BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050P13

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       234   2e-70   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       233   7e-70   Nicotiana sylvestris
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                  226   7e-69   Citrus sinensis [apfelsine]
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    228   3e-68   Nicotiana tomentosiformis
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    228   5e-68   Nicotiana tomentosiformis
emb|CDP11780.1|  unnamed protein product                                227   1e-67   Coffea canephora [robusta coffee]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             226   3e-67   Citrus clementina [clementine]
emb|CDP11782.1|  unnamed protein product                                225   6e-67   Coffea canephora [robusta coffee]
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       224   1e-66   Solanum tuberosum [potatoes]
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            223   3e-66   Solanum lycopersicum
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            222   7e-66   Solanum lycopersicum
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    220   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_003605914.1|  Transparent testa 12 protein                       220   6e-65   Medicago truncatula
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    219   7e-65   Nelumbo nucifera [Indian lotus]
emb|CDY39494.1|  BnaA01g24940D                                          219   1e-64   Brassica napus [oilseed rape]
emb|CDY19294.1|  BnaC01g31860D                                          219   1e-64   Brassica napus [oilseed rape]
emb|CDY19295.1|  BnaC01g31850D                                          212   5e-64   Brassica napus [oilseed rape]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    217   5e-64   Pyrus x bretschneideri [bai li]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    217   5e-64   Pyrus x bretschneideri [bai li]
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    216   2e-63   Arabis alpina [alpine rockcress]
ref|XP_008342001.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       210   3e-63   
emb|CDY38631.1|  BnaA05g19560D                                          215   4e-63   Brassica napus [oilseed rape]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       215   4e-63   Brassica rapa
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       214   7e-63   Brassica rapa
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       214   9e-63   Camelina sativa [gold-of-pleasure]
emb|CDY69153.1|  BnaAnng29470D                                          208   1e-62   Brassica napus [oilseed rape]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    214   1e-62   Cicer arietinum [garbanzo]
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            213   2e-62   Glycine max [soybeans]
ref|XP_006375529.1|  hypothetical protein POPTR_0014s15140g             208   2e-62   
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            213   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       213   3e-62   
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    213   4e-62   Arabis alpina [alpine rockcress]
ref|XP_008379931.1|  PREDICTED: protein TRANSPARENT TESTA 12            211   5e-62   
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg             210   2e-61   
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             210   3e-61   Eutrema salsugineum [saltwater cress]
ref|XP_007045634.1|  MATE efflux family protein isoform 2               208   4e-61   
emb|CDP17486.1|  unnamed protein product                                210   4e-61   Coffea canephora [robusta coffee]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       209   4e-61   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       209   1e-60   Cucumis sativus [cucumbers]
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       208   1e-60   Cicer arietinum [garbanzo]
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       208   2e-60   Brassica rapa
emb|CDY33129.1|  BnaCnng07000D                                          208   2e-60   Brassica napus [oilseed rape]
ref|XP_002883313.1|  mate efflux family protein                         208   2e-60   
gb|KEH39009.1|  MATE efflux family protein                              206   2e-60   Medicago truncatula
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       207   4e-60   Prunus mume [ume]
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            207   4e-60   Glycine soja [wild soybean]
ref|XP_003596992.1|  Transparent testa 12 protein                       207   5e-60   Medicago truncatula
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            207   6e-60   Vitis vinifera
ref|XP_007045633.1|  MATE efflux family protein isoform 1               206   7e-60   
emb|CDY24250.1|  BnaC03g42230D                                          201   8e-60   Brassica napus [oilseed rape]
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       206   2e-59   Cucumis melo [Oriental melon]
emb|CBI28937.3|  unnamed protein product                                206   2e-59   Vitis vinifera
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             206   2e-59   
dbj|BAJ34540.1|  unnamed protein product                                205   2e-59   Eutrema halophilum
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       204   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            204   4e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    204   4e-59   Elaeis guineensis
emb|CAN69305.1|  hypothetical protein VITISV_021605                     199   4e-59   Vitis vinifera
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            204   6e-59   Glycine soja [wild soybean]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       204   6e-59   Glycine max [soybeans]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    204   9e-59   Elaeis guineensis
emb|CBI28939.3|  unnamed protein product                                199   9e-59   Vitis vinifera
emb|CDY65669.1|  BnaCnng48120D                                          203   1e-58   Brassica napus [oilseed rape]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       203   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       203   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       203   1e-58   Cicer arietinum [garbanzo]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       203   2e-58   Brassica rapa
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            203   2e-58   Phoenix dactylifera
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       202   2e-58   Elaeis guineensis
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       201   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    202   3e-58   Arabis alpina [alpine rockcress]
emb|CDX92916.1|  BnaA03g36380D                                          202   4e-58   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       202   4e-58   
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       202   4e-58   Elaeis guineensis
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            202   5e-58   
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       202   6e-58   Elaeis guineensis
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       201   7e-58   
gb|KGN43522.1|  Mate efflux family protein                              201   7e-58   Cucumis sativus [cucumbers]
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       201   1e-57   Brassica rapa
emb|CDY39493.1|  BnaA01g24950D                                          200   1e-57   Brassica napus [oilseed rape]
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            200   3e-57   Vitis vinifera
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              199   3e-57   Gossypium arboreum [tree cotton]
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       199   4e-57   Cucumis sativus [cucumbers]
ref|NP_188806.1|  MATE efflux family protein                            199   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20595.1|  integral membrane protein, putative                     199   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    199   5e-57   Vitis vinifera
gb|KJB30571.1|  hypothetical protein B456_005G149900                    199   6e-57   Gossypium raimondii
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            199   6e-57   
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       199   9e-57   Elaeis guineensis
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       198   9e-57   Cucumis sativus [cucumbers]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             198   1e-56   Capsella rubella
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       198   1e-56   Prunus mume [ume]
gb|ACF85423.1|  unknown                                                 198   1e-56   Zea mays [maize]
tpg|DAA50098.1|  TPA: putative MATE efflux family protein               196   2e-56   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       197   2e-56   Cucumis melo [Oriental melon]
gb|ACZ55931.1|  MATE transporter 2                                      197   2e-56   Zea mays [maize]
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    197   3e-56   Cicer arietinum [garbanzo]
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             196   3e-56   
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             197   4e-56   Phaseolus vulgaris [French bean]
gb|AGT17221.1|  transparent testa 12 protein                            197   4e-56   Saccharum hybrid cultivar R570
gb|KDO75455.1|  hypothetical protein CISIN_1g010798mg                   194   6e-56   Citrus sinensis [apfelsine]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       196   7e-56   
ref|NP_001149176.1|  transparent testa 12 protein                       196   7e-56   Zea mays [maize]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       196   7e-56   Setaria italica
gb|KDO75454.1|  hypothetical protein CISIN_1g010798mg                   194   1e-55   Citrus sinensis [apfelsine]
gb|ACZ55932.1|  MATE transporter 2                                      195   1e-55   Zea mays [maize]
ref|NP_001050524.1|  Os03g0572900                                       195   2e-55   
gb|ABF97220.1|  MATE efflux family protein, expressed                   195   2e-55   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA50097.1|  TPA: putative MATE efflux family protein               185   2e-55   
gb|EEC75610.1|  hypothetical protein OsI_12322                          195   2e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001148084.1|  transparent testa 12 protein                       195   2e-55   Zea mays [maize]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               194   3e-55   
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   194   4e-55   Citrus sinensis [apfelsine]
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    194   5e-55   Zea mays [maize]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             193   7e-55   Populus trichocarpa [western balsam poplar]
emb|CDM85992.1|  unnamed protein product                                193   7e-55   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             193   8e-55   Citrus clementina [clementine]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   1e-54   Populus euphratica
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   1e-54   
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             192   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   2e-54   Populus euphratica
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   2e-54   Setaria italica
gb|AAS01962.1|  putative MATE efflux family protein                     192   3e-54   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75606.1|  hypothetical protein OsI_12318                          192   3e-54   Oryza sativa Indica Group [Indian rice]
gb|ABF97209.1|  MATE efflux family protein, expressed                   192   3e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   4e-54   Cucumis melo [Oriental melon]
gb|KDP20755.1|  hypothetical protein JCGZ_21226                         187   5e-54   Jatropha curcas
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   5e-54   Cucumis melo [Oriental melon]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   6e-54   Cucumis sativus [cucumbers]
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    191   7e-54   Populus euphratica
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       190   1e-53   Citrus sinensis [apfelsine]
ref|XP_004173828.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   2e-53   
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       189   3e-53   
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       189   4e-53   Brachypodium distachyon [annual false brome]
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             188   5e-53   
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    188   6e-53   Brachypodium distachyon [annual false brome]
gb|KJB57729.1|  hypothetical protein B456_009G178100                    184   9e-53   Gossypium raimondii
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   1e-52   Fragaria vesca subsp. vesca
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            187   1e-52   Vitis vinifera
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   1e-52   
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            187   1e-52   
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g             186   2e-52   
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             186   3e-52   Citrus clementina [clementine]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       186   3e-52   Zea mays [maize]
emb|CDM86677.1|  unnamed protein product                                186   4e-52   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    186   4e-52   Populus euphratica
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            186   4e-52   Triticum urartu
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    186   7e-52   Populus euphratica
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       185   7e-52   Sesamum indicum [beniseed]
gb|KJB57730.1|  hypothetical protein B456_009G178100                    185   8e-52   Gossypium raimondii
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             185   9e-52   Phaseolus vulgaris [French bean]
gb|KJB57728.1|  hypothetical protein B456_009G178100                    185   9e-52   Gossypium raimondii
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          184   1e-51   Sorghum bicolor [broomcorn]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       184   2e-51   Cucumis sativus [cucumbers]
gb|KJB69294.1|  hypothetical protein B456_011G014800                    184   2e-51   Gossypium raimondii
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              184   2e-51   Gossypium arboreum [tree cotton]
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   2e-51   Zea mays [maize]
gb|KJB69293.1|  hypothetical protein B456_011G014800                    184   3e-51   Gossypium raimondii
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         188   3e-51   Jatropha curcas
gb|KCW76957.1|  hypothetical protein EUGRSUZ_D01316                     182   4e-51   Eucalyptus grandis [rose gum]
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             182   5e-51   
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       183   6e-51   Fragaria vesca subsp. vesca
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   7e-51   Citrus sinensis [apfelsine]
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       182   9e-51   Eucalyptus grandis [rose gum]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             182   1e-50   Prunus persica
emb|CDM86696.1|  unnamed protein product                                182   1e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007026057.1|  MATE efflux family protein                         182   1e-50   
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   181   2e-50   Citrus sinensis [apfelsine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    181   2e-50   Citrus sinensis [apfelsine]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            181   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    181   3e-50   
emb|CDM86692.1|  unnamed protein product                                181   3e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   5e-50   Eucalyptus grandis [rose gum]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    180   6e-50   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               180   7e-50   
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   1e-49   Sesamum indicum [beniseed]
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       180   1e-49   Morus notabilis
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                179   1e-49   Erythranthe guttata [common monkey flower]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   2e-49   Prunus mume [ume]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   2e-49   Solanum tuberosum [potatoes]
emb|CDM86687.1|  unnamed protein product                                178   2e-49   Triticum aestivum [Canadian hard winter wheat]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                179   2e-49   Erythranthe guttata [common monkey flower]
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    178   3e-49   Populus euphratica
gb|KDO78210.1|  hypothetical protein CISIN_1g043801mg                   171   3e-49   Citrus sinensis [apfelsine]
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   4e-49   
ref|XP_008371179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   4e-49   
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   4e-49   Nicotiana sylvestris
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    178   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   4e-49   Vitis vinifera
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   4e-49   Populus euphratica
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                177   4e-49   Erythranthe guttata [common monkey flower]
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    178   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   5e-49   Prunus mume [ume]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    178   5e-49   Populus euphratica
ref|XP_002518493.1|  multidrug resistance pump, putative                177   5e-49   Ricinus communis
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           177   5e-49   Nicotiana tabacum [American tobacco]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   5e-49   Nicotiana sylvestris
ref|XP_006348109.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    176   5e-49   Solanum tuberosum [potatoes]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    177   5e-49   Populus euphratica
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   6e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   6e-49   Solanum lycopersicum
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   6e-49   Glycine max [soybeans]
ref|XP_009618512.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    176   7e-49   Nicotiana tomentosiformis
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            177   7e-49   Glycine soja [wild soybean]
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    177   9e-49   Tarenaya hassleriana [spider flower]
gb|EPS61219.1|  hypothetical protein M569_13580                         168   9e-49   Genlisea aurea
ref|XP_009618511.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    176   1e-48   Nicotiana tomentosiformis
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                177   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   1e-48   
gb|KDP20757.1|  hypothetical protein JCGZ_21228                         172   1e-48   Jatropha curcas
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             176   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    176   2e-48   Nicotiana sylvestris
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             176   2e-48   
ref|XP_006389638.1|  MATE efflux family protein                         176   2e-48   
ref|XP_008371177.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-48   
ref|XP_008371097.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-48   
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   2e-48   Nicotiana tomentosiformis
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   4e-48   Solanum tuberosum [potatoes]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   4e-48   Solanum tuberosum [potatoes]
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   4e-48   Prunus mume [ume]
emb|CDY33130.1|  BnaCnng07010D                                          171   4e-48   Brassica napus [oilseed rape]
gb|EPS67796.1|  hypothetical protein M569_06975                         175   4e-48   Genlisea aurea
gb|ABK24492.1|  unknown                                                 175   5e-48   Picea sitchensis
ref|XP_002518495.1|  multidrug resistance pump, putative                174   8e-48   Ricinus communis
ref|XP_007026056.1|  MATE efflux family protein                         174   8e-48   
ref|XP_008364095.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   9e-48   
ref|XP_010533821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010533820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010533819.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   2e-47   Solanum lycopersicum
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   2e-47   
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    173   2e-47   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   2e-47   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   2e-47   
ref|XP_010533818.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   2e-47   
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   2e-47   
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    172   3e-47   Nicotiana tomentosiformis
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   3e-47   Populus euphratica
gb|EMT19998.1|  hypothetical protein F775_52364                         176   3e-47   
ref|XP_010533817.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   4e-47   
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   5e-47   Oryza brachyantha
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   7e-47   
ref|XP_009614258.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   8e-47   
ref|XP_009362007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   8e-47   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   1e-46   Populus euphratica
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   1e-46   Solanum lycopersicum
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   1e-46   Solanum tuberosum [potatoes]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   3e-46   Populus euphratica
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   4e-46   Pyrus x bretschneideri [bai li]
gb|ADE77677.1|  unknown                                                 169   6e-46   Picea sitchensis
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   6e-46   Nicotiana tomentosiformis
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                169   6e-46   Erythranthe guttata [common monkey flower]
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   6e-46   Pyrus x bretschneideri [bai li]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   6e-46   Pyrus x bretschneideri [bai li]
gb|EEC75604.1|  hypothetical protein OsI_12313                          169   1e-45   Oryza sativa Indica Group [Indian rice]
gb|AAS01961.1|  putative MatE domain containing protein, 3'-partial     162   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   2e-45   Nicotiana sylvestris
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          167   5e-45   Sorghum bicolor [broomcorn]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             167   6e-45   Populus trichocarpa [western balsam poplar]
gb|AHI48506.1|  multidrug and toxic extrusion transporter               167   7e-45   Vaccinium corymbosum [American blueberry]
ref|XP_002518492.1|  multidrug resistance pump, putative                166   7e-45   Ricinus communis
gb|AGT17223.1|  MATE efflux family protein                              166   7e-45   Saccharum hybrid cultivar R570
ref|NP_001050520.1|  Os03g0570800                                       166   8e-45   
ref|NP_001147791.1|  transparent testa 12 protein                       166   1e-44   Zea mays [maize]
tpg|DAA62913.1|  TPA: putative MATE efflux family protein               167   1e-44   
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   2e-44   Malus domestica [apple tree]
gb|KDP20759.1|  hypothetical protein JCGZ_21230                         161   3e-44   Jatropha curcas
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            164   3e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH36840.1|  MATE efflux family protein                              164   5e-44   Medicago truncatula
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   5e-44   Nicotiana sylvestris
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   8e-44   Pyrus x bretschneideri [bai li]
emb|CDP04391.1|  unnamed protein product                                164   8e-44   Coffea canephora [robusta coffee]
ref|NP_001142368.1|  uncharacterized protein LOC100274540               162   8e-44   Zea mays [maize]
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         162   2e-43   Jatropha curcas
gb|EAY90719.1|  hypothetical protein OsI_12317                          160   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            162   2e-43   Vitis vinifera
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    159   3e-42   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   3e-42   
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             159   4e-42   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             159   4e-42   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   4e-42   
ref|XP_002892653.1|  mate efflux family protein                         159   4e-42   
gb|AAM98160.1|  unknown protein                                         159   5e-42   
ref|NP_172632.1|  MATE efflux family protein                            159   5e-42   
emb|CDY64933.1|  BnaCnng45550D                                          158   9e-42   
emb|CDY64820.1|  BnaA08g31640D                                          158   9e-42   
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   1e-41   
tpg|DAA40987.1|  TPA: putative MATE efflux family protein               157   2e-41   
emb|CDP11781.1|  unnamed protein product                                156   2e-41   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   2e-41   
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    157   2e-41   
tpg|DAA40993.1|  TPA: putative MATE efflux family protein               156   2e-41   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                            157   4e-41   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            155   6e-41   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   6e-41   
emb|CDY34637.1|  BnaC08g41960D                                          155   8e-41   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   8e-41   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      155   1e-40   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               154   1e-40   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...    155   2e-40   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            154   2e-40   
ref|XP_011100216.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    153   2e-40   
emb|CBI23252.3|  unnamed protein product                                150   3e-40   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             154   4e-40   
emb|CDY34833.1|  BnaA09g47590D                                          152   6e-40   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    153   6e-40   
gb|AAK82541.1|  At1g61890/F8K4_9                                        153   6e-40   
ref|NP_564787.1|  MATE efflux family protein                            153   6e-40   
ref|XP_002886501.1|  mate efflux family protein                         153   6e-40   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   7e-40   
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   7e-40   
dbj|BAJ90668.1|  predicted protein                                      152   1e-39   
emb|CDY25329.1|  BnaC01g29980D                                          151   2e-39   
emb|CDY47166.1|  BnaA01g22920D                                          151   2e-39   
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   3e-39   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          150   4e-39   
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             150   5e-39   
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    150   5e-39   
ref|XP_006391951.1|  hypothetical protein EUTSA_v10023417mg             149   1e-38   
emb|CDY19507.1|  BnaC09g13960D                                          149   2e-38   
emb|CDY12916.1|  BnaA09g13580D                                          149   2e-38   
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   2e-38   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     148   3e-38   
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    148   3e-38   
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             148   4e-38   
emb|CDX94061.1|  BnaC07g36950D                                          147   5e-38   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          147   9e-38   
ref|XP_009353369.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   2e-37   
gb|AGT17222.1|  MATE efflux family protein                              145   4e-37   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   7e-37   
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             144   7e-37   
emb|CDX98711.1|  BnaA03g44960D                                          144   8e-37   
emb|CDX94063.1|  BnaC07g36970D                                          144   8e-37   
emb|CBI28938.3|  unnamed protein product                                143   1e-36   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       143   2e-36   
emb|CDX98712.1|  BnaA03g44970D                                          143   2e-36   
ref|XP_010439401.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   2e-36   
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       143   3e-36   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   4e-36   
emb|CDY07256.1|  BnaC04g19150D                                          134   4e-36   
emb|CDX76391.1|  BnaA08g10090D                                          142   5e-36   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    142   6e-36   
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            140   1e-35   
emb|CDY27434.1|  BnaC03g64740D                                          140   2e-35   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   2e-35   
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    140   2e-35   
emb|CAA17158.1|  putative protein                                       139   4e-35   
dbj|BAH19969.1|  AT4G21910                                              139   4e-35   
ref|NP_974587.1|  MATE efflux family protein                            139   4e-35   
ref|NP_001190793.1|  MATE efflux family protein                         139   6e-35   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   7e-35   
ref|XP_002867814.1|  mate efflux family protein                         139   8e-35   
ref|XP_002867813.1|  mate efflux family protein                         138   9e-35   
emb|CDX79109.1|  BnaA01g11760D                                          138   1e-34   
emb|CDX98713.1|  BnaA03g44980D                                          137   1e-34   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             138   1e-34   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   3e-34   
emb|CDY27431.1|  BnaC03g64710D                                          137   4e-34   
ref|NP_001059785.1|  Os07g0516600                                       136   4e-34   
dbj|BAC56017.1|  putative ripening regulated protein DDTFR18            136   4e-34   
gb|EEC82143.1|  hypothetical protein OsI_26198                          136   5e-34   
emb|CDX76392.1|  BnaA08g10080D                                          135   8e-34   
ref|XP_008646561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   8e-34   
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            135   1e-33   
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             135   1e-33   
ref|NP_567640.1|  MATE efflux family protein                            135   1e-33   
gb|AAM62936.1|  unknown                                                 135   1e-33   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             135   2e-33   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       133   5e-33   
emb|CBI23254.3|  unnamed protein product                                130   5e-32   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             130   6e-32   
emb|CBI23251.3|  unnamed protein product                                129   1e-31   
gb|AAL06936.1|  AT5g38030/F16F17_30                                     126   3e-31   
emb|CDP04390.1|  unnamed protein product                                127   5e-31   
ref|XP_010026078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   6e-31   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            128   2e-30   
ref|XP_004299689.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       126   2e-30   
ref|XP_006836338.1|  hypothetical protein AMTR_s00092p00085880          125   3e-30   
ref|NP_198619.1|  MATE efflux family protein                            125   4e-30   
ref|XP_002868811.1|  mate efflux family protein                         125   4e-30   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       124   6e-30   
gb|KJB64207.1|  hypothetical protein B456_010G037100                    124   9e-30   
ref|XP_006426305.1|  hypothetical protein CICLE_v10025480mg             122   1e-29   
gb|KDO60642.1|  hypothetical protein CISIN_1g011371mg                   122   1e-29   
emb|CDP20703.1|  unnamed protein product                                123   2e-29   
ref|XP_004250128.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   3e-29   
ref|XP_009759747.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    121   3e-29   
ref|XP_009759746.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    121   3e-29   
ref|XP_006394040.1|  hypothetical protein EUTSA_v100040871mg            118   4e-29   
ref|XP_010106306.1|  Protein TRANSPARENT TESTA 12                       122   4e-29   
emb|CDP11775.1|  unnamed protein product                                121   5e-29   
ref|XP_006292391.1|  hypothetical protein CARUB_v10018603mg             122   5e-29   
ref|XP_009373462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   5e-29   
ref|XP_010275892.1|  PREDICTED: protein TRANSPARENT TESTA 12            122   5e-29   
gb|KDO60641.1|  hypothetical protein CISIN_1g011371mg                   122   6e-29   
ref|XP_009791264.1|  PREDICTED: protein TRANSPARENT TESTA 12            122   6e-29   
ref|XP_006426304.1|  hypothetical protein CICLE_v10025480mg             122   6e-29   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   6e-29   
ref|XP_009759744.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    121   6e-29   
gb|KDO60639.1|  hypothetical protein CISIN_1g011371mg                   122   7e-29   
ref|XP_006426307.1|  hypothetical protein CICLE_v10025480mg             122   7e-29   
gb|KDO60638.1|  hypothetical protein CISIN_1g011371mg                   122   7e-29   
gb|KDO60640.1|  hypothetical protein CISIN_1g011371mg                   121   8e-29   
ref|XP_006353193.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   8e-29   
gb|KDP35980.1|  hypothetical protein JCGZ_08375                         121   8e-29   
ref|XP_010425356.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   9e-29   
ref|XP_009117173.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   9e-29   
ref|XP_010502591.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    121   9e-29   
gb|ACU15197.1|  unknown                                                 117   1e-28   
ref|XP_010512133.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   1e-28   
ref|XP_010514303.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   1e-28   
ref|XP_010681039.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   1e-28   
gb|KHG03893.1|  Protein TRANSPARENT TESTA 12 -like protein              120   1e-28   
ref|NP_191462.1|  protein TRANSPARENT TESTA 12                          121   1e-28   
ref|XP_010026089.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   2e-28   
ref|XP_010502590.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    120   2e-28   
ref|XP_009601126.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   2e-28   
gb|KFK35144.1|  hypothetical protein AALP_AA5G243900                    120   2e-28   
ref|XP_006466280.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   2e-28   
ref|XP_006417171.1|  hypothetical protein EUTSA_v10007376mg             120   2e-28   
gb|ABK24651.1|  unknown                                                 120   2e-28   
ref|XP_004501679.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   2e-28   
ref|XP_006402730.1|  hypothetical protein EUTSA_v10005907mg             120   2e-28   
ref|XP_006290950.1|  hypothetical protein CARUB_v10017066mg             120   3e-28   
ref|XP_010916697.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   3e-28   
ref|NP_001119025.1|  mate efflux domain-containing protein              120   3e-28   
ref|XP_010250482.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    120   3e-28   
ref|NP_001190792.1|  mate efflux domain-containing protein              120   3e-28   
ref|XP_009629826.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   3e-28   
gb|KFK33585.1|  hypothetical protein AALP_AA5G032800                    120   3e-28   
dbj|BAE98722.1|  hypothetical protein                                   115   3e-28   
emb|CDP01534.1|  unnamed protein product                                120   4e-28   
ref|XP_002876486.1|  hypothetical protein ARALYDRAFT_907401             120   4e-28   
ref|XP_010250481.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    119   4e-28   
gb|EMS63521.1|  Protein TRANSPARENT TESTA 12                            113   4e-28   
emb|CDX67772.1|  BnaA07g18120D                                          119   4e-28   
ref|XP_007224466.1|  hypothetical protein PRUPE_ppa022569mg             119   4e-28   
ref|XP_010060062.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   5e-28   
ref|XP_002285728.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   5e-28   
ref|XP_008219413.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   5e-28   
emb|CBI19217.3|  unnamed protein product                                119   5e-28   
ref|XP_010100395.1|  Protein TRANSPARENT TESTA 12                       119   6e-28   
gb|KFK32791.1|  hypothetical protein AALP_AA6G288700                    119   6e-28   
ref|XP_010681038.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   6e-28   
ref|XP_006395543.1|  hypothetical protein EUTSA_v10005286mg             119   6e-28   
ref|XP_009591643.1|  PREDICTED: protein TRANSPARENT TESTA 12            119   6e-28   
gb|EEC74654.1|  hypothetical protein OsI_10313                          119   9e-28   
gb|KDO60636.1|  hypothetical protein CISIN_1g011035mg                   117   9e-28   
ref|XP_009599386.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   9e-28   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   1e-27   
dbj|BAE99795.1|  hypothetical protein                                   119   1e-27   
ref|NP_172755.1|  root hair specific 2                                  119   1e-27   
ref|XP_009765840.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   1e-27   
gb|KDO60635.1|  hypothetical protein CISIN_1g011035mg                   117   1e-27   
gb|EEE58464.1|  hypothetical protein OsJ_09708                          118   1e-27   
ref|XP_010504878.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   1e-27   
ref|XP_010504879.1|  PREDICTED: protein TRANSPARENT TESTA 12            118   1e-27   
gb|ACJ36215.1|  transparent testa 12                                    118   1e-27   
ref|XP_006466279.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   1e-27   
ref|XP_004299688.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   1e-27   
ref|XP_006852302.1|  hypothetical protein AMTR_s00049p00190590          116   1e-27   
emb|CDY13643.1|  BnaA06g32800D                                          118   1e-27   
ref|XP_009398326.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   1e-27   
ref|XP_009104180.1|  PREDICTED: protein TRANSPARENT TESTA 12            118   1e-27   
gb|ACJ36211.1|  transparent testa 12 isoform 2                          118   2e-27   
ref|XP_009393552.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   2e-27   
ref|XP_009152044.1|  PREDICTED: protein TRANSPARENT TESTA 12            118   2e-27   
ref|XP_010528103.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   2e-27   
emb|CDX83627.1|  BnaC07g23670D                                          118   2e-27   
ref|XP_010045479.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   2e-27   
ref|XP_010554152.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   2e-27   
ref|XP_010476276.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   2e-27   
gb|KDO60634.1|  hypothetical protein CISIN_1g011035mg                   117   2e-27   
ref|XP_007018128.1|  MATE efflux family protein isoform 2               117   2e-27   
gb|AHH83753.1|  multidrug and toxic extrusion transporter               117   2e-27   
ref|XP_006306102.1|  hypothetical protein CARUB_v10011529mg             117   2e-27   
ref|XP_009150628.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   3e-27   
ref|XP_006478600.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   3e-27   
emb|CDY26602.1|  BnaA09g46750D                                          117   3e-27   
ref|XP_007018127.1|  MATE efflux family protein isoform 1               117   3e-27   
emb|CDY08796.1|  BnaA06g24280D                                          117   3e-27   
ref|XP_009789598.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    117   3e-27   
ref|XP_010524117.1|  PREDICTED: protein TRANSPARENT TESTA 12            117   3e-27   
gb|KDO60633.1|  hypothetical protein CISIN_1g011035mg                   117   3e-27   
gb|KFK43564.1|  hypothetical protein AALP_AA1G142600                    117   4e-27   
ref|XP_006433900.1|  hypothetical protein CICLE_v10000950mg             117   4e-27   
ref|XP_002302325.2|  hypothetical protein POPTR_0002s10240g             117   4e-27   
ref|XP_010100396.1|  Protein TRANSPARENT TESTA 12                       117   4e-27   
ref|XP_006472534.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   4e-27   
ref|XP_006426302.1|  hypothetical protein CICLE_v10025455mg             117   4e-27   
gb|KDP29740.1|  hypothetical protein JCGZ_18675                         117   4e-27   
gb|KDO81079.1|  hypothetical protein CISIN_1g011186mg                   116   4e-27   
gb|EMS59510.1|  Protein TRANSPARENT TESTA 12                            117   4e-27   
gb|KDO60632.1|  hypothetical protein CISIN_1g011035mg                   117   4e-27   
emb|CDY61495.1|  BnaC03g74630D                                          117   4e-27   
dbj|BAJ95959.1|  predicted protein                                      116   5e-27   
ref|XP_008234853.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   5e-27   



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 151/177 (85%), Gaps = 4/177 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  247
            MDSS    Y P  E++G  + SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNTYQPFLENNGTSNLSPQLSETHNFESSNELETVLLDTEIPFWSKLRLATWIEM  60

Query  248  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  427
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  428  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            VETLCGQAFGA K+++LG+YLQRST+LLTLTG+LL  +Y+F +PILIFLG++  I+S
Sbjct  121  VETLCGQAFGAKKFDMLGVYLQRSTILLTLTGILLTFVYIFCKPILIFLGESERIAS  177



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 152/177 (86%), Gaps = 4/177 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  247
            MDSS    Y P  +++G  S SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNIYQPFLDNNGNSSLSPQFSETHNFESSNELETVLLDTEIPLWNKLRLATWIEM  60

Query  248  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  427
            KLL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFHLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  428  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            VETLCGQAFGA KY++LG+YLQRST+LLTLTG+LLA +Y+F +PILIFLG++  I+S
Sbjct  121  VETLCGQAFGAKKYDMLGVYLQRSTILLTLTGILLAFVYIFCKPILIFLGESERIAS  177



>gb|KDO54650.1| hypothetical protein CISIN_1g0100251mg, partial [Citrus sinensis]
Length=351

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 148/181 (82%), Gaps = 8/181 (4%)
 Frame = +2

Query  59   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  235
            HH+   ++ S     + P P +  V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQS-----HPPAPPA--VLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  236  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  415
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  416  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDIS  595
            MGSAVETLCGQA+GA KYE+LGIYLQRS VLLTLTG+L+ ++YVFS PILIFLG++PDI+
Sbjct  125  MGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIA  184

Query  596  S  598
            S
Sbjct  185  S  185



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 150/177 (85%), Gaps = 4/177 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  247
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  248  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  427
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  428  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            VETLCGQA+GA KY++LG+YLQRST+LLTLTGVLL L+Y+F +PILIFLG++P+I+S
Sbjct  121  VETLCGQAYGARKYDMLGVYLQRSTILLTLTGVLLTLVYIFCKPILIFLGESPEIAS  177



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 150/177 (85%), Gaps = 4/177 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  247
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  248  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  427
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  428  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            VETLCGQA+GA KY++LG+YLQRST+LLTLTGVLL L+Y+F +PILIFLG++P+I+S
Sbjct  121  VETLCGQAYGARKYDMLGVYLQRSTILLTLTGVLLTLVYIFCKPILIFLGESPEIAS  177



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 143/173 (83%), Gaps = 9/173 (5%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSVDASQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFGA KYE+LG+YLQRST+LL+LTGVLLA+IYVFS+PILIFLGQAPDI+S
Sbjct  112  CGQAFGAKKYEMLGVYLQRSTILLSLTGVLLAIIYVFSKPILIFLGQAPDIAS  164



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 148/181 (82%), Gaps = 8/181 (4%)
 Frame = +2

Query  59   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  235
            HH+   ++ S     + P P +  V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQS-----HPPAPPA--VLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  236  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  415
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  416  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDIS  595
            MGSAVETLCGQA+GA KYE+LGIYLQRS VLLTLTG+L+ ++YVFS PILIFLG++PDI+
Sbjct  125  MGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIA  184

Query  596  S  598
            S
Sbjct  185  S  185



>emb|CDP11782.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 142/173 (82%), Gaps = 9/173 (5%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSNDAGQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFGA K+E+LGIYLQRST+LL+LTGVLL +IYVFS+PILIFLGQ+PDI+S
Sbjct  112  CGQAFGAKKFEMLGIYLQRSTILLSLTGVLLTIIYVFSKPILIFLGQSPDIAS  164



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  250
            M S     Y P  +++    SP   E+   E+SNELE++L+DT IP W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEIPLWSKLRLATWIEMK  60

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
             L +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   FLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQAFGA KY++LG+YLQRSTVLLTLTG+LL ++Y+F +PILIFLGQ   I++
Sbjct  121  ETLCGQAFGAKKYDMLGVYLQRSTVLLTLTGILLTIMYIFCKPILIFLGQTERIAA  176



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 143/167 (86%), Gaps = 5/167 (3%)
 Frame = +2

Query  113  LPESDGVVSSPPHEESEASN-----ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  277
            +  S+  V+ P  E+S AS+     ELES+L+D  +PRW RL+ ATWIE+KLL  LAAPA
Sbjct  1    MASSENDVNQPFIEKSRASDSESSIELESVLLDHSLPRWNRLRQATWIEMKLLFSLAAPA  60

Query  278  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  457
            V+VYMINYLMSMSTQIFSGH+GNLELAAASLGNTGIQIF YGLMLGMGSAVETLCGQA+G
Sbjct  61   VMVYMINYLMSMSTQIFSGHIGNLELAAASLGNTGIQIFVYGLMLGMGSAVETLCGQAYG  120

Query  458  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            A KY++LG+YLQRST+LL LTGVLL  +YVFS+PIL+FLGQ+P+I+S
Sbjct  121  ARKYDMLGVYLQRSTILLVLTGVLLTFVYVFSKPILLFLGQSPEIAS  167



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  250
            M S     Y P  +++    SP   E+   E+SNELE++L+DT I  W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEITLWSKLRLATWIEMK  60

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            LL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   LLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQAFGA KY++LG+YLQRSTVLLTLTG+LL ++Y+F +PILIF+GQ   I++
Sbjct  121  ETLCGQAFGAKKYDMLGVYLQRSTVLLTLTGILLTIVYIFCKPILIFVGQTERIAA  176



>ref|XP_010278703.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEES----EASNELESILMDTGIPRWQRLKLATWIEL  247
            M++S      P+  S    +S   ++S    E S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  248  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  427
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  428  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            VETLCGQ++GAGKYE+LGIYLQRST+LL  TG+ LA+IY+ S+P+LIFLG++P+I+S
Sbjct  121  VETLCGQSYGAGKYEMLGIYLQRSTILLMATGIPLAVIYILSKPLLIFLGESPEIAS  177



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  155  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  334
            + E+  ELE IL DT +P  +R+KLATW+E KLL YLAAP+V+VY+INY+MSMSTQIFSG
Sbjct  36   KHESDGELERILSDTSVPFVKRIKLATWVEFKLLFYLAAPSVIVYLINYVMSMSTQIFSG  95

Query  335  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvllt  514
            HLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQAFGA KYE+LGIYLQRSTVLLT
Sbjct  96   HLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAFGAKKYEMLGIYLQRSTVLLT  155

Query  515  ltgvllalIYVFSEPILIFLGQAPDISS  598
            + G++L +IY+FSEPILIFLG++P I+S
Sbjct  156  IAGLILTIIYIFSEPILIFLGESPKIAS  183



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEES----EASNELESILMDTGIPRWQRLKLATWIEL  247
            M++S      P+  S    +S   ++S    E S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  248  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  427
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  428  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            VETLCGQ++GAGKYE+LGIYLQRST+LL  TG+ LA+IY+ S+P+LIFLG++P+I+S
Sbjct  121  VETLCGQSYGAGKYEMLGIYLQRSTILLMATGIPLAVIYILSKPLLIFLGESPEIAS  177



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +2

Query  86   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG++P+I+S
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLGESPEIAS  175



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +2

Query  86   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG++P+I+S
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLGESPEIAS  175



>emb|CDY19295.1| BnaC01g31850D [Brassica napus]
Length=304

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 142/176 (81%), Gaps = 4/176 (2%)
 Frame = +2

Query  80   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  250
            MDSS N   Y+ L  P+SDG V   P  ES  + ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQNDGLYEQLLHPQSDGTVPLSPSTESR-NGELERVLSDVETPLFHRLRKATMIESK  59

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            LL  LAAPAV+VYMINY+MSMSTQIF GHLGNLELAAASLGNTGI+ FAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYMMSMSTQIFPGHLGNLELAAASLGNTGIKTFAYGLMLGMGSAV  119

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQAFG  KYE+LGIYL+RSTVLLTL GVLL LIYVFS+PIL+FLG++P+I+S
Sbjct  120  ETLCGQAFGGRKYEMLGIYLRRSTVLLTLAGVLLTLIYVFSKPILLFLGESPEIAS  175



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 141/182 (77%), Gaps = 6/182 (3%)
 Frame = +2

Query  53   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  232
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  233  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  412
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  413  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  592
            GMGSAVETLCGQA+GA KYE+LGIYLQRS VLL   GVLL +IYVFSEPIL+ LG++P I
Sbjct  118  GMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLFFPGVLLTIIYVFSEPILLLLGESPSI  177

Query  593  SS  598
            +S
Sbjct  178  AS  179



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 141/182 (77%), Gaps = 6/182 (3%)
 Frame = +2

Query  53   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  232
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  233  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  412
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  413  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  592
            GMGSAVETLCGQA+GA KYE+LGIYLQRS VLL   GVLL +IYVFSEPIL+ LG++P I
Sbjct  118  GMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLFFPGVLLTIIYVFSEPILLLLGESPSI  177

Query  593  SS  598
            +S
Sbjct  178  AS  179



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPH--EESEASN-ELESILMDTGIPRWQRLKLATWIEL  247
            MDSS N   Y PL    G  + PPH    +E++N ELE +L D   P + RL+ AT IE 
Sbjct  1    MDSSQNDGVYQPLLHPHGDATLPPHLPPSTESTNGELERVLSDVETPLFLRLRKATMIES  60

Query  248  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  427
            KLL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  428  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            VETLCGQA+G  KYE+LGIYLQRSTVLLTLTGV L LIYVFS+PIL+FLG++P+I+S
Sbjct  121  VETLCGQAYGGRKYEMLGIYLQRSTVLLTLTGVFLTLIYVFSKPILLFLGESPEIAS  177



>ref|XP_008342001.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=325

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  101  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  280
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  281  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  460
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYGA  131

Query  461  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
             KYE+LGIYLQRSTVLL   GVLL +IY+FSEPIL+ LG++P I+S
Sbjct  132  QKYEMLGIYLQRSTVLLFFPGVLLTIIYIFSEPILLLLGESPSIAS  177



>emb|CDY38631.1| BnaA05g19560D [Brassica napus]
Length=512

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = +2

Query  80   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  250
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIY+FS+PIL+FLG++P+I+S
Sbjct  120  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYIFSKPILLFLGESPEIAS  175



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = +2

Query  80   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  250
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIY+FS+PIL+FLG++P+I+S
Sbjct  120  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYIFSKPILLFLGESPEIAS  175



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 142/173 (82%), Gaps = 3/173 (2%)
 Frame = +2

Query  86   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            S N   Y PL  P+SDG V   P  ES ++ ELE +L +   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSNVETPLFHRLRKATMIESKLLF  62

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG++P+I+S
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLGESPEIAS  175



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 146/174 (84%), Gaps = 5/174 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N  AY PL +S    SSP   ES ++ ELE++L D   P +QRL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQSQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESKLL  56

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVET  116

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG++L L+YVFSEPIL+FLG++P I+S
Sbjct  117  LCGQAYGGKKYEMLGVYLQRSTVLLTLTGLVLTLLYVFSEPILLFLGESPAIAS  170



>emb|CDY69153.1| BnaAnng29470D [Brassica napus]
Length=317

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG++P+I+S
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLGESPEIAS  169



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPES-DGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MD    A  D  P+    + +     + E+  ELE IL DT +P  +R+ LATW+ELKLL
Sbjct  1    MDEPFLALNDSTPQQPSSIFTHSFGSKHESDGELERILSDTNVPFVKRIPLATWVELKLL  60

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
             YLAAPAV+VY+INY+MSMSTQIFSGHLG LELA ASLGNTGIQIFAYGLMLGMGSAVET
Sbjct  61   FYLAAPAVIVYLINYVMSMSTQIFSGHLGTLELAGASLGNTGIQIFAYGLMLGMGSAVET  120

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFGA KY++LGIYLQ+S+VLLTL G++L LIY+FS+PILIF+GQ+P I+S
Sbjct  121  LCGQAFGAKKYDMLGIYLQKSSVLLTLAGLILTLIYIFSKPILIFIGQSPAIAS  174



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  98   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  277
            A  +PL  ++G  S+  HE S +  +LE IL D  +P   R+  ATWIELKLL +LAAPA
Sbjct  4    AEKEPLLTAEGTRSNSKHESS-SHGQLERILSDDTLPFLNRVGPATWIELKLLFFLAAPA  62

Query  278  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  457
            V+VY+INYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  63   VIVYLINYLMSMSTQIFSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAFG  122

Query  458  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            A KY +LG+Y+QRST+LL+L GV+L +IYVFSEP+LIFLG++P I+S
Sbjct  123  AQKYGMLGVYMQRSTILLSLAGVVLTVIYVFSEPMLIFLGESPRIAS  169



>ref|XP_006375529.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
 gb|ERP53326.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
Length=326

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = +2

Query  110  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  289
            P P S  +    P + + +S ELES+L DT +P ++RL+ ATWIE KLLC LAAPAVVVY
Sbjct  19   PSPFSSTI---KPKQSNHSSIELESVLSDTEMPYFKRLRRATWIESKLLCRLAAPAVVVY  75

Query  290  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  469
            MINYLMSMSTQIFSG LGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA KY
Sbjct  76   MINYLMSMSTQIFSGQLGNLELAAASLGNTGIQLFAYGLMLGMGSAVETLCGQAFGAHKY  135

Query  470  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
             +LG+YLQRST+LL+LTG+LL +IY+F +PIL+ LG++ +I+S
Sbjct  136  GMLGLYLQRSTLLLSLTGILLTIIYIFCKPILVLLGESQEIAS  178



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 140/173 (81%), Gaps = 8/173 (5%)
 Frame = +2

Query  83   DSSNGAAYDPLPESDGVVSSPPHEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLC  259
             S N A Y PL +       P    +E    ELE +L D   P  +R+  ATWIE KLL 
Sbjct  3    SSRNDAVYQPLLQ-------PVAAAAEYGGGELERVLTDAETPAMRRVGRATWIESKLLF  55

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  56   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETL  115

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQA+GAGK+E+LG+YLQRSTVLLTLTGV+L +IYVFS+PIL+FLG++P+I+S
Sbjct  116  CGQAYGAGKFEMLGVYLQRSTVLLTLTGVILTVIYVFSKPILLFLGESPEIAS  168



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 146/176 (83%), Gaps = 5/176 (3%)
 Frame = +2

Query  74   SVMDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  250
            S MDSS N  AY PL +     SSP   ES ++ ELE++L D   P +QRL+ AT IE K
Sbjct  10   SAMDSSRNDGAYQPLLQPQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESK  65

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAV
Sbjct  66   LLFNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAV  125

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQA+G  KYE+LGIYLQRSTVLLTLTG++L L+YVFSEPIL+FLG++P I+S
Sbjct  126  ETLCGQAYGGRKYEMLGIYLQRSTVLLTLTGLVLTLLYVFSEPILLFLGESPAIAS  181



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N   Y P  +  G  + P  E S    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDDFYQPFLQPLGDETVPSTESS--IGELERVLSDVETPLFLRLRKATMIESKLL  58

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAVVVYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  59   FNLAAPAVVVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  118

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG GKYE+LGIYLQRSTVLL+LTGVLL +IYVFSEPIL+FLG++P+I+S
Sbjct  119  LCGQAFGGGKYEMLGIYLQRSTVLLSLTGVLLTVIYVFSEPILLFLGESPEIAS  172



>ref|XP_008379931.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=446

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  101  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  280
            +Y PLP +    S   HEE  AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  15   SYRPLPSTKSFTSKHAHEE-HASGELEQVLCDTYKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  281  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  460
            +VYMINY+MSMSTQ+F GHLGNLELAA+SLGN GIQIFAYGL+LGMGSAVETLCGQA GA
Sbjct  74   IVYMINYVMSMSTQMFCGHLGNLELAASSLGNNGIQIFAYGLLLGMGSAVETLCGQAHGA  133

Query  461  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
             KY++LGIYLQRSTVLL   GVLL +IYVFSEPIL+ LG++P I+S
Sbjct  134  QKYKMLGIYLQRSTVLLFFPGVLLTIIYVFSEPILLLLGESPSIAS  179



>ref|XP_006406243.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47696.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=468

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = +2

Query  80   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  241
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  242  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  421
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  422  SAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            SAVETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL LIYVFSEPIL+FLG++P+I+S
Sbjct  121  SAVETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTLIYVFSEPILLFLGESPEIAS  179



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = +2

Query  80   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  241
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  242  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  421
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  422  SAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            SAVETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL LIYVFSEPIL+FLG++P+I+S
Sbjct  121  SAVETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTLIYVFSEPILLFLGESPEIAS  179



>ref|XP_007045634.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY01466.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=424

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 140/174 (80%), Gaps = 5/174 (3%)
 Frame = +2

Query  77   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFGA KY++LGIYLQRS +LLTLTG+LL +IY+ S+PIL+ LG++PDI+S
Sbjct  116  LCGQAFGAHKYDMLGIYLQRSAILLTLTGILLTIIYILSKPILLLLGESPDIAS  169



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 141/176 (80%), Gaps = 3/176 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDG---VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  250
            M SS  ++Y  LP+++    +  +      EAS+ELE IL +T +P  +R+  ATWIE+K
Sbjct  1    MGSSGDSSYKTLPQNEKKPVLTHTQSQVRKEASDELERILSNTEVPFIKRVVPATWIEIK  60

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            LL +LAAPAVVVYMINYLMSM TQIFSGHLGNLE AAASLGN G+Q FAYGLMLGMGSAV
Sbjct  61   LLVHLAAPAVVVYMINYLMSMLTQIFSGHLGNLEYAAASLGNNGVQTFAYGLMLGMGSAV  120

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQA+GA +Y +LGIYLQRS +LLTLTGV L +IY+FS+PIL+ LG+APD++S
Sbjct  121  ETLCGQAYGAHRYGMLGIYLQRSAILLTLTGVSLTIIYIFSKPILLLLGEAPDVAS  176



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  101  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  280
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  281  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  460
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYGA  131

Query  461  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
             KYE+LGIYLQRSTVLL   GVLL +IY+FSEPIL+ LG++P I+S
Sbjct  132  QKYEMLGIYLQRSTVLLFFPGVLLTIIYIFSEPILLLLGESPSIAS  177



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = +2

Query  137  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  310
            + PP    + E S+ELESIL DT +P  QR   ATWIE+KLL YLAAPAV VY+INYLMS
Sbjct  19   TQPPVLSNKHEYSDELESILSDTHLPLLQRYTKATWIEMKLLFYLAAPAVFVYVINYLMS  78

Query  311  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  490
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LGIYL
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKYDMLGIYL  138

Query  491  QRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            QRS++LLTLTG +L LIY+F +PILIFLG++ +I+S
Sbjct  139  QRSSILLTLTGFVLTLIYIFCKPILIFLGESKEIAS  174



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  143  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQ  322
            P     E+  ELE +L DT +P + R+  ATWIEL+LL +LAAPAV VY+INY+MSMSTQ
Sbjct  16   PGKGAHESDGELERLLSDTTVPYFTRVCSATWIELRLLFFLAAPAVFVYLINYVMSMSTQ  75

Query  323  IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRSt  502
            IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA K+E+LG YLQRST
Sbjct  76   IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAEKFEMLGTYLQRST  135

Query  503  vlltltgvllalIYVFSEPILIFLGQAPDISS  598
            +LLT+ G+ L +IYV SEPILIF+GQ+P I+S
Sbjct  136  ILLTIAGLFLTVIYVLSEPILIFIGQSPTIAS  167



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG++P+I+S
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLGESPEIAS  169



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG++P+I+S
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLGESPEIAS  169



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 142/174 (82%), Gaps = 5/174 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N   Y PL        SPP  ES ++ ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQPLLHPQ---PSPPTTES-SNGELETVLSDVETPLFLRLRKATTIESKLL  56

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQA+G  KY++LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG++P I+S
Sbjct  117  LCGQAYGGRKYDMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLGESPAIAS  170



>gb|KEH39009.1| MATE efflux family protein [Medicago truncatula]
Length=461

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KY +LG YLQR
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAEKYGMLGTYLQR  137

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ST+LLT+TG  L +IYV SEPIL+F+GQ+P I+S
Sbjct  138  STILLTITGFFLTIIYVLSEPILVFIGQSPRIAS  171



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H +  +SNELE +L +T  P  +RLKLA WIE KLL YLA+PAV+VYMINY+M+MSTQIF
Sbjct  35   HHDLHSSNELERVLSETDRPFLERLKLALWIESKLLFYLASPAVIVYMINYVMAMSTQIF  94

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
            +GHLGNLELAAASLGN GIQ+FAYG+MLGMGSAVETLCGQA+GA KYE+LGIYLQRSTVL
Sbjct  95   AGHLGNLELAAASLGNNGIQVFAYGVMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVL  154

Query  509  ltltgvllalIYVFSEPILIFLGQAPDISS  598
            LTLTGVLL ++Y+FS P+LI LGQ+P I+S
Sbjct  155  LTLTGVLLTIVYIFSRPVLILLGQSPSIAS  184



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +P PE      S   +   +  ELE IL +T +P  +RL  ATW+ELKLL +LAAPAV+V
Sbjct  19   EPSPEPPSCTQSFSSKHG-SDGELERILSNTSVPFAKRLGPATWVELKLLFHLAAPAVIV  77

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K
Sbjct  78   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKK  137

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            +++LGIYLQRSTVLLTL G++L +IY+FSEPILIFLG++P I+S
Sbjct  138  FDMLGIYLQRSTVLLTLAGIILTIIYIFSEPILIFLGESPRIAS  181



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KY +LG YLQR
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAEKYGMLGTYLQR  137

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ST+LLT+TG  L +IYV SEPIL+F+GQ+P I+S
Sbjct  138  STILLTITGFFLTIIYVLSEPILVFIGQSPRIAS  171



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  1    MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  58

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG++ +I+S
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLGESSEIAS  171



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 140/174 (80%), Gaps = 5/174 (3%)
 Frame = +2

Query  77   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFGA KY++LGIYLQRS +LLTLTG+LL +IY+ S+PIL+ LG++PDI+S
Sbjct  116  LCGQAFGAHKYDMLGIYLQRSAILLTLTGILLTIIYILSKPILLLLGESPDIAS  169



>emb|CDY24250.1| BnaC03g42230D [Brassica napus]
Length=317

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N   Y  L +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQQLLQPQ---LSPLPESS--NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG++P+I+S
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLGESPEIAS  169



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +2

Query  137  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  310
            + PP    + E+S+ELE+IL DT +P  QR   ATWIE+KL+ YLAAPA+ VYM+NYLMS
Sbjct  19   TEPPLLSNKHESSDELEAILSDTHLPLLQRYTKATWIEMKLMFYLAAPAIFVYMVNYLMS  78

Query  311  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  490
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LGIYL
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKYDMLGIYL  138

Query  491  QRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            QRS++LLTLTG++L L+Y+F +PILIFLG++ +I+S
Sbjct  139  QRSSILLTLTGLVLTLVYIFCKPILIFLGESKEIAS  174



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  37   MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  94

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  95   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  154

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG++ +I+S
Sbjct  155  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLGESSEIAS  207



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H +  +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF
Sbjct  35   HHDLHSSNELERVLSDTNRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIF  94

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
            +GHLGNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST+L
Sbjct  95   AGHLGNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTIL  154

Query  509  ltltgvllalIYVFSEPILIFLGQAPDISS  598
            LTL GVLL ++Y+FS PILI LGQ+P I+S
Sbjct  155  LTLGGVLLTIVYIFSRPILILLGQSPSIAS  184



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 141/177 (80%), Gaps = 12/177 (7%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEE--SEASN-ELESILMDTGIPRWQRLKLATWIEL  247
            MDSS N     PL +        PH +  +E+SN ELE +L D   P   RL+ AT IE 
Sbjct  1    MDSSQNDGVNQPLLQ--------PHADHGTESSNGELERVLSDVETPLSSRLRKATMIES  52

Query  248  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  427
            KLL  LAAPAV+VYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  53   KLLFKLAAPAVIVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  112

Query  428  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            VETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL +IYVFSEPIL+FLG++P+I+S
Sbjct  113  VETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTIIYVFSEPILLFLGESPEIAS  169



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 140/173 (81%), Gaps = 3/173 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            MDSS     D       +  SP   ES ++ ELE++L D   P +QRL+ AT IE KLL 
Sbjct  1    MDSSRNDGVDQALLQRQL--SPKTTES-SNGELETVLSDVETPLFQRLRKATMIESKLLF  57

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVETL
Sbjct  58   NLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVETL  117

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQA+GA KYE+LG+YLQRSTVLLT+T +LL L+YVFSEPIL+FLG++P I+S
Sbjct  118  CGQAYGARKYEMLGVYLQRSTVLLTITSLLLTLLYVFSEPILLFLGESPAIAS  170



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  155  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  334
            E   S++LE IL D  IP  +R ++ATWIELK L  LAAPAVVVYMINY MSMSTQIFSG
Sbjct  29   EYRWSDQLEKILTDPHIPTLKRYRMATWIELKRLFLLAAPAVVVYMINYSMSMSTQIFSG  88

Query  335  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvllt  514
            HLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GAGKY +LGIYLQRSTV+L 
Sbjct  89   HLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAGKYGMLGIYLQRSTVILM  148

Query  515  ltgvllalIYVFSEPILIFLGQAPDISS  598
             TG+LL +IY+FS+PILI LG++ +I+S
Sbjct  149  ATGILLMVIYIFSKPILIALGESSEIAS  176



>ref|XP_010930078.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Elaeis 
guineensis]
Length=494

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 5/165 (3%)
 Frame = +2

Query  110  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  283
            PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV+
Sbjct  24   PLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAVI  80

Query  284  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  463
            VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA 
Sbjct  81   VYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAH  140

Query  464  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            KYE+LG+YLQRST+LL  TGV LA+IY FS PIL+ LG++P+I+ 
Sbjct  141  KYEMLGVYLQRSTILLMATGVPLAVIYGFSRPILVLLGESPEIAK  185



>emb|CAN69305.1| hypothetical protein VITISV_021605 [Vitis vinifera]
Length=320

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG++ +I+S
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLGESSEIAS  171



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            +  ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFSGHLG
Sbjct  38   SDGELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFSGHLG  97

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LGIYLQRSTVLLTL G
Sbjct  98   NLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKKFNMLGIYLQRSTVLLTLAG  157

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            +LL +IY+FSEPILIFLG++P I+S
Sbjct  158  ILLTIIYIFSEPILIFLGESPRIAS  182



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            +  ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFSGHLG
Sbjct  38   SDGELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFSGHLG  97

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LGIYLQRSTVLLTL G
Sbjct  98   NLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKKFNMLGIYLQRSTVLLTLAG  157

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            +LL +IY+FSEPILIFLG++P I+S
Sbjct  158  ILLTIIYIFSEPILIFLGESPRIAS  182



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 5/165 (3%)
 Frame = +2

Query  110  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  283
            PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV+
Sbjct  24   PLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAVI  80

Query  284  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  463
            VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA 
Sbjct  81   VYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAH  140

Query  464  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            KYE+LG+YLQRST+LL  TGV LA+IY FS PIL+ LG++P+I+ 
Sbjct  141  KYEMLGVYLQRSTILLMATGVPLAVIYGFSRPILVLLGESPEIAK  185



>emb|CBI28939.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = +2

Query  59   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  238
            H    + M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT 
Sbjct  4    HKYLFNPMESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATS  61

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
             E KLL  LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGM
Sbjct  62   TESKLLFRLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGM  121

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI L ++ +I+S
Sbjct  122  GSAVETLCGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLRESSEIAS  181



>emb|CDY65669.1| BnaCnng48120D [Brassica napus]
Length=495

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 135/173 (78%), Gaps = 6/173 (3%)
 Frame = +2

Query  83   DSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLC  259
             +     Y PL + D + + P     E+ N ELE +L D   P + RL+ AT IE KLL 
Sbjct  3    SAQTDGVYQPLLQPDQLSALP-----ESKNCELERVLADVETPLFLRLRKATMIETKLLF  57

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETL
Sbjct  58   KLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVETL  117

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLGQ+P+I+S
Sbjct  118  CGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLGQSPEIAS  170



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 8/168 (5%)
 Frame = +2

Query  116  PESDGV-------VSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  274
            P++DGV        SSP   ES ++ ELE++L D   P  QRL+ AT IE KLL  LAAP
Sbjct  4    PQNDGVDQPLLQPQSSPSTTES-SNGELETVLSDVETPLVQRLRKATMIESKLLFNLAAP  62

Query  275  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  454
            AV+VYMINYLMSMST+IFSGHLGNLELAAASLGNTGIQ+F+YGL+LGMGSAVETLCGQA+
Sbjct  63   AVIVYMINYLMSMSTRIFSGHLGNLELAAASLGNTGIQVFSYGLLLGMGSAVETLCGQAY  122

Query  455  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GA KYE+LG+YLQRSTVLLTLTG++L L+YVFSEPIL+FLG++P I+S
Sbjct  123  GARKYEMLGVYLQRSTVLLTLTGLVLTLLYVFSEPILLFLGESPAIAS  170



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +2

Query  86   SSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYL  265
            + N     PLP S     +   E   AS +LE +L D  IP  +R+ LA+ IE+KLL +L
Sbjct  15   TGNDDVDQPLPPSTPPAMADEGEAHGASGQLEIVLNDASIPWARRMWLASLIEMKLLVFL  74

Query  266  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  445
            AAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG
Sbjct  75   AAPAVMVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  134

Query  446  QAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            QA+GA KYE+LGIY+QRSTVLL  TGV LA+IY FS PIL+ LG++P+I+ 
Sbjct  135  QAYGAHKYEMLGIYMQRSTVLLMATGVPLAVIYAFSRPILVLLGESPEIAK  185



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 133/164 (81%), Gaps = 3/164 (2%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL  S+ +     HE   +  ELE +L DT +P  +R+  ATWIEL+LL +LAAPAV V
Sbjct  11   EPLLLSNNIGKPNLHE---SDGELERLLSDTTVPFLRRVGSATWIELRLLFFLAAPAVFV  67

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+ AYGLMLGMGSAVETLCGQAFGA K
Sbjct  68   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQMLAYGLMLGMGSAVETLCGQAFGAEK  127

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            +E+LG YLQRST+LLT+ G+ L +IYV SEPILIF+GQ+P I S
Sbjct  128  FEMLGTYLQRSTILLTIAGLFLTVIYVLSEPILIFIGQSPTIVS  171



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  80   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDS+     Y PL + D +  SP  E +    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERVLADVETPLFLRLRKATMIETKLL  56

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLGQ+P+I+S
Sbjct  117  LCGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLGQSPEIAS  170



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 7/187 (4%)
 Frame = +2

Query  44   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQ  217
            P   P  L   ++  S+     PLP S  + +    PH    +S  LESIL DT +   +
Sbjct  3    PAASPEKLRTPLLGPSDDD--QPLPSSSPMAADMDDPHG---SSGRLESILTDTSLSWAR  57

Query  218  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFA  397
            RL+LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FA
Sbjct  58   RLQLATIIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFA  117

Query  398  YGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  577
            YGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRST+LL  TGV LA+IY FS P+L+ LG
Sbjct  118  YGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTILLMATGVPLAVIYAFSRPLLVLLG  177

Query  578  QAPDISS  598
            ++P+I+ 
Sbjct  178  ESPEIAK  184



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +2

Query  44   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRL  223
            P   P  L+  ++  S+     PLP S   ++    +   +S  LE IL DT IP  +RL
Sbjct  3    PVASPEKLSTPLLVPSDDD--QPLPTSTPSMAGDVDDPHGSSGRLERILTDTSIPWARRL  60

Query  224  KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYG  403
             LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYG
Sbjct  61   PLATAIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAASSLGNNGIQVFAYG  120

Query  404  LMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQA  583
            LMLGMGSAVETLCGQAFGA K+E+LGIYLQRSTVLL  TGV LA+IY FS PIL+ LG++
Sbjct  121  LMLGMGSAVETLCGQAFGANKHEMLGIYLQRSTVLLMATGVPLAVIYGFSRPILVLLGES  180

Query  584  PDIS  595
            P+I+
Sbjct  181  PEIA  184



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  155  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  334
            ES AS +LESIL D  IP  +R+ +A+ +E+KLL YLAAPAV+VYM+NY+MSMSTQIFSG
Sbjct  4    ESGASQKLESILSDNSIPWARRIWMASLVEMKLLVYLAAPAVMVYMLNYVMSMSTQIFSG  63

Query  335  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvllt  514
            HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRSTVLL 
Sbjct  64   HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVLLM  123

Query  515  ltgvllalIYVFSEPILIFLGQAPDISS  598
             TGV LA IY  S PIL+ LG++P+I+ 
Sbjct  124  ATGVPLAAIYALSRPILVLLGESPEIAK  151



>gb|KFK39485.1| hypothetical protein AALP_AA3G250300 [Arabis alpina]
Length=510

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 138/176 (78%), Gaps = 5/176 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  250
            MDSS N   Y PL  P  DG + SP  E    + ELE +L D   P +  L+ AT IE K
Sbjct  1    MDSSQNEGVYQPLIQPHGDGTLPSPLSESR--NGELERVLSDFEAPLFLCLRKATIIESK  58

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            LL  LAAPAV+VYMIN  MSMSTQIFSGHLGNLELAAASLGNTGIQ FAYGLMLGMGSAV
Sbjct  59   LLFKLAAPAVIVYMINNFMSMSTQIFSGHLGNLELAAASLGNTGIQGFAYGLMLGMGSAV  118

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQA+G  KYE+LG+YLQRSTVLLTLTGV L LIYVFS+PIL+FLGQ+P+I+S
Sbjct  119  ETLCGQAYGGRKYEMLGVYLQRSTVLLTLTGVFLTLIYVFSKPILLFLGQSPEIAS  174



>emb|CDX92916.1| BnaA03g36380D [Brassica napus]
Length=505

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = +2

Query  80   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS     Y PL +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ---LSPLPESS--NGELERVLSDLETPLFLRLRKATMIESKLL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG++P+I+S
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLGESPEIAS  169



>ref|XP_004159226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 6/164 (4%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG++P+I+S
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLGESPEIAS  165



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 134/166 (81%), Gaps = 7/166 (4%)
 Frame = +2

Query  110  PLPESD---GVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  280
            PLP S    G V  P      +S  LESIL DT +P  +RL+LAT +E+KLL +LA PAV
Sbjct  23   PLPPSSPTTGTVDDP----HGSSGRLESILTDTTVPWSRRLRLATIVEMKLLLHLAGPAV  78

Query  281  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  460
             VYM+NY+MSMSTQIFSGHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQA+GA
Sbjct  79   TVYMLNYVMSMSTQIFSGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAYGA  138

Query  461  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
             KYE+LGIYLQRST+LL  TGVLLA+IY FS PIL+ LG++P+I+ 
Sbjct  139  HKYEMLGIYLQRSTILLMATGVLLAVIYAFSRPILLLLGESPEIAK  184



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 139/184 (76%), Gaps = 11/184 (6%)
 Frame = +2

Query  80   MDSSNGAA----YDPLPESDGVVSSPPHEES-------EASNELESILMDTGIPRWQRLK  226
            M SS  A     YDPLPES  V   P            E S  LES+L D  +    R++
Sbjct  1    MGSSQAAGGDRKYDPLPESTQVPPPPSPRPHRPRPDHHETSGHLESVLSDPSLTLGARVR  60

Query  227  LATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL  406
             A+ IELKLL +LAAPAVVVYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL
Sbjct  61   AASRIELKLLFHLAAPAVVVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGL  120

Query  407  MLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAP  586
            MLGMGSAVETLCGQA+GA KYE+LG+YLQR+ VLLT TG LL L+YVFS+P+L+FLG+  
Sbjct  121  MLGMGSAVETLCGQAYGAHKYEMLGVYLQRAAVLLTATGFLLTLVYVFSKPLLLFLGEPL  180

Query  587  DISS  598
            +I+S
Sbjct  181  EIAS  184



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  110  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  289
            PLP S   +     +   +   LESIL D   PR +RL+LAT +E+KLL +LAAP V+VY
Sbjct  23   PLPPSSPSMDGDIDDPHGSRGRLESILTDPSFPRARRLQLATIVEMKLLVHLAAPTVIVY  82

Query  290  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  469
            M+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY
Sbjct  83   MLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKY  142

Query  470  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
             +LGIYLQRST+LL  TGV LA+IYVFS PIL+ LGQ+ +I++
Sbjct  143  GMLGIYLQRSTILLMATGVPLAVIYVFSRPILLLLGQSSEIAT  185



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 6/164 (4%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG++P+I+S
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLGESPEIAS  165



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 6/164 (4%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG++P+I+S
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLGESPEIAS  165



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = +2

Query  80   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS     Y PL +        P  ES  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ----LSPLPESN-NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG++P+I+S
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLGESPEIAS  169



>emb|CDY39493.1| BnaA01g24950D [Brassica napus]
Length=503

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = +2

Query  80   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDS+     Y PL + D +  SP  E +    ELE  L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERGLADVETPLFLRLRKATMIETKLL  56

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLGQ+P+I+S
Sbjct  117  LCGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLGQSPEIAS  170



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG++ +I+S
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLGESSEIAS  171



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 134/164 (82%), Gaps = 4/164 (2%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPAV+V
Sbjct  11   EPLLQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPAVIV  66

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA K
Sbjct  67   YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAHK  126

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            Y++LGIYLQRS VLLT TG+LL LIYVFS+PIL+ LG++PDI+S
Sbjct  127  YDMLGIYLQRSAVLLTFTGILLTLIYVFSKPILLLLGESPDIAS  170



>gb|KGN43526.1| hypothetical protein Csa_7G043680 [Cucumis sativus]
Length=517

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  161  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  340
            + S+ELE +L DT +   +R  LA+WIE+KL+ YLAAPAV VY+INYLMSMSTQIFSGHL
Sbjct  32   KTSDELEKVLSDTQLSVLRRYSLASWIEMKLMFYLAAPAVFVYVINYLMSMSTQIFSGHL  91

Query  341  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  520
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRS +LLTLT
Sbjct  92   GNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAQKYHMLGIYLQRSIILLTLT  151

Query  521  gvllalIYVFSEPILIFLGQAPDISSP  601
            G  +  IY+F +PILIFLG++ +I+S 
Sbjct  152  GFAITTIYIFCKPILIFLGESKEIASA  178



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG++P I+S
Sbjct  117  LCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLGESPAIAS  170



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG++P I+S
Sbjct  117  LCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLGESPAIAS  170



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLF  58

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI L ++ +I+S
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLRESSEIAS  171



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = +2

Query  98   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  277
            A   PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPA
Sbjct  8    AIRKPLFQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPA  63

Query  278  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  457
            V+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  64   VIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAFG  123

Query  458  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            A KY++LGIYLQRS VLLT TG+LL LIYVFS+PIL+ LG++PDI+S
Sbjct  124  AHKYDMLGIYLQRSAVLLTFTGILLTLIYVFSKPILLLLGESPDIAS  170



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 139/181 (77%), Gaps = 10/181 (6%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPP--------HEESEASNELESILMDTGIPRWQRLKLAT  235
            M SS      P+ +SD   S PP           SE S +LESIL +T +   +RL+LAT
Sbjct  1    MKSSPEVVQKPILQSDD--SDPPLSSSLQSDDTRSETSAQLESILSNTQLRLSERLRLAT  58

Query  236  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  415
            W ELKLL YLA PAV+VYMI Y+MSM+TQIF GHLGNLELAAASLGN GIQIFAYGL+LG
Sbjct  59   WTELKLLFYLAGPAVLVYMIGYVMSMATQIFVGHLGNLELAAASLGNNGIQIFAYGLLLG  118

Query  416  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDIS  595
            MGSAVETLCGQA+GA K+++LGIYLQ+STVLLT+TGVLL  +Y+FS+PILI LG++  I+
Sbjct  119  MGSAVETLCGQAYGAKKFDMLGIYLQKSTVLLTITGVLLTFVYIFSKPILILLGESSRIA  178

Query  596  S  598
            S
Sbjct  179  S  179



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 130/165 (79%), Gaps = 5/165 (3%)
 Frame = +2

Query  110  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  283
            PLP S  V      PH    +S  LESIL DT IP  +RL+LAT IE+KLL +LA P+V 
Sbjct  23   PLPPSSPVTGDIDDPHG---SSGRLESILTDTSIPWARRLRLATIIEMKLLLHLAVPSVT  79

Query  284  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  463
            VYM+NY+MSMST I SGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA 
Sbjct  80   VYMLNYVMSMSTTIISGHLGNLELAAASLGNAGIQVFAYGLMLGMGSAVETLCGQAYGAH  139

Query  464  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            KYE+LGIYLQRST+LL  T V LA+IY FS PIL+FLGQ+ +I+ 
Sbjct  140  KYEMLGIYLQRSTILLMATAVPLAVIYAFSRPILLFLGQSSEIAK  184



>gb|KGN43524.1| hypothetical protein Csa_7G043660 [Cucumis sativus]
Length=485

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL E     S+  HE    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEK----SAAKHEA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y+IN LMSMST+IFSG LGNL+LAAASLGN GIQ FAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGIQSFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG++P+I+S
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLGESPEIAS  165



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 138/174 (79%), Gaps = 4/174 (2%)
 Frame = +2

Query  80   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
            MDSS N     PL     +  SP   ES  + ELE++L D   P  QRL+ AT IE KLL
Sbjct  1    MDSSQNDGVSQPLLHPPQL--SPSTTESN-NGELETVLSDVETPLLQRLRKATMIESKLL  57

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  58   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  117

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL L+YVFSEP L+ LG++P I+S
Sbjct  118  LCGQAYGGKKYEMLGVYLQRSTVLLTLTGLLLTLLYVFSEPFLLLLGESPAIAS  171



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  161  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  340
             +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  38   HSSNELERVLSDTDRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIFAGHL  97

Query  341  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  520
            GNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST+LLTL 
Sbjct  98   GNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTILLTLG  157

Query  521  gvllalIYVFSEPILIFLGQAPDISS  598
            GVLL ++Y++  PILI LGQ+P I+S
Sbjct  158  GVLLTIVYIYYRPILILLGQSPSIAS  183



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG++P+I+S
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLVLLGESPEIAS  173



>tpg|DAA50098.1| TPA: putative MATE efflux family protein [Zea mays]
Length=432

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  149  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  506  lltltgvllalIYVFSEPILIFLGQAPDISS  598
            LL  TGV L ++Y FS PIL+ LG++P+I+S
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLGESPEIAS  179



>ref|XP_008455433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=515

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  161  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  340
            + S+ELE IL DT +   +R   ATWIE+KL+ YLAAPAV VY+INYLMSMSTQ+FSGHL
Sbjct  33   KTSDELEKILSDTQLSVVRRYSQATWIEMKLMFYLAAPAVFVYVINYLMSMSTQVFSGHL  92

Query  341  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  520
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRST+LLTLT
Sbjct  93   GNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAQKYNMLGIYLQRSTILLTLT  152

Query  521  gvllalIYVFSEPILIFLGQAPDISSP  601
            G +L +IY+F +PILIFLG++ +I+S 
Sbjct  153  GFVLTIIYIFCKPILIFLGESEEIASA  179



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG++P+I+S
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLLLLGESPEIAS  173



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  155  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  334
            + E+  ELE IL ++ +P  +R++LAT +ELKLL YLAAP+V+VY++N + SMSTQIFSG
Sbjct  29   KHESDGELERILSNSSVPFIKRIQLATRVELKLLFYLAAPSVIVYLLNNVTSMSTQIFSG  88

Query  335  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvllt  514
            H+GNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LGIYLQ+S+VLLT
Sbjct  89   HIGNLELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAFGAKKYDMLGIYLQKSSVLLT  148

Query  515  ltgvllalIYVFSEPILIFLGQAPDISS  598
            L G++L LIY+FS+PILIF+GQ+P I+S
Sbjct  149  LAGLILTLIYIFSKPILIFIGQSPAIAS  176



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            S   H +   SNELE IL +   P  +RL+LA+W+ELKLL  LAAPAV+VY++N ++SMS
Sbjct  10   SKVSHHDETVSNELEEILTNNQSPYSKRLRLASWVELKLLFQLAAPAVIVYLLNNVISMS  69

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            TQIF GHLGNLELAA SLGNTGIQ+FAYGL+LGMGSAVETLCGQA+GA +YE+LGIYLQR
Sbjct  70   TQIFCGHLGNLELAAVSLGNTGIQVFAYGLLLGMGSAVETLCGQAYGANRYEILGIYLQR  129

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ST+LL LT + L +IY+FS+PILI LG+  +I+S
Sbjct  130  STILLMLTALPLMVIYIFSKPILILLGEPVNIAS  163



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            +S ELE IL D  +P  +R+  ATW+ELKLL  LAAPAV+VY++NY+MSMSTQIF GHLG
Sbjct  37   SSGELEQILTDISLPYSKRVGAATWLELKLLFNLAAPAVIVYLLNYVMSMSTQIFCGHLG  96

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRSTVLL+L G
Sbjct  97   NLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAKKYHMLGIYLQRSTVLLSLAG  156

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            VLL +IYVF+EPIL+ LG++P+I+S
Sbjct  157  VLLTIIYVFAEPILLMLGESPEIAS  181



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +2

Query  149  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            H   EA S +LESIL DT +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  26   HGHGEAVSGQLESILSDTSLPWGRRMVAASVVEMRLLVRLAAPAVLVYMINYLMSMSTQI  85

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRST+
Sbjct  86   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTI  145

Query  506  lltltgvllalIYVFSEPILIFLGQAPDISS  598
            LL  TGV LA+IY FS PIL+ LG++P I+S
Sbjct  146  LLMATGVPLAVIYAFSRPILVLLGESPAIAS  176



>gb|KDO75455.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=444

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 134/168 (80%), Gaps = 9/168 (5%)
 Frame = +2

Query  95   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  274
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  275  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  454
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  455  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GAG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++S
Sbjct  118  GAGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVAS  165



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = +2

Query  146  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            PH    +   LESIL +  +P  +RL+LAT +E+KLL  +AAPAV+VYM+N+LMSMSTQI
Sbjct  7    PHG---SRGRLESILTNPSVPWVRRLQLATIVEMKLLIRIAAPAVMVYMVNFLMSMSTQI  63

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRST+
Sbjct  64   FSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTI  123

Query  506  lltltgvllalIYVFSEPILIFLGQAPDISS  598
            LLT TGV LA+IY FS PIL+ LG++P+I+ 
Sbjct  124  LLTTTGVPLAVIYAFSRPILVLLGESPEIAK  154



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  149  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            H   EA S +LESIL D  +P  QR+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRQRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  506  lltltgvllalIYVFSEPILIFLGQAPDISS  598
            LL  TGV L ++Y FS PIL+ LG++P+I+S
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLGESPEIAS  179



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H     S  LESIL D  +P  +R+  AT +E++LL  LAAPAVVVYMINYLMSMSTQIF
Sbjct  28   HGVEAVSGRLESILSDESLPWGRRMSAATLVEMRLLVRLAAPAVVVYMINYLMSMSTQIF  87

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVL
Sbjct  88   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVL  147

Query  509  ltltgvllalIYVFSEPILIFLGQAPDISS  598
            L  TGV LA++Y FS PIL+ LG++P+I+S
Sbjct  148  LMATGVPLAVLYAFSRPILVLLGESPEIAS  177



>gb|KDO75454.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=456

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 134/167 (80%), Gaps = 9/167 (5%)
 Frame = +2

Query  98   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  277
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  278  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  457
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  118

Query  458  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            AG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++S
Sbjct  119  AGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVAS  165



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H E+  S +LESIL D  +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIF
Sbjct  26   HGETAVSGQLESILGDASVPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIF  85

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRSTVL
Sbjct  86   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTVL  145

Query  509  ltltgvllalIYVFSEPILIFLGQAPDISS  598
            L  TGV LA +Y FS P+L+ LG++P+I+S
Sbjct  146  LMATGVPLAALYAFSRPVLLLLGESPEIAS  175



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  524  vllalIYVFSEPILIFLGQAPDIS  595
            V LA+IY FSEPIL+F+GQ+P+I+
Sbjct  134  VPLAVIYGFSEPILVFMGQSPEIA  157



>gb|ABF97220.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  524  vllalIYVFSEPILIFLGQAPDIS  595
            V LA+IY FSEPIL+F+GQ+P+I+
Sbjct  134  VPLAVIYGFSEPILVFMGQSPEIA  157



>tpg|DAA50097.1| TPA: putative MATE efflux family protein, partial [Zea mays]
Length=167

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +2

Query  152  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  331
            + ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  5    DGADASERLESILTAE---AAASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61

Query  332  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  511
            GHLGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL
Sbjct  62   GHLGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLL  121

Query  512  tltgvllalIYVFSEPILIFLGQAPDIS  595
             +TGV LA+IY FSEPIL+FLGQ+P+I+
Sbjct  122  CVTGVPLAVIYAFSEPILVFLGQSPEIA  149



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  524  vllalIYVFSEPILIFLGQAPDIS  595
            V LA+IY FSEPIL+F+GQ+P+I+
Sbjct  134  VPLAVIYGFSEPILVFMGQSPEIA  157



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLG+TGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGHTGIQVFAYGLMLGMGSAVETL  120

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG++P+I+S
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLLLLGESPEIAS  173



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  149  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  506  lltltgvllalIYVFSEPILIFLGQAPDISS  598
            LL  TGV L ++Y FS PIL+ LG++P+I+S
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLGESPEIAS  179



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 134/167 (80%), Gaps = 9/167 (5%)
 Frame = +2

Query  98   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  277
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  278  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  457
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  118

Query  458  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            AG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++S
Sbjct  119  AGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVAS  165



>ref|XP_008676828.1| PREDICTED: transparent testa 12 protein isoform X1 [Zea mays]
 tpg|DAA50099.1| TPA: putative MATE efflux family protein [Zea mays]
Length=537

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  149  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  506  lltltgvllalIYVFSEPILIFLGQAPDISS  598
            LL  TGV L ++Y FS PIL+ LG++P+I+S
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLGESPEIAS  179



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +2

Query  149  HEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            H++ E  S+ELE IL DT  P  +R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQI
Sbjct  15   HDDHETVSDELEQILTDTEAPYSKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQI  74

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            F GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRSTV
Sbjct  75   FCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGANRHEMLGIYLQRSTV  134

Query  506  lltltgvllalIYVFSEPILIFLGQAPDISS  598
            LL   G+ L +IY+FS+PILI LG+  +I+S
Sbjct  135  LLMAAGIPLMMIYIFSKPILILLGEPVNIAS  165



>emb|CDM85992.1| unnamed protein product [Triticum aestivum]
Length=512

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  161  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  340
             ASNELE+IL D  +P  +R+  AT +E ++L  LAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  30   RASNELEAILNDDSVPWARRMCAATAVETRMLLRLAAPAVLVYMINYMMSMSTQIFAGHL  89

Query  341  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  520
            G LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  T
Sbjct  90   GTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGANKFDMLGIYMQRSTVLLMAT  149

Query  521  gvllalIYVFSEPILIFLGQAPDIS  595
            G+ LA+IYVF  PILI LGQ P+I+
Sbjct  150  GIPLAVIYVFCRPILILLGQTPEIA  174



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 134/168 (80%), Gaps = 9/168 (5%)
 Frame = +2

Query  98   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  277
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  278  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  457
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  118

Query  458  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSP  601
            AG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++S 
Sbjct  119  AGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVASA  166



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H+E+  S+ELE IL DT  P ++R++ A+W+E+KLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVEMKLLFRLAAPAVIVYLLNNVVSMSTQIF  73

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA +YE+LG+YLQRST+L
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFGAHRYEMLGVYLQRSTIL  133

Query  509  ltltgvllalIYVFSEPILIFLGQAPDISS  598
            L    + L +IY+FSEP+L+ LG+   I+S
Sbjct  134  LMAAAIPLMVIYIFSEPLLMLLGEPVSIAS  163



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S  LESIL DT  P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLGN
Sbjct  15   SGRLESILSDTSTPLARRAWAATAIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLGN  74

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLTLTGV
Sbjct  75   LELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTLTGV  134

Query  527  llalIYVFSEPILIFLGQAPDIS  595
             LA++Y FSEP+L+F+GQ+P I+
Sbjct  135  PLAVVYAFSEPLLVFMGQSPAIA  157



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H+E+  S+ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  73

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA +YE+LG+YLQRST+L
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFGAHRYEMLGVYLQRSTIL  133

Query  509  ltltgvllalIYVFSEPILIFLGQAPDISS  598
            L  T + L +IY+F EP+L+ LG+   I+S
Sbjct  134  LMATAIPLMVIYIFCEPLLMLLGEPVSIAS  163



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 141/193 (73%), Gaps = 18/193 (9%)
 Frame = +2

Query  32   EQAAPRFPPHHLTNSVMDSSNG---AAYDPLP--ESDGVVSSPPHEESEASNELESILMD  196
            E ++P   P H      D  +G    A  PLP   +DG            S +LESIL D
Sbjct  9    ELSSPLIFPAH------DDGHGLPLQASTPLPPVAADGTAHG-------TSGKLESILND  55

Query  197  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  376
            T IP  +R+ LA+ IE++LL  LAAPA++VY+IN++MSMSTQIFSGHLGN+ELAAASLGN
Sbjct  56   TSIPWLRRVGLASLIEMRLLLSLAAPAIIVYLINFVMSMSTQIFSGHLGNVELAAASLGN  115

Query  377  TGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSE  556
            TGIQIFAYG+MLGMGSAVETLCGQA+GA KYE+LG+YLQRSTVLL  TGV LA+IY  S 
Sbjct  116  TGIQIFAYGIMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVLLMATGVPLAVIYALSR  175

Query  557  PILIFLGQAPDIS  595
            PIL+ LG++ DI+
Sbjct  176  PILVLLGESRDIA  188



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            S   H +   SNELE IL +   P  +R++LA+W+ELKLL  LAAPAV+VY++N ++SMS
Sbjct  10   SKVSHHDETVSNELEEILTNNQSPYSKRVRLASWVELKLLFQLAAPAVIVYLLNNVISMS  69

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            TQIF GHLGNLELAA SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA  YE+LGIYLQR
Sbjct  70   TQIFCGHLGNLELAAVSLGNNGIQVFAYGLLLGMGSAVETLCGQAYGANSYEILGIYLQR  129

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ST+LL L  + L +IY+FS+PILI LG+  +I+S
Sbjct  130  STILLMLAALPLLVIYIFSKPILILLGEPVNIAS  163



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +2

Query  173  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  352
             LESIL D   P  +R   A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLE
Sbjct  16   RLESILTDASSPWTRRAWAAGGIELRLLARLAAPAVVMYMINYLMSMSTQIFSGHLGNLE  75

Query  353  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  532
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL  TG+ L
Sbjct  76   LAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLCGTGIPL  135

Query  533  alIYVFSEPILIFLGQAPDIS  595
            A+IY FSEPIL+ LGQ+P+I+
Sbjct  136  AVIYAFSEPILVLLGQSPEIA  156



>gb|AAS01962.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
Length=534

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  173  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  352
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  353  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  532
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  533  alIYVFSEPILIFLGQAPDISS  598
            A+IY FS PIL+ LG++P+I+S
Sbjct  164  AVIYAFSRPILVLLGESPEIAS  185



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  173  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  352
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATEVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  353  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  532
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  533  alIYVFSEPILIFLGQAPDISS  598
            A+IY FS PIL+ LG++P+I+S
Sbjct  164  AVIYAFSRPILVLLGESPEIAS  185



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  173  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  352
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  353  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  532
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  533  alIYVFSEPILIFLGQAPDISS  598
            A+IY FS PIL+ LG++P+I+S
Sbjct  164  AVIYAFSRPILVLLGESPEIAS  185



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            + ELE IL DT +   +R   ATWIE+KLL YLAAPAV VY+INY MS STQIFSGHLGN
Sbjct  35   NEELERILSDTEMSAMERYSRATWIEIKLLFYLAAPAVFVYIINYAMSTSTQIFSGHLGN  94

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRS +LLT+TG+
Sbjct  95   LELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAERFEMLGIYLQRSAILLTITGL  154

Query  527  llalIYVFSEPILIFLGQAPDISS  598
             L + YVF +PIL+FLG++ DI+S
Sbjct  155  FLTIPYVFCKPILLFLGESKDIAS  178



>gb|KDP20755.1| hypothetical protein JCGZ_21226 [Jatropha curcas]
Length=359

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            ++ELE IL DT    + R++LA+W+ELKLL  +A PAV+VY++N ++SMSTQIF GHLGN
Sbjct  19   NSELEEILTDTETSSFTRIQLASWVELKLLFRIAGPAVIVYLLNNVVSMSTQIFVGHLGN  78

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAA SLGNTGIQIFAYGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL    +
Sbjct  79   LELAAVSLGNTGIQIFAYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVLLMAASI  138

Query  527  llalIYVFSEPILIFLGQAPDISS  598
             L L+YVFS+P+LI LG+  DI+S
Sbjct  139  PLTLLYVFSKPLLILLGEPNDIAS  162



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  152  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  331
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLAAPA++VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELETLLSNTHLPLLHRYTQATWIEMKLLFYLAAPAILVYMMNYLMTMFTQIFS  71

Query  332  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  511
            GHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQRS +LL
Sbjct  72   GHLGNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQRSAILL  131

Query  512  tltgvllalIYVFSEPILIFLGQAPDISS  598
            TLTG +L ++Y+F +PILI LG++  I+S
Sbjct  132  TLTGFVLTIVYIFCKPILIILGESNQIAS  160



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            + ELE IL DT I    R + ATWIE+KLL YLAAPAV VY+INY MS STQIFSGHLGN
Sbjct  35   NEELERILSDTEISVMDRYRRATWIEIKLLFYLAAPAVFVYIINYTMSTSTQIFSGHLGN  94

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRST+LLT+TG+
Sbjct  95   LELAASSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAERFEMLGIYLQRSTILLTITGI  154

Query  527  llalIYVFSEPILIFLGQAPDISS  598
             L + Y+F +PIL+FLG++ DI+S
Sbjct  155  FLTIPYIFCKPILLFLGESKDIAS  178



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+ Y++N ++SMSTQIF
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLLHLAAPAVIDYLLNNVVSMSTQIF  74

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
             GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRS VL
Sbjct  75   CGHLGNLELAAVSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGANRHEMLGIYLQRSAVL  134

Query  509  ltltgvllalIYVFSEPILIFLGQAPDISS  598
            L  TG+ L +IY+FS+PILI LG+  +I+S
Sbjct  135  LMATGIPLMMIYIFSKPILILLGEPVNIAS  164



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 133/167 (80%), Gaps = 9/167 (5%)
 Frame = +2

Query  98   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  277
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  278  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  457
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAYG  118

Query  458  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            AG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++S
Sbjct  119  AGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVAS  165



>ref|XP_004173828.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=307

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  152  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  331
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  332  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  511
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQ+S +LL
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQKSAILL  131

Query  512  tltgvllalIYVFSEPILIFLGQAPDISS  598
            TLTG +L ++Y+  +PILI LG++  I+S
Sbjct  132  TLTGFVLTIVYISCKPILIILGESNKIAS  160



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  131  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  310
            ++S  P    E+S ELE IL DT  P  +RL  A  +E +LL +LA PAV+VYMINYLMS
Sbjct  25   LLSPSPKTSHESSGELERILTDTTRPFLRRLGPALLMESRLLFHLAGPAVIVYMINYLMS  84

Query  311  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  490
            MSTQI SGHLGNLELAA+SLGN G+QIFAYGLMLGMGSAVETLCGQA+GA KY +LGIYL
Sbjct  85   MSTQIVSGHLGNLELAASSLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAQKYGMLGIYL  144

Query  491  QRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            QRST+LLTLTG+LL ++Y+FS+PIL+FLG++  I+S
Sbjct  145  QRSTILLTLTGILLTVVYIFSKPILLFLGESEKIAS  180



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  170  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  349
             +LESIL D  +P  +R+  AT +EL++L  LAAPAV+VYMINYLMSMSTQIFSGHLG L
Sbjct  33   RQLESILSDESVPWGRRMCAATAVELRMLIRLAAPAVLVYMINYLