  123  SGSRDKTIRLWNTLGECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVK  177


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 74/170 (44%), Gaps = 14/170 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC    G  + H++WV+ +  +P+  +  IVS   DK + VWNLT         +  L G
Sbjct  138  ECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVKVWNLTN-----CKLKNNLIG  192

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HS +V  V +S DG    SG  D    LWDL  G   R +     D++       NR  +
Sbjct  193  HSGYVNTVTVSPDGSLCASGGKDNVGMLWDLAEG--KRLYSLDAGDIIHALCFSPNRYWL  250

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSW  574
             A+   +IK+W+   E K  +   D   EW     F      P  VS +W
Sbjct  251  CAATSSSIKIWDL--ESKSVVD--DLRPEWNK--EFKKKATVPYCVSLAW  294



>gb|KDO62873.1| hypothetical protein CISIN_1g048118mg [Citrus sinensis]
Length=303

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 137/174 (79%), Gaps = 24/174 (14%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IV++SRDKSIIVW+LTK+   +GVARRRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDMIVTASRDKSIIVWHLTKEEKTYGVARRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFVQDVVLSSDGQF                        V HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVQDVVLSSDGQF------------------------VGHTKDVLSVAFSIDNRQIVS  98

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            ASRDRTIKLWNTLGECKYTIQ+GD H EWVSCVRFSP+TLQPTIVS SWDR  K
Sbjct  99   ASRDRTIKLWNTLGECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVK  152


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P     TIVS+S D+++ VWNL+         R  L G
Sbjct  113  ECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVKVWNLSN-----CKLRATLAG  167

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRF-VDHTKDVLSVAFSVDNRQI  421
            H+ +V  V +S DG    SG  DG + LWDL  G   R + +D    + ++ FS  NR  
Sbjct  168  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KRLYSLDAGAVIHALCFS-PNRYW  224

Query  422  VSASRDRTIKLWNTLGECKYTIQD  493
            + A+ +++IK+W+   E K  ++D
Sbjct  225  LCAATEQSIKIWDL--ESKSIVED  246



>ref|XP_009836542.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces astaci]
 gb|ETV74029.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces astaci]
Length=318

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = +2

Query  74   LVLRGTMKAH-TDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP--QFGVARRRLTG  244
            LVLRGT+  H  +WVTAIA   +N + +V+SSRDKS++VW LT D     +G ARRRLTG
Sbjct  5    LVLRGTLAGHGKNWVTAIATSRENPNLVVTSSRDKSVLVWQLTHDADPDNYGYARRRLTG  64

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFV+DVV+SSDGQFALSGSWDG LRLWDL  G T RRFV H+KDVLSVAFS DNRQIV
Sbjct  65   HSHFVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIV  124

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRDR+IKLWNTLGECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR  K
Sbjct  125  SGSRDRSIKLWNTLGECKYTITE-EGHTEWVSCVRFSPSSANPLIVSAGWDRLVK  178


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 8/125 (6%)
 Frame = +2

Query  89   TMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQD  265
            T + HT+WV+ +  +P   +  IVS+  D+ + VWNLT         R  L GH+ ++  
Sbjct  146  TEEGHTEWVSCVRFSPSSANPLIVSAGWDRLVKVWNLTN-----CKLRTNLCGHTGYLNT  200

Query  266  VVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
            V +S DG    SG  DG   LWDL  G   R +     D++       NR  + A+    
Sbjct  201  VTVSPDGSLCASGGKDGVAMLWDLNEG--KRLYSLEANDIIHALVFSPNRYWLVAATSSA  258

Query  446  IKLWN  460
            IK+W+
Sbjct  259  IKIWD  263



>gb|ABC75581.1| guanine nucleotide binding protein beta 2 [Ictalurus punctatus]
Length=240

 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 142/187 (76%), Gaps = 2/187 (1%)
 Frame = +2

Query  29   PNS*SQRERKMAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDG  208
            P     R  KM ++ + LRGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D 
Sbjct  4    PRKARYRFAKMTEQ-MTLRGTLKGHSGWVTQIATTPQFPDMILSASRDKSIIMWKLTRDE  62

Query  209  PQFGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL  388
              +GV +R L GHSHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVL
Sbjct  63   TNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVL  122

Query  389  SVAFSVDNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            SVAFS DNRQIVS SRD+TIKLWNTLG CKYTIQD +GH+EWVSCV FSP++  P IVS 
Sbjct  123  SVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQD-EGHSEWVSCVHFSPNSSNPIIVSC  181

Query  569  SWDRPXK  589
             WD+  K
Sbjct  182  GWDKLVK  188


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (51%), Gaps = 6/85 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ F+  V 
Sbjct  158  EGHSEWVSCVHFSPNSSNPIIVSCGWDKLVKVWNLAN-----CKLKTNHIGHTGFLNTVT  212

Query  272  LSSDGQFALSGSWDGELRLWDLQAG  346
            +S DG    SG  DG+  LWDL  G
Sbjct  213  VSPDGSLCASGGKDGQAMLWDLNEG  237


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 60/132 (45%), Gaps = 12/132 (9%)
 Frame = +2

Query  98   AHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL--TGHSHFVQDVV  271
             HT  V ++A   DN   IVS SRDK+I +WN        GV +  +   GHS +V  V 
Sbjct  116  GHTKDVLSVAFSADNRQ-IVSGSRDKTIKLWN------TLGVCKYTIQDEGHSEWVSCVH  168

Query  272  LS--SDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
             S  S     +S  WD  +++W+L         + HT  + +V  S D     S  +D  
Sbjct  169  FSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGFLNTVTVSPDGSLCASGGKDGQ  228

Query  446  IKLWNTLGECKY  481
              LW+ L E K+
Sbjct  229  AMLWD-LNEGKH  239



>dbj|BAC56715.1| receptor for activated protein kinase C homolog [Mamestra brassicae]
 gb|AEI84399.1| receptor of activated protein kinase C [Helicoverpa armigera]
Length=319

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+  H  WVT IA      D I+SSSRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLKLRGTLCGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP + QP IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPQSRQPIIVSAGWDRTVK  175


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P      IVS+  D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPQSRQPIIVSAGWDRTVKVWHLTNCKLKIN-----HLGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + S+ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITSLCFS-PNRYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>ref|NP_001187435.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
punctatus]
 gb|ADO28638.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
punctatus]
Length=317

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 138/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D   +GV +R L GH
Sbjct  3    EQMTLRGTLKGHSGWVTQIATTPQFPDMILSASRDKSIIMWKLTRDETNYGVPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  175


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ F+  V 
Sbjct  145  EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLAN-----CKLKTNHIGHTGFLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G      +D    + ++ FS  NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDGGDTINALCFS-PNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>gb|EXX68230.1| Asc1p [Rhizophagus irregularis DAOM 197198w]
Length=308

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            + L LRGT+  H++WVTAIA   +N D I+S+SRDK+IIVWNLT+D   +GV ++ LTGH
Sbjct  3    DTLSLRGTLDGHSNWVTAIATTSENPDMILSASRDKTIIVWNLTRDETNYGVPKKSLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            +HFVQDVV+SSDGQFALS SWD  LRLWDL  GTT RRFV H KDVLSV+FS DNRQIVS
Sbjct  63   NHFVQDVVISSDGQFALSASWDKTLRLWDLNTGTTTRRFVGHDKDVLSVSFSPDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLGECK+ IQ+ DGH+EWVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGECKFNIQE-DGHSEWVSCVRFSPNPSNPVIVSCGWDKLVK  175


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 61/133 (46%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H++WV+ +  +P  ++  IVS   DK + VW LTK        R    GH+ ++  V +
Sbjct  146  GHSEWVSCVRFSPNPSNPVIVSCGWDKLVKVWELTK-----CKLRTNHIGHTGYINTVTI  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG   LWDL  G     +     D+++      NR  + A+    IK+
Sbjct  201  SPDGSLCASGGKDGITMLWDLNEG--KHLYSLEAGDIINALVFSPNRYWLCAATASFIKI  258

Query  455  WNTLGECKYTIQD  493
            W+   E K  + D
Sbjct  259  WDL--ETKTVVDD  269



>ref|XP_005072032.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Mesocricetus auratus]
Length=187

 Score =   241 bits (615),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  175



>gb|ESA03866.1| hypothetical protein GLOINDRAFT_336518 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX68229.1| Asc1p [Rhizophagus irregularis DAOM 197198w]
Length=315

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            + L LRGT+  H++WVTAIA   +N D I+S+SRDK+IIVWNLT+D   +GV ++ LTGH
Sbjct  3    DTLSLRGTLDGHSNWVTAIATTSENPDMILSASRDKTIIVWNLTRDETNYGVPKKSLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            +HFVQDVV+SSDGQFALS SWD  LRLWDL  GTT RRFV H KDVLSV+FS DNRQIVS
Sbjct  63   NHFVQDVVISSDGQFALSASWDKTLRLWDLNTGTTTRRFVGHDKDVLSVSFSPDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLGECK+ IQ+ DGH+EWVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGECKFNIQE-DGHSEWVSCVRFSPNPSNPVIVSCGWDKLVK  175


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 61/133 (46%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H++WV+ +  +P  ++  IVS   DK + VW LTK        R    GH+ ++  V +
Sbjct  146  GHSEWVSCVRFSPNPSNPVIVSCGWDKLVKVWELTK-----CKLRTNHIGHTGYINTVTI  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG   LWDL  G     +     D+++      NR  + A+    IK+
Sbjct  201  SPDGSLCASGGKDGITMLWDLNEG--KHLYSLEAGDIINALVFSPNRYWLCAATASFIKI  258

Query  455  WNTLGECKYTIQD  493
            W+   E K  + D
Sbjct  259  WDL--ETKTVVDD  269



>gb|AAT01086.1| putative activated protein kinase C receptor [Homalodisca vitripennis]
Length=318

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L ++G ++ H+DWVT IA      D IVSSSRDKSIIVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQMKGALRGHSDWVTQIATNPKYPDMIVSSSRDKSIIVWKLTRDEANYGIPQKRLHGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVVLSSDG +ALSGSWD  LRLWDL  G T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVSDVVLSSDGNYALSGSWDKTLRLWDLAVGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSAGWDKVVK  175


 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS+  DK + VWNLT    +         GH+ ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSAGWDKVVKVWNLTNCKLKIN-----HYGHTGYLNCVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH+  + ++ FS  NR  + A+    IK+
Sbjct  201  SPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHSDIITNLCFS-PNRYWLCAAYGPHIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>emb|CDX81860.1| BnaC08g37410D [Brassica napus]
Length=250

 Score =   243 bits (619),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 132/157 (84%), Gaps = 5/157 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSP  538
            ASRDRTIKLWNTLGE         GH  +VS V  SP
Sbjct  123  ASRDRTIKLWNTLGESTLA-----GHTGYVSTVAVSP  154



>ref|XP_011334834.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Cerapachys biroi]
 gb|EZA56887.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Cerapachys biroi]
Length=318

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ESLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSAGWDRVVK  175


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 77/165 (47%), Gaps = 17/165 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL--TGHSHFVQDV  268
             H+DWV+ +  +P   +  IVS+  D+ + VWNLT         R ++  +GH+ ++  V
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSAGWDRVVKVWNLTN-------CRLKINHSGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    I
Sbjct  199  TVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPWI  256

Query  449  KLWN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            K+W+      + E K  +       E   C+  S ST   T+ +G
Sbjct  257  KIWDLETKEMVEELKPEVVSATSKAEPPLCLCLSWSTDGQTLFAG  301



>ref|XP_011049912.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Acromyrmex echinatior]
Length=317

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH +WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHTDWVSCVRFSPNHANPIIVSAGWDRVVK  175


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 17/165 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL--TGHSHFVQDV  268
             HTDWV+ +  +P   +  IVS+  D+ + VWNLT         R ++  +GH+ ++  V
Sbjct  146  GHTDWVSCVRFSPNHANPIIVSAGWDRVVKVWNLTN-------CRLKINHSGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    I
Sbjct  199  TVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPWI  256

Query  449  KLWN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            K+W+      + E K  +      +E   C+  + ST   T+ +G
Sbjct  257  KIWDLETKEMVEELKPEVVSATSKSEPPLCLSLAWSTDGQTLFAG  301



>emb|CDY21720.1| BnaA09g44710D [Brassica napus]
Length=250

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 132/157 (84%), Gaps = 5/157 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSP  538
            ASRDRTIKLWNTLGE         GH  +VS V  SP
Sbjct  123  ASRDRTIKLWNTLGESTLA-----GHTGYVSTVAVSP  154



>gb|AAM88902.1| guanine nucleotide-binding protein [Branchiostoma lanceolatum]
Length=263

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 135/177 (76%), Gaps = 1/177 (1%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E + LRGT+K H +WVT IA    + D I+S+SRD+SIIVW LT+D   +G+  + L
Sbjct  1    MAMEQMTLRGTLKGHGNWVTQIATTPQHPDMILSASRDESIIVWKLTRDENNYGIPYKCL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GHSHFV DVV+SSDGQFALSGSWD  LRLWDL   TT RRFV HTKDVLSVAFS DNRQ
Sbjct  61   NGHSHFVSDVVISSDGQFALSGSWDHTLRLWDLNTATTTRRFVGHTKDVLSVAFSADNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVS SRD+TIKLWNTLG CKYTIQ+ DGH EW SCVRFSP+   P IVS  WD+  K
Sbjct  121  IVSGSRDKTIKLWNTLGVCKYTIQE-DGHTEWTSCVRFSPNNQNPIIVSCGWDKLVK  176



>gb|ADO33039.1| receptor for activated protein kinase C RACK isoform 1 [Biston 
betularia]
Length=320

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+  H  WVT IA      D I+SSSRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLKLRGTLCGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSAGWDRTVK  175


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS+  D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSAGWDRTVKVWHLTNCKLKIN-----HLGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAYGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>ref|NP_001041703.1| receptor for activated protein kinase C RACK 1 isoform 1 [Bombyx 
mori]
 gb|ABD36343.1| receptor for activated protein kinase C RACK isoform 1 [Bombyx 
mori]
 gb|AEH16566.1| receptor for activated protein kinase C [Bombyx mori]
Length=319

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSCGWDRTVK  175


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS   D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSCGWDRTVKVWHLTNCKLKIN-----HLGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>ref|NP_001291517.1| guanine nucleotide-binding protein subunit beta-like protein 
[Solenopsis invicta]
 gb|AEA72283.1| guanine nucleotide-binding protein subunit beta-like protein 
[Solenopsis invicta]
Length=317

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH +WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHTDWVSCVRFSPNHANPIIVSAGWDRVVK  175


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 77/165 (47%), Gaps = 17/165 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL--TGHSHFVQDV  268
             HTDWV+ +  +P   +  IVS+  D+ + VWNLT         R ++  +GH+ ++  V
Sbjct  146  GHTDWVSCVRFSPNHANPIIVSAGWDRVVKVWNLTN-------CRLKINHSGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    I
Sbjct  199  TVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPWI  256

Query  449  KLWN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            K+W+      + E K  +       E   C+  + ST   T+ +G
Sbjct  257  KIWDLETKEMVEELKPEVVSATSKAEPPLCLSLAWSTDGQTLFAG  301



>ref|XP_007244608.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Astyanax mexicanus]
Length=317

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 138/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H+ WVT IA      D I+S+SRDK+I++W LT+D   +GV +R L GH
Sbjct  3    EQMTLRGTLKGHSGWVTQIATTPQFPDMILSASRDKTIVMWKLTRDETNYGVPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ F+  V 
Sbjct  145  EGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGFLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G      +D    + ++ FS  NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDGGDTINALCFS-PNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>gb|AAZ29605.1| activated C kinase 1 receptor [Choristoneura fumiferana]
Length=319

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+  H  WVT IA      D I+SSSRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLKLRGTLCGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSAGWDRTVK  175


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS+  D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSAGWDRTVKVWHLTNCKLKIN-----HLGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKRLHT-LDHNDIITALCFS-PNRYWLCAAYGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>ref|XP_011145304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Harpegnathos saltator]
 gb|EFN90078.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Harpegnathos saltator]
Length=319

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH +WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHTDWVSCVRFSPNHANPIIVSAGWDRVVK  175


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 74/163 (45%), Gaps = 13/163 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             HTDWV+ +  +P   +  IVS+  D+ + VWNLT    +         GH+ ++  V +
Sbjct  146  GHTDWVSCVRFSPNHANPIIVSAGWDRVVKVWNLTNCKLKIN-----HNGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    IK+
Sbjct  201  SPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPWIKI  258

Query  455  WN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            W+      + E K  +       E   C+  + ST   T+ +G
Sbjct  259  WDLETKEMVEELKPEVVSATSKAEPPQCLSLAWSTDGQTLFAG  301



>ref|XP_008873892.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces invadans]
 gb|ETV97683.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces invadans]
Length=318

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 139/175 (79%), Gaps = 4/175 (2%)
 Frame = +2

Query  74   LVLRGTMKAH-TDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP--QFGVARRRLTG  244
            LVLRGT+  H  +WVTAIA   +N + +V++SRDKS++VW LT D     +G ARRRLTG
Sbjct  5    LVLRGTLAGHGKNWVTAIATSRENPNLVVTASRDKSVLVWQLTHDADPDNYGYARRRLTG  64

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFVQDVV+SSDGQFALSGSWDG LRLWDL  G T RRFV H+KDVLSVAFS DNRQIV
Sbjct  65   HSHFVQDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIV  124

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRDR+IKLWNTLGECKYTI + +GH EWVS VRFSPS+  P IVS  WDR  K
Sbjct  125  SGSRDRSIKLWNTLGECKYTITE-EGHTEWVSSVRFSPSSANPLIVSAGWDRVVK  178


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 8/125 (6%)
 Frame = +2

Query  89   TMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQD  265
            T + HT+WV+++  +P   +  IVS+  D+ + VWNLT         R  L GHS ++  
Sbjct  146  TEEGHTEWVSSVRFSPSSANPLIVSAGWDRVVKVWNLTN-----CKLRTNLFGHSGYLNT  200

Query  266  VVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
            V +S DG    SG  DG   LWDL  G   R +     D++       NR  + A+    
Sbjct  201  VTVSPDGSLCASGGKDGVAMLWDLNEG--KRLYALEANDIIHALVFSPNRYWLVAATSSA  258

Query  446  IKLWN  460
            IK+W+
Sbjct  259  IKIWD  263



>gb|AEB26318.1| receptor for activated protein kinase C [Helicoverpa armigera]
Length=319

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+  H  WVT IA      D I+SSSRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLKLRGTLCGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSAGWDRTVK  175


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS+  D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSAGWDRTVKVWHLTNCKLKIN-----HLGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + S+ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITSLCFS-PNRYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>gb|ACR19030.1| receptor for activated protein kinase C [Bombyx mori]
Length=319

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRD+++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDRTLIVWKLTRDENNYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRDRTIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDRTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSCGWDRTVK  175


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS   D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSCGWDRTVKVWHLTNCKLKINHL-----GHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>dbj|BAM17717.1| receptor of activated protein kinase C 1 [Papilio xuthus]
 dbj|BAM18977.1| receptor of activated protein kinase C 1 [Papilio polytes]
Length=319

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+  H  WVT IA      D I+SSSRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLKLRGTLCGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH +WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHTDWVSCVRFSPNHANPIIVSAGWDRTVK  175


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             HTDWV+ +  +P   +  IVS+  D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHTDWVSCVRFSPNHANPIIVSAGWDRTVKVWHLTNCKLKIN-----HLGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>emb|CAG01204.1| unnamed protein product [Tetraodon nigroviridis]
Length=317

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHSGWVTQIATTPQYPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSG+WDG LRLWDL +G T RRFV H+KDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGAWDGTLRLWDLTSGNTTRRFVGHSKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRDRTIKLWNTLG CKYTIQD D H+EWVSCVRFSP++  P IVS  WDR  K
Sbjct  123  GSRDRTIKLWNTLGVCKYTIQD-DSHSEWVSCVRFSPNSSNPIIVSCGWDRIVK  175


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 60/126 (48%), Gaps = 8/126 (6%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
            +H++WV+ +  +P  ++  IVS   D+ + VWNL          +    GH  ++  V +
Sbjct  146  SHSEWVSCVRFSPNSSNPIIVSCGWDRIVKVWNLAN-----CKLKTNHIGHGGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG+  LWDL  G     +   + D ++      NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGRDGQAMLWDLNEG--KHLYTLDSGDTINALCFSPNRYWLCAATGPSIKI  258

Query  455  WNTLGE  472
            W+  G+
Sbjct  259  WDLEGK  264



>emb|CDY60778.1| BnaC05g50130D [Brassica napus]
Length=250

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 132/157 (84%), Gaps = 5/157 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSP  538
            ASRDRTIKLWNTLGE         GH  +V+ V  SP
Sbjct  123  ASRDRTIKLWNTLGESTLA-----GHTGYVNTVAVSP  154



>dbj|BAD52259.1| receptor for activated protein kinase C homolog [Plutella xylostella]
Length=319

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+  H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLKLRGTLCGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSAGWDRTVK  175


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS+  D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSAGWDRTVKVWHLTNCKLKIN-----HLGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>emb|CDY26186.1| BnaA06g12310D [Brassica napus]
Length=250

 Score =   241 bits (616),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 132/157 (84%), Gaps = 5/157 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSP  538
            ASRDRTIKLWNTLGE         GH  +V+ V  SP
Sbjct  123  ASRDRTIKLWNTLGESTLA-----GHTGYVNTVAVSP  154



>gb|KDR18184.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Zootermopsis nevadensis]
Length=317

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      DTI+S SRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDTILSCSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVSDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHSNPIIVSAGWDKVVK  175


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 12/124 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT--GHSHFVQDV  268
             H+DWV+ +  +P  ++  IVS+  DK + VWNLT         R ++   GH+ ++  V
Sbjct  146  GHSDWVSCVRFSPNHSNPIIVSAGWDKVVKVWNLTN-------CRLKINHIGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +I
Sbjct  199  TVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPSI  256

Query  449  KLWN  460
            K+W+
Sbjct  257  KIWD  260



>gb|ABX55886.1| activated C kinase 1 receptor [Spodoptera exigua]
Length=319

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+  H  WVT IA      D I+SSSRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLKLRGTLCGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFLSDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSAGWDRTVK  175


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS+  D+++ VW+LT    +         GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSAGWDRTVKVWHLTNCKLKIN-----HLGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + S+ FS D R  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITSLCFSPD-RYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>ref|XP_004697224.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Echinops telfairi]
Length=243

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  175



>gb|ACO09909.1| Guanine nucleotide-binding protein subunit beta 2-like 1 [Osmerus 
mordax]
Length=317

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKSIIMWKLTRDETNYGIPQRALKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 65/127 (51%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ F+  V 
Sbjct  145  ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGFLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G      +D   ++ ++ FS  NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDSGDNINALCFS-PNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>gb|EHJ73733.1| receptor for activated protein kinase C-like protein [Danaus 
plexippus]
Length=317

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+  H  WVT IA      + I+SSSRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLKLRGTLCGHNGWVTQIATNPKYPEMILSSSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHANPIIVSAGWDRAVK  175


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 64/122 (52%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS+  D+++ VW+LT    +  +  R   GHS ++  V +
Sbjct  146  GHSDWVSCVRFSPNHANPIIVSAGWDRAVKVWHLTN--CKLKINHR---GHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +I++
Sbjct  201  SPDGSLCASGGKDMKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPSIRI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>gb|AGM32571.1| WD40 domain containing protein, partial [Coptotermes formosanus]
Length=275

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+S SRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSCSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVSDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHSNPIIVSAGWDKVVK  175


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 12/124 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT--GHSHFVQDV  268
             H+DWV+ +  +P  ++  IVS+  DK + VWNLT         R ++   GH+ ++  V
Sbjct  146  GHSDWVSCVRFSPNHSNPIIVSAGWDKVVKVWNLTN-------CRLKINHIGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +I
Sbjct  199  TVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPSI  256

Query  449  KLWN  460
            K+W+
Sbjct  257  KIWD  260



>ref|XP_003394799.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Bombus terrestris]
 ref|XP_003485657.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Bombus impatiens]
Length=317

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH +WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHTDWVSCVRFSPNHSNPIIVSAGWDKLVK  175


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 78/165 (47%), Gaps = 17/165 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL--TGHSHFVQDV  268
             HTDWV+ +  +P  ++  IVS+  DK + VWNLT         R ++  +GH+ ++  V
Sbjct  146  GHTDWVSCVRFSPNHSNPIIVSAGWDKLVKVWNLTN-------CRLKINHSGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    I
Sbjct  199  TVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPWI  256

Query  449  KLWN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            K+W+      + E K  +       E   C+  + ST   T+ +G
Sbjct  257  KIWDLETKEMVEELKPEVVSATSKAEPPHCLSLAWSTDGQTLFAG  301



>gb|KDO19117.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
parasitica CBS 223.65]
Length=326

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 140/181 (77%), Gaps = 6/181 (3%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTD-WVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDG---PQFGVA  226
            MA++ L LRGT+  H   WVTAIA   +N   IV++SRDKSI+VW LT D      +G A
Sbjct  8    MAEQ-LTLRGTLAGHGKAWVTAIATSRENPSMIVTASRDKSILVWQLTGDSSDLENYGFA  66

Query  227  RRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSV  406
            RRRL GHSHFV+DVV+SSDGQFALSGSWDG LRLWDL  G T RRFV H+KDVLSVAFS 
Sbjct  67   RRRLQGHSHFVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSA  126

Query  407  DNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPX  586
            DNRQIVS SRDR+IKLWNTLGECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR  
Sbjct  127  DNRQIVSGSRDRSIKLWNTLGECKYTITE-EGHTEWVSCVRFSPSSANPLIVSCGWDRLV  185

Query  587  K  589
            K
Sbjct  186  K  186


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 59/125 (47%), Gaps = 8/125 (6%)
 Frame = +2

Query  89   TMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQD  265
            T + HT+WV+ +  +P   +  IVS   D+ + VWNLT         R  L GH+ ++  
Sbjct  154  TEEGHTEWVSCVRFSPSSANPLIVSCGWDRLVKVWNLTNCK-----LRTNLCGHTGYLNT  208

Query  266  VVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
            V +S DG    SG  DG   LWDL  G   R +     D++       NR  + A+    
Sbjct  209  VTVSPDGSLCASGGKDGVAMLWDLNEGK--RLYTLEAGDIIHALVFSPNRYWLCAATSSG  266

Query  446  IKLWN  460
            IK+W+
Sbjct  267  IKIWD  271



>ref|XP_392962.1| PREDICTED: receptor of activated protein kinase C 1 isoformX1 
[Apis mellifera]
 ref|XP_003692430.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Apis florea]
 ref|XP_006620958.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like isoform X1 [Apis dorsata]
Length=317

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH +WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHTDWVSCVRFSPNHSNPIIVSAGWDKLVK  175


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 77/165 (47%), Gaps = 17/165 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT--GHSHFVQDV  268
             HTDWV+ +  +P  ++  IVS+  DK + VWNLT         R ++   GH+ ++  V
Sbjct  146  GHTDWVSCVRFSPNHSNPIIVSAGWDKLVKVWNLTN-------CRLKINHCGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    I
Sbjct  199  TVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPWI  256

Query  449  KLWN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            K+W+      + E K  +       E   C+  + ST   T+ +G
Sbjct  257  KIWDLETKEMVEELKPEVVSATSKAEPPHCLSLAWSTDGQTLFAG  301



>ref|XP_011259045.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Camponotus floridanus]
 gb|EFN74185.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Camponotus floridanus]
Length=317

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL  G T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAVGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH +WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHTDWVSCVRFSPNHANPIIVSAGWDRIVK  175


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 77/165 (47%), Gaps = 17/165 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL--TGHSHFVQDV  268
             HTDWV+ +  +P   +  IVS+  D+ + VWNLT         R ++  +GH+ ++  V
Sbjct  146  GHTDWVSCVRFSPNHANPIIVSAGWDRIVKVWNLTN-------CRLKINHSGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    I
Sbjct  199  TVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPWI  256

Query  449  KLWN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            K+W+      + E K  +       E   C+  + ST   T+ +G
Sbjct  257  KIWDLETKEMVEELKPEVVSATSKAEPPLCLSLAWSTDGQTLFAG  301



>gb|AAX54700.1| receptor of activated protein kinase C 1 [Branchiostoma belcheri 
tsingtauense]
Length=317

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 135/177 (76%), Gaps = 1/177 (1%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E + LRGT+K H +WVT IA    + D I+S+SRD+SIIVW LT+D   +G+  + L
Sbjct  1    MAMEQMTLRGTLKGHGNWVTQIATTPQHPDMILSASRDESIIVWKLTRDENNYGIPYKCL  60

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GHSHFV DVV+SSDGQFALSGSWD  LRLWDL   TT RRFV HTKDVLSVAFS DNRQ
Sbjct  61   NGHSHFVSDVVISSDGQFALSGSWDHTLRLWDLNTATTTRRFVGHTKDVLSVAFSADNRQ  120

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVS SRD+TIKLWNTLG CKYTIQ+ DGH EW SCVRFSP+   P IVS  WD+  K
Sbjct  121  IVSGSRDKTIKLWNTLGVCKYTIQE-DGHTEWTSCVRFSPNNQNPIIVSCGWDKLVK  176



>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution 
Of 2.45 Angstrom
 pdb|4AOW|B Chain B, Crystal Structure Of The Human Rack1 Protein At A Resolution 
Of 2.45 Angstrom
 pdb|4AOW|C Chain C, Crystal Structure Of The Human Rack1 Protein At A Resolution 
Of 2.45 Angstrom
Length=340

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = +2

Query  53   RKMAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARR  232
            + M  E + LRGT+K H  WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R
Sbjct  21   QSMMTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQR  80

Query  233  RLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDN  412
             L GHSHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DN
Sbjct  81   ALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDN  140

Query  413  RQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            RQIVS SRD+TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  141  RQIVSGSRDKTIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  198


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  168  ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLAN-----CKLKTNHIGHTGYLNTVT  222

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +     D+++      NR  + A+   +IK
Sbjct  223  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDGGDIINALCFSPNRYWLCAATGPSIK  280

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  281  IWDLEGK  287



>ref|XP_008608530.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
 gb|EQC38203.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
Length=319

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 140/181 (77%), Gaps = 6/181 (3%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTD-WVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDG---PQFGVA  226
            MA++ L LRGT+  H   WVTAIA   +N   IV++SRDKSI+VW LT D      +G A
Sbjct  1    MAEQ-LTLRGTLAGHGKAWVTAIATSRENPSMIVTASRDKSILVWQLTGDSSDLENYGFA  59

Query  227  RRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSV  406
            RRRL GHSHFV+DVV+SSDGQFALSGSWDG LRLWDL  G T RRFV H+KDVLSVAFS 
Sbjct  60   RRRLQGHSHFVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSA  119

Query  407  DNRQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPX  586
            DNRQIVS SRDR+IKLWNTLGECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR  
Sbjct  120  DNRQIVSGSRDRSIKLWNTLGECKYTITE-EGHTEWVSCVRFSPSSANPLIVSCGWDRLV  178

Query  587  K  589
            K
Sbjct  179  K  179


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 59/125 (47%), Gaps = 8/125 (6%)
 Frame = +2

Query  89   TMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQD  265
            T + HT+WV+ +  +P   +  IVS   D+ + VWNLT         R  L GH+ ++  
Sbjct  147  TEEGHTEWVSCVRFSPSSANPLIVSCGWDRLVKVWNLTNCK-----LRTNLCGHTGYLNT  201

Query  266  VVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
            V +S DG    SG  DG   LWDL  G   R +     D++       NR  + A+    
Sbjct  202  VTVSPDGSLCASGGKDGVAMLWDLNEG--KRLYTLEAGDIIHALVFSPNRYWLCAATSSG  259

Query  446  IKLWN  460
            IK+W+
Sbjct  260  IKIWD  264



>gb|ACV53651.1| guanine nucleotide-binding protein beta polypeptide 2-like 1 
[Paramisgurnus dabryanus]
Length=317

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H+ WVT IA      D I+S+SRDKS+I+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHSGWVTQIATTPQFPDMILSASRDKSVIMWKLTRDETNYGIPQRALKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD D H EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 8/126 (6%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
            +HT+WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V +
Sbjct  146  SHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG+  LWDL  G     +     DV++      NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDGGDVINALCFSPNRYWLCAATGPSIKI  258

Query  455  WNTLGE  472
            W+  G+
Sbjct  259  WDLEGK  264



>ref|XP_002735015.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Saccoglossus kowalevskii]
Length=316

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK++I+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTVIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  G T RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVMSSDGQFALSGSWDGTLRLWDLTTGVTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRDRTIKLWNTLG CKYTIQ+ DGH EWVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDRTIKLWNTLGICKYTIQE-DGHTEWVSCVRFSPNNQNPIIVSCGWDKHVK  175


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 77/166 (46%), Gaps = 13/166 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             HT+WV+ +  +P + +  IVS   DK + VWNLT         +    GHS ++  V +
Sbjct  146  GHTEWVSCVRFSPNNQNPIIVSCGWDKHVKVWNLTN-----CKLKTNHIGHSGYLNCVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG+  LWDL  G      +D  + + ++ FS  NR  + A+   TIK+
Sbjct  201  SPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDGGEIINALCFS-PNRYWLCAATGPTIKI  258

Query  455  WNTLG-----ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            W+  G     E +  +  G    E   C+  + S    T+ +G  D
Sbjct  259  WDLEGKIIVDELRPEVITGSSKAEPPQCISLAWSADGQTLFAGYTD  304



>ref|NP_001266445.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Oreochromis 
niloticus]
 sp|O42249.1|GBLP_ORENI RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Oreochromis niloticus]
 gb|AAB81618.1| receptor for activated protein kinase C [Oreochromis niloticus]
Length=317

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHSGWVTQIATTPKYPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSG+WDG LRLWDL  G T RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGAWDGTLRLWDLTTGLTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + HT+WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +   + DV++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDSGDVINALCFSPNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|XP_004540947.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Maylandia zebra]
 ref|XP_005719882.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Pundamilia nyererei]
 ref|XP_005921230.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Haplochromis burtoni]
 ref|XP_006781554.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Neolamprologus brichardi]
 gb|AAQ91574.1| receptor for activated protein kinase C [Oreochromis mossambicus]
Length=317

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHSGWVTQIATTPQYPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSG+WDG LRLWDL  G T RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGAWDGTLRLWDLTTGLTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + HT+WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +   + DV++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDSGDVINALCFSPNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>gb|ACQ83470.1| receptor of activated protein kinase C [Platynereis dumerilii]
Length=318

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+  H +WVT IA      D I+S+SRDKS+I+W LT+D   +G+ ++ L GH
Sbjct  3    EQMTLRGTLTGHGNWVTQIATTPQYPDMILSASRDKSLIMWKLTRDETNYGIPQKALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
             HFV DVV+SSDGQFALSGSWDG LRLWDL AGTT R FV HTKDVLSVAFS DNRQIVS
Sbjct  63   GHFVSDVVMSSDGQFALSGSWDGTLRLWDLSAGTTTRNFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD++IKLWNTLG CKYTIQ  DGH++WVSCVRFSP+T  P IVS  WD+  K
Sbjct  123  GSRDKSIKLWNTLGVCKYTIQQEDGHSDWVSCVRFSPNTQNPIIVSCGWDKTVK  176


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 8/126 (6%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P   +  IVS   DK++ VWNLT         +    GH+ ++  V +
Sbjct  147  GHSDWVSCVRFSPNTQNPIIVSCGWDKTVKVWNLTN-----CKLKTNHIGHTGYLNVVTV  201

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG+  LWDL  G       D    + S+ FS  NR  + A+   +IK+
Sbjct  202  SPDGSLCASGGKDGQAMLWDLNEGKHLYTL-DGGDIINSLCFS-PNRYWLCAATGPSIKI  259

Query  455  WNTLGE  472
            W+  G+
Sbjct  260  WDLEGK  265



>gb|ADO27998.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
furcatus]
Length=317

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D   +GV +R L GH
Sbjct  3    EQMTLRGTLKGHSGWVTQIATTPQFPDMILSASRDKSIIMWKLTRDETNYGVPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVA S DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVASSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  175


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 63/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H++WV+ +  +P  ++  IVS   DK + VWNLT         +    GH+ F+  V 
Sbjct  145  EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLTN-----CKLKTNHIGHTGFLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G       D    + ++ FS  NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEGKHLYTL-DGGDTINALCFS-PNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|XP_005711409.1| receptor for activated protein kinase C [Chondrus crispus]
 emb|CDF41115.1| receptor for activated protein kinase C [Chondrus crispus]
Length=320

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 137/177 (77%), Gaps = 4/177 (2%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ---FGVARRRL  238
            E L LRG +K H+ WVTA+A  +DN++ ++S+SRDK+IIVW LT D  +   +G  +R L
Sbjct  3    ETLSLRGYLKGHSGWVTALATTVDNTNIVLSASRDKTIIVWQLTTDTEELGSYGYPKRAL  62

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GH HFV DVVLSSDGQFALS SWD  LRLWDL  G T RRFV H+KDVLSVAFS DNRQ
Sbjct  63   RGHGHFVSDVVLSSDGQFALSSSWDHTLRLWDLSTGVTTRRFVGHSKDVLSVAFSADNRQ  122

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVS SRDRTIKLWNTLGECKYTIQ+ +GH EWVSCVRFSPST  P IVS  WD+  K
Sbjct  123  IVSGSRDRTIKLWNTLGECKYTIQE-EGHTEWVSCVRFSPSTQNPLIVSCGWDKLVK  178


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 58/123 (47%), Gaps = 8/123 (7%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + HT+WV+ +  +P   +  IVS   DK + VWNLT         R  L  HS ++  V 
Sbjct  148  EGHTEWVSCVRFSPSTQNPLIVSCGWDKLVKVWNLTN-----CKLRTNLHNHSGYLNAVT  202

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG   LWDLQ G     +     D++       NR  + A+ +  IK
Sbjct  203  VSPDGSLCASGGKDGVAMLWDLQEG--KHLYSLEANDIIHALCFSPNRYWLCAATNSCIK  260

Query  452  LWN  460
            +W+
Sbjct  261  IWD  263



>gb|ACH70647.1| guanine nucleotide binding protein (G protein) beta polypeptide 
2-like 1 [Salmo salar]
 gb|ACI67449.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Salmo 
salar]
 gb|ACI68732.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Salmo 
salar]
 gb|ACN11018.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Salmo 
salar]
 gb|ACN11311.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Salmo 
salar]
 gb|AHG98234.1| guanine nucleotide-binding protein subunit beta-2-like 1-1, partial 
[Coregonus clupeaformis]
 emb|CDQ88192.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ79714.1| unnamed protein product [Oncorhynchus mykiss]
Length=317

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H  WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHNGWVTQIATTPQFPDMILSASRDKSIIMWKLTRDETNYGIPQRALKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 65/127 (51%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G      +D   ++ ++ FS  NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDSGDNINALCFS-PNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|XP_001631784.1| predicted protein [Nematostella vectensis]
 gb|EDO39721.1| predicted protein [Nematostella vectensis]
Length=315

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = +2

Query  59   MAQECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L LRGT+K H  WVT IA    N DTI+SSSRDK +IVW LT+D   +G A++ L
Sbjct  1    MAEQ-LSLRGTLKGHNGWVTQIATNPSNPDTILSSSRDKKLIVWELTRDDANYGFAKKSL  59

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
            TGH+HFV DVV+SSDGQFALSGSWD  LRLWDL AG T RRFV HTKDVLSVAFS DNRQ
Sbjct  60   TGHNHFVSDVVMSSDGQFALSGSWDKTLRLWDLNAGVTTRRFVGHTKDVLSVAFSADNRQ  119

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVS +RD  IKLWNTLG CKYTIQ+ + H+EWVSCVRFSP+T  P IVS  WD+  K
Sbjct  120  IVSGARDHHIKLWNTLGVCKYTIQE-ETHSEWVSCVRFSPNTSNPIIVSSGWDKLIK  175


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 77/167 (46%), Gaps = 13/167 (8%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H++WV+ +  +P  ++  IVSS  DK I VWNLT         +    GH+ ++  V 
Sbjct  145  ETHSEWVSCVRFSPNTSNPIIVSSGWDKLIKVWNLTN-----CRLKTNHIGHTGYLNCVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +     D+++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNDG--KHLYTLSGGDIINAMTFSPNRYWLCAAVGPSIK  257

Query  452  LWNTLG-----ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            +W+  G     E +  I +  G  +   CV  + S    T+ +G  D
Sbjct  258  IWDLEGKSLVDELRPEIINMGGKAQPHDCVSLAWSADGQTLFAGYTD  304



>ref|XP_001600152.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Nasonia vitripennis]
Length=317

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHT+DVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTQDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQ+ DGH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQE-DGHSDWVSCVRFSPNHSNPIIVSAGWDRVVK  175


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 77/165 (47%), Gaps = 17/165 (10%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT--GHSHFVQDV  268
             H+DWV+ +  +P  ++  IVS+  D+ + VWNLT         R ++   GH+ ++  V
Sbjct  146  GHSDWVSCVRFSPNHSNPIIVSAGWDRVVKVWNLTN-------CRLKINHNGHTGYLNTV  198

Query  269  VLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTI  448
             +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    I
Sbjct  199  TVSPDGSLCASGGKDNKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAYGPWI  256

Query  449  KLWNTLG-----ECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            K+W+  G     E K  +       E   C+  + ST   T+ +G
Sbjct  257  KIWDLEGKEMVEELKPDVVSTTSKAEPPQCLSLAWSTDGQTLFAG  301



>gb|ABI63548.1| receptor for activated protein kinase C-like [Blattella germanica]
Length=317

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+S SRDK++IVW LT+D   +GV ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSCSRDKTLIVWKLTRDETNYGVPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFVSDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNHSNPIIVSAGWDKVVK  175


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 78/166 (47%), Gaps = 13/166 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P  ++  IVS+  DK + VWNLT    +         GH+ ++  V +
Sbjct  146  GHSDWVSCVRFSPNHSNPIIVSAGWDKVVKVWNLTNCKLKIN-----HIGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPSIKI  258

Query  455  W-----NTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWD  577
            W     + + E +  +       E   C+  + ST   T+ +G +D
Sbjct  259  WDLESKDMVEELRPEVVSQTSKAEPPQCLSLAWSTDGQTLFAGYFD  304



>ref|XP_006679085.1| hypothetical protein BATDEDRAFT_33248 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80461.1| hypothetical protein BATDEDRAFT_33248 [Batrachochytrium dendrobatidis 
JAM81]
Length=315

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 139/174 (80%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            + LVLRGT+K HT+WVTAIA   ++ DTI+S+SRDK++IVW LT+D   +GV  R LTGH
Sbjct  3    DTLVLRGTLKGHTNWVTAIATSPESPDTILSASRDKTVIVWRLTRDDSNYGVPYRSLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            +HFV DVV+SSDGQFALS SWD  LRLWDL  G T R+FV HT DVLSV+FS DNRQIVS
Sbjct  63   NHFVSDVVISSDGQFALSASWDKTLRLWDLSTGKTTRQFVGHTNDVLSVSFSPDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD++IKLWNTLGECKY I + DGH+EWVSCV+FSP+ L P IVS  WD+  K
Sbjct  123  GSRDKSIKLWNTLGECKYNIIE-DGHSEWVSCVKFSPNPLNPVIVSSGWDKLVK  175


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H++WV+ +  +P   +  IVSS  DK + VW+L+K     G  +    GH+ ++  + +
Sbjct  146  GHSEWVSCVKFSPNPLNPVIVSSGWDKLVKVWDLSK-----GKLKTNHYGHTGYINTITI  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG   LWDL  G     +     D++S      NR  + A+    IK+
Sbjct  201  SPDGSLCASGGKDGVTMLWDLNDG--KHLYSLEAGDIISALVFSPNRYWLCAASGSGIKI  258

Query  455  WNTLGECKYTIQD  493
            W+   E K  + D
Sbjct  259  WDL--ESKSVVAD  269



>gb|AHG98209.1| guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Oncorhynchus mykiss]
Length=317

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H  WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHNGWVTQIATTPQFPDMILSASRDKSIIMWKLTRDETNYGIPQRALKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +  DG    SG  DG+  LWDL  G      +D   ++ ++ FS  NR  + A+   +IK
Sbjct  200  VPPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDSGDNINALCFS-PNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|NP_571519.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Danio 
rerio]
 sp|O42248.1|GBLP_DANRE RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Danio rerio]
 gb|AAB81617.1| receptor for activated protein kinase C [Danio rerio]
 gb|AAH49459.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Danio rerio]
 gb|AAQ98014.1| guanine nucleotide binding protein beta polypeptide 2-like 1 
[Danio rerio]
Length=317

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H+ WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHSGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD D H EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 63/126 (50%), Gaps = 8/126 (6%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
            +HT+WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V +
Sbjct  146  SHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG+  LWDL  G      +D    + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDGGDTINALCFS-PNRYWLCAATGPSIKI  258

Query  455  WNTLGE  472
            W+  G+
Sbjct  259  WDLEGK  264



>ref|NP_001086465.1| uncharacterized protein LOC446289 [Xenopus laevis]
 ref|NP_001080133.1| guanine nucleotide binding protein, beta 2, related sequence 
1 [Xenopus laevis]
 gb|AAH41541.1| Gnb2l1-prov protein [Xenopus laevis]
 gb|AAI11472.1| LOC446289 protein [Xenopus laevis]
Length=317

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+SSSRDKS+I+W LT+D   +GV +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSSSRDKSVIMWKLTRDETNYGVPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+Q+ + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTVQE-ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 63/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GHS ++  V 
Sbjct  145  ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHSGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +   + DV++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDSGDVINALCFSPNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>gb|AAI50408.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Danio rerio]
Length=317

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H+ WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHSGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD D H EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 8/126 (6%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
            +HT+WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V +
Sbjct  146  SHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG+  LWDL  G      +D    + ++ FS  NR  + A+   +I++
Sbjct  201  SPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDGGDTINALCFS-PNRYWLCAATGPSIRI  258

Query  455  WNTLGE  472
            W+  G+
Sbjct  259  WDLEGK  264



>ref|XP_009037831.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
 gb|EGB07194.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
Length=319

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK-----DGPQFGVARR  232
            E L LRGT+K H+DWVT+IA   ++   I+SSSRDK++++W LT      +G  +G  RR
Sbjct  3    EALTLRGTLKGHSDWVTSIATTSEDPSMILSSSRDKTVLLWALTAGGGSAEGEAYGYPRR  62

Query  233  RLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDN  412
             L GHSHFV DVV+SSDGQFALSGSWDG LRLW+L  G T RRFV HTKDVLSVAFS DN
Sbjct  63   ALKGHSHFVSDVVISSDGQFALSGSWDGTLRLWELATGKTTRRFVGHTKDVLSVAFSTDN  122

Query  413  RQIVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            RQIVS SRD+T+KLWNTLGECKYTI D +GH EWVSCVRFSPS   P IVS  WD+  K
Sbjct  123  RQIVSGSRDKTVKLWNTLGECKYTISD-EGHTEWVSCVRFSPSVQAPVIVSCGWDKLVK  180


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 10/124 (8%)
 Frame = +2

Query  95   KAHTDWVTAI-AAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + HT+WV+ +  +P   +  IVS   DK + VW+LT         R  L GH+ ++  V 
Sbjct  150  EGHTEWVSCVRFSPSVQAPVIVSCGWDKLVKVWSLTN-----CKLRTNLYGHNGYLNTVT  204

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVL-SVAFSVDNRQIVSASRDRTI  448
            +S DG    SG  DG   LWDL  G   R +     DV+ S+ FS  NR  + A+    +
Sbjct  205  VSPDGSLCASGGKDGTAMLWDLNEG--KRLYSLDAGDVIHSLVFS-PNRYWLCAATTLGV  261

Query  449  KLWN  460
            K+W+
Sbjct  262  KIWD  265



>ref|XP_003970442.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Takifugu rubripes]
Length=317

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHSGWVTQIATTPQYPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSG+WDG LRLWDL  G T RRFV H+KDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGAWDGTLRLWDLTTGITTRRFVGHSKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD D H EWVSCVRFSP++  P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDRVVK  175


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 8/126 (6%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
            +HT+WV+ +  +P  ++  IVS   D+ + VWNL          +    GHS ++  V +
Sbjct  146  SHTEWVSCVRFSPNSSNPIIVSCGWDRVVKVWNLAN-----CKLKTNHIGHSGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG+  LWDL  G     +   + D ++      NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGRDGQAMLWDLNEG--KHLYTLDSGDTINALCFSPNRYWLCAATGPSIKI  258

Query  455  WNTLGE  472
            W+  G+
Sbjct  259  WDLEGK  264



>ref|XP_004343796.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE96804.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
Length=316

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 138/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT+K H+ WVT IA   +  D +VS+SRDKS+I+WNLT+D   +GV +RRL GH
Sbjct  3    EQLTLRGTLKGHSGWVTQIATTPEVPDLLVSASRDKSLIIWNLTRDETNYGVPKRRLQGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            +HFV DVV+SSDGQFALSGSWD  LRLWDL +G T RRFV HT DVLSVAFS DNRQIVS
Sbjct  63   NHFVSDVVISSDGQFALSGSWDHTLRLWDLNSGVTTRRFVGHTSDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD++I+LWNTLGECK+ IQ+ DGH+EWVS VRFSP+T  P IVS  WDR  K
Sbjct  123  GSRDKSIRLWNTLGECKFVIQE-DGHSEWVSSVRFSPNTSNPNIVSVGWDRVVK  175


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 61/133 (46%), Gaps = 10/133 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H++WV+++  +P  ++  IVS   D+ + VWNL          R    GH+ +V  V +
Sbjct  146  GHSEWVSSVRFSPNTSNPNIVSVGWDRVVKVWNLNN-----CKLRTNHYGHTGYVNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG   LWDL  G     +     D ++      NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDGVAMLWDLNEG--KHLYTLEAGDEINALVFSPNRYWLCAASGASIKI  258

Query  455  WNTLGECKYTIQD  493
            W+   E K  + D
Sbjct  259  WDL--ESKNLVDD  269



>emb|CDX96736.1| BnaA08g22790D [Brassica napus]
Length=250

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 132/157 (84%), Gaps = 5/157 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDQVTAIATPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSP  538
            ASRDRTIKLWNTLGE         GH+ +VS V  SP
Sbjct  123  ASRDRTIKLWNTLGESTLA-----GHSGYVSTVAVSP  154



>ref|XP_004341795.1| guanine nucleotide-binding protein beta subunit, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR19703.1| guanine nucleotide-binding protein beta subunit, putative [Acanthamoeba 
castellanii str. Neff]
Length=321

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            + L L+G ++ H+ WV +IA   +N+D I+S+SRDK+++VWNLT+D   +G  +R L GH
Sbjct  3    DSLTLKGVLRGHSGWVNSIATTTENNDMILSASRDKTLLVWNLTRDEDNYGQPKRALKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALS SWD  LRLWDL AGTT RRFV H+KDVLSVAFS DNRQIVS
Sbjct  63   SHFVNDVVISSDGQFALSASWDNTLRLWDLNAGTTTRRFVGHSKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRDR+IKLWNTLGECKYTI     H EWVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDRSIKLWNTLGECKYTIDGEGAHTEWVSCVRFSPNAANPVIVSSGWDKLVK  176


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 80/175 (46%), Gaps = 19/175 (11%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC        AHT+WV+ +  +P   +  IVSS  DK + VWNL          R  L G
Sbjct  137  ECKYTIDGEGAHTEWVSCVRFSPNAANPVIVSSGWDKLVKVWNL-----HNCRLRTNLRG  191

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H+ +V  V +S DG    SG  DG   LWDL  G      ++  + + S+ FS  NR  +
Sbjct  192  HTGYVNTVTVSPDGSLCASGGKDGTAMLWDLNEGKHLSS-LEGGEIIHSLVFS-PNRYWL  249

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRF-----SPSTLQPTIVSGSW  574
             A+    I++W+   E K  + + + +N    C  F     +P    PT +S +W
Sbjct  250  CAATTTGIRIWDL--ESKSVVAELNKNN----CAGFFGDDDTPKDKNPTPISLAW  298



>emb|CDX83869.1| BnaC08g17760D [Brassica napus]
Length=250

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 131/157 (83%), Gaps = 5/157 (3%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E LVL+GTM+AHTD VTAIA PIDNSD IVS+SRDKSII+W LTKD   +GVA+RRLTGH
Sbjct  3    EGLVLKGTMRAHTDQVTAIATPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV+DVVLSSDGQFALSGSWDGELRLWDL AG + RRFV HTKDVLSVAFS+DNRQIVS
Sbjct  63   SHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSP  538
            ASRDRTIKLWNTLGE         GH  +VS V  SP
Sbjct  123  ASRDRTIKLWNTLGESTLA-----GHTGYVSTVAVSP  154



>ref|XP_011301856.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Fopius arisanus]
Length=317

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L L+GT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLKGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD +GH++WVSCVRFSP+   P IVS  WDR  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-EGHSDWVSCVRFSPNHSNPIIVSAGWDRIVK  175


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 79/166 (48%), Gaps = 17/166 (10%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL--TGHSHFVQD  265
            + H+DWV+ +  +P  ++  IVS+  D+ + VWNLT         R ++  +GH+ ++  
Sbjct  145  EGHSDWVSCVRFSPNHSNPIIVSAGWDRIVKVWNLTN-------CRLKINHSGHTGYLNT  197

Query  266  VVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
            V +S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    
Sbjct  198  VTVSPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPW  255

Query  446  IKLWN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            IK+W+      + E K  +       E   C+  + ST   T+ +G
Sbjct  256  IKIWDLESKEMVEELKPEVVSTTSKAEPPQCLSLAWSTDGQTLFAG  301



>ref|XP_006631768.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Lepisosteus oculatus]
Length=317

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H  WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHNGWVTQIATTPQFPDMILSASRDKSIIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD + H EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-ESHTEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 64/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++HT+WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  ESHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G      +D    + ++ FS  NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDGGDTINALCFS-PNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>gb|ACN10148.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Salmo 
salar]
 gb|ACN12499.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Salmo 
salar]
Length=317

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H  WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHNGWVTQIATTPQFPDMILSASRDKSIIMWKLTRDETNYGIPQRALKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  ESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG     G  DG+  LWDL  G      +D   ++ ++ FS  NR  + A+   +IK
Sbjct  200  VSPDGSLCAFGGKDGQAMLWDLNEGKHLYT-LDSGDNINALCFS-PNRYWLCAAPGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|XP_008550735.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Microplitis demolitor]
Length=223

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L L+G +  H+ WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLKGILWGHSGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGIPQKRLHGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHF+ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD +GH++WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-EGHSDWVSCVRFSPNHTNPIIVSAGWDKTVK  175



>ref|XP_009448629.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Pan troglodytes]
Length=328

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  81   EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  140

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  141  SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVS  200

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  201  GSRDKTIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  253



>emb|CEG67117.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI95133.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI93908.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=316

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 136/175 (78%), Gaps = 1/175 (1%)
 Frame = +2

Query  65   QECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
             + L LRGT++ H +WVTAIA   +  D ++S+SRDK+IIVWNLT+D   +GV R+ L G
Sbjct  1    MDTLTLRGTLEGHGNWVTAIATTSEAPDMVLSASRDKTIIVWNLTRDEVNYGVPRKSLVG  60

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHFV+D+ +SSDGQFALS SWD  LRLWDL  GTT RRFV HT DVLSV+FS DNRQIV
Sbjct  61   HSHFVEDIAISSDGQFALSASWDHTLRLWDLNNGTTTRRFVGHTNDVLSVSFSADNRQIV  120

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD++IKLWNTLGECKY I + DGH EWVSCVRFSP+   P IVSG WD+  K
Sbjct  121  SGSRDKSIKLWNTLGECKYNITE-DGHTEWVSCVRFSPNPATPLIVSGGWDKLVK  174


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 73/154 (47%), Gaps = 18/154 (12%)
 Frame = +2

Query  98   AHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT--GHSHFVQDVV  271
             HT+ V +++   DN   IVS SRDKSI +WN        G  +  +T  GH+ +V  V 
Sbjct  102  GHTNDVLSVSFSADNRQ-IVSGSRDKSIKLWN------TLGECKYNITEDGHTEWVSCVR  154

Query  272  LSSDGQFAL--SGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
             S +    L  SG WD  +++WDL        F+ H   V +V  S D     SA +D  
Sbjct  155  FSPNPATPLIVSGGWDKLVKVWDLTKLKLRTNFIGHNGYVNTVTISPDGSLCASAGKDGV  214

Query  446  IKLWNTLGECK--YTIQDGDGHNEWVSCVRFSPS  541
            + LW+ L + K  Y++  G      V  + FSP+
Sbjct  215  VMLWD-LNDAKHLYSLDAGSV----VHALTFSPN  243



>dbj|BAE93065.1| guanine nucleotide binding protein beta polypeptide 2-like 1 
[Lethenteron camtschaticum]
Length=317

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK++I+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTLIMWKLTRDETNYGIPQRSLHGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
             HFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   GHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQ+ DGH EWVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQE-DGHTEWVSCVRFSPNNNNPIIVSCGWDKLVK  175


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 8/126 (6%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             HT+WV+ +  +P +N+  IVS   DK + VWNLT         +    GH+ ++  V +
Sbjct  146  GHTEWVSCVRFSPNNNNPIIVSCGWDKLVKVWNLTN-----CKLKTNHIGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  DG+  LWDL  G      +D    + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDGQAMLWDLNEGKHLYT-LDGGDTINALCFS-PNRYWLCAATGPSIKI  258

Query  455  WNTLGE  472
            W+  G+
Sbjct  259  WDLEGK  264



>ref|XP_008955163.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Pan paniscus]
Length=328

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  81   EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  140

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  141  SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVS  200

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  201  GSRDKTIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  253



>ref|XP_005847990.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
 gb|EFN55888.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
Length=319

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 137/177 (77%), Gaps = 4/177 (2%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNL--TKDGPQFGVARRRL  238
            E L LRG +  H  WVTAIAAP+D  S+T++SSSRDK+++VW L   +DG   G  +R L
Sbjct  3    ETLTLRGELTGHRGWVTAIAAPLDPTSETLLSSSRDKTVLVWQLGNAEDG-SLGYPKRAL  61

Query  239  TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQ  418
             GHSH+VQDVV+SSDGQF L+GSWDG LRLWD+  G T RRF+ HTKDVLSVAFS DNRQ
Sbjct  62   RGHSHYVQDVVISSDGQFCLTGSWDGTLRLWDINTGATTRRFLGHTKDVLSVAFSADNRQ  121

Query  419  IVSASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            IVS SRD+TIKLWNTLGECKYTI + DGH EWVSCVRFSP T  P IVS  WD+  K
Sbjct  122  IVSGSRDKTIKLWNTLGECKYTIGEPDGHTEWVSCVRFSPVTQNPIIVSAGWDKAVK  178


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
            EC    G    HT+WV+ +  +P+  +  IVS+  DK++ VWNLT         R  L G
Sbjct  139  ECKYTIGEPDGHTEWVSCVRFSPVTQNPIIVSAGWDKAVKVWNLTN-----CKLRNNLVG  193

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            H  +V  V +S DG    SG  DG   LWDL  G       D T  + S+ FS  NR  +
Sbjct  194  HQGYVNTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSL-DATDIIHSLCFS-PNRYWL  251

Query  425  SASRDRTIKLWN  460
             A+   +IK+W+
Sbjct  252  CAATQGSIKIWD  263



>gb|AAU84924.1| putative activated protein kinase C receptor [Aphis citricidus]
Length=319

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT++ H  WVT IA    ++D I+S SRDK++IVW+LT+D   +G+ ++RL GH
Sbjct  3    ETMQLRGTLRGHNGWVTQIATNPIHTDMILSCSRDKTLIVWDLTRDELNYGIPKKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNIHNPIIVSAGWDKVVK  175


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P  ++  IVS+  DK + VWNLT         +    GH+ ++  V +
Sbjct  146  GHSDWVSCVRFSPNIHNPIIVSAGWDKVVKVWNLTN-----CRIKTNHYGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIIEALCFS-PNRYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>tpg|DAA27596.1| TPA: guanine nucleotide-binding protein subunit beta-2-like 1 
[Bos taurus]
Length=296

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  175


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +     D+++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDGGDIINALCFSPNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>gb|EIE76651.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Rhizopus 
delemar RA 99-880]
Length=316

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = +2

Query  65   QECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTG  244
             + L LRGT++ H +WVTAIA   +  D ++S+SRDK+IIVWNLT+D   +GV R+ L G
Sbjct  1    MDTLTLRGTLEGHGNWVTAIATTSEAPDMVLSASRDKTIIVWNLTRDEVNYGVPRKSLVG  60

Query  245  HSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIV  424
            HSHF++D+ +SSDGQFALS SWD  LRLWDL  GTT RRFV HT DVLSV+FS DNRQIV
Sbjct  61   HSHFIEDLAISSDGQFALSASWDHTLRLWDLNNGTTTRRFVGHTNDVLSVSFSADNRQIV  120

Query  425  SASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
            S SRD++IKLWNTLGECKY I + DGH+EWVSCVRFSP+   P IVSG WD+  K
Sbjct  121  SGSRDKSIKLWNTLGECKYNITE-DGHSEWVSCVRFSPNPATPVIVSGGWDKIVK  174


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 18/154 (12%)
 Frame = +2

Query  98   AHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLT--GHSHFVQDVV  271
             HT+ V +++   DN   IVS SRDKSI +WN        G  +  +T  GHS +V  V 
Sbjct  102  GHTNDVLSVSFSADNRQ-IVSGSRDKSIKLWN------TLGECKYNITEDGHSEWVSCVR  154

Query  272  LSSDGQ--FALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRT  445
             S +      +SG WD  +++WDL        F+ H  +V +V  S D     SA +D  
Sbjct  155  FSPNPATPVIVSGGWDKIVKVWDLTKLKLRTNFIGHNGNVNTVTISPDGSLCASAGKDGV  214

Query  446  IKLWNTLGECK--YTIQDGDGHNEWVSCVRFSPS  541
            + LW+ L E K  Y+++     N  V+ + FSP+
Sbjct  215  VMLWD-LAEAKHLYSLE----ANAPVNALTFSPN  243



>ref|NP_001004946.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Xenopus (Silurana) tropicalis]
 gb|AAH75435.1| guanine nucleotide binding protein (G protein), beta polypeptide 
[Xenopus (Silurana) tropicalis]
 emb|CAJ83114.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Xenopus (Silurana) tropicalis]
 gb|AAI66955.1| guanine nucleotide binding protein (G protein), beta polypeptide 
[Xenopus (Silurana) tropicalis]
Length=317

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+SSSRDK++I+W LT+D   +GV +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSSSRDKTVIMWKLTRDETNYGVPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+Q+ + H EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTVQE-ESHTEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++HT+WV+ +  +P  ++  IVS   DK + VWNL          +    GHS ++  V 
Sbjct  145  ESHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHSGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +   + DV++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDSGDVINALCFSPNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|XP_004073369.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Oryzias latipes]
Length=317

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHSGWVTQIATTPQYPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSG+WDG LRLWDL  G T R+FV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGAWDGTLRLWDLTTGLTTRQFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + HT+WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +   + DV++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDSGDVINALCFSPNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|NP_001280259.1| guanine nucleotide-binding protein subunit beta-like protein 
[Acyrthosiphon pisum]
 dbj|BAH71077.1| ACYPI004192 [Acyrthosiphon pisum]
Length=319

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT++ H  WVT IA    ++D I+S SRDK++IVW+LT+D   +G+ ++RL GH
Sbjct  3    ETMQLRGTLRGHNGWVTQIATNPIHTDMILSCSRDKTLIVWDLTRDELNYGIPKKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQD DGH++WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQD-DGHSDWVSCVRFSPNIHNPIIVSAGWDKVVK  175


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             H+DWV+ +  +P  ++  IVS+  DK + VWNLT         +    GH+ ++  V +
Sbjct  146  GHSDWVSCVRFSPNIHNPIIVSAGWDKVVKVWNLTN-----CRIKTNHYGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+   +IK+
Sbjct  201  SPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIIEALCFS-PNRYWLCAAFGPSIKI  258

Query  455  WN  460
            W+
Sbjct  259  WD  260



>ref|XP_004780256.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Mustela putorius furo]
Length=317

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  175


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +     D+++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDGGDIINALGFSPNRYGLRAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|XP_010780163.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Notothenia coriiceps]
Length=317

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + +RGT+K H+ WVT IA      D I+S+SRDKSII+W LT+D   +G+ +R L GH
Sbjct  3    EQMTVRGTLKGHSGWVTQIATTPQYPDMILSASRDKSIIMWKLTRDETNYGIPQRSLLGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSG+WDG LRLWDL  G T R+FV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGAWDGSLRLWDLTNGNTTRQFVGHTKDVLSVAFSADNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKMVK  175


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            + H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ F+  V 
Sbjct  145  EGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLAN-----CKLKTNHIGHTGFLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +   + D ++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGRDGQAMLWDLNEG--KHLYTLDSGDTINALCFSPNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|XP_006987199.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X1 [Peromyscus maniculatus bairdii]
Length=324

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E + LRGT+K H  WVT IA      D I+S+SRDK+II+W LT+D   +G+ +R L GH
Sbjct  3    EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SHFV DVV+SSDGQFALSGSWDG LRLWDL  GTT RRFV HTKDVLSVAFS DNRQIVS
Sbjct  63   SHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVK  175


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 8/127 (6%)
 Frame = +2

Query  95   KAHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVV  271
            ++H++WV+ +  +P  ++  IVS   DK + VWNL          +    GH+ ++  V 
Sbjct  145  ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLAN-----CKLKTNHIGHTGYLNTVT  199

Query  272  LSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIK  451
            +S DG    SG  DG+  LWDL  G     +     D+++      NR  + A+   +IK
Sbjct  200  VSPDGSLCASGGKDGQAMLWDLNEG--KHLYTLDGGDIINALCFSPNRYWLCAATGPSIK  257

Query  452  LWNTLGE  472
            +W+  G+
Sbjct  258  IWDLEGK  264



>ref|XP_003701723.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Megachile rotundata]
Length=317

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  68   ECLVLRGTMKAHTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGH  247
            E L LRGT++ H  WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL GH
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLYGH  62

Query  248  SHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVS  427
            SH++ DVVLSSDG +ALSGSWD  LRLWDL AG T RRF DHTKDVLSVAFSVDNRQIVS
Sbjct  63   SHYISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQIVS  122

Query  428  ASRDRTIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRPXK  589
             SRD+TIKLWNTL ECKYTIQ+ DGH +WVSCVRFSP+   P IVS  WD+  K
Sbjct  123  GSRDKTIKLWNTLAECKYTIQE-DGHTDWVSCVRFSPNHSNPIIVSAGWDKLVK  175


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 76/163 (47%), Gaps = 13/163 (8%)
 Frame = +2

Query  98   AHTDWVTAIA-APIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRLTGHSHFVQDVVL  274
             HTDWV+ +  +P  ++  IVS+  DK + VWNLT    +        +GH+ ++  V +
Sbjct  146  GHTDWVSCVRFSPNHSNPIIVSAGWDKLVKVWNLTNCKLKIN-----HSGHTGYLNTVTV  200

Query  275  SSDGQFALSGSWDGELRLWDLQAGTTARRFVDHTKDVLSVAFSVDNRQIVSASRDRTIKL  454
            S DG    SG  D +  LWDL  G      +DH   + ++ FS  NR  + A+    IK+
Sbjct  201  SPDGSLCASGGKDCKAMLWDLNDGKHLHT-LDHNDIITALCFS-PNRYWLCAAFGPWIKI  258

Query  455  WN-----TLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSG  568
            W+      + E K  +       E   C+  + ST   T+ +G
Sbjct  259  WDLETKEMVEELKPEVVSATSKAEPPHCLSLAWSTDGQTLFAG  301



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090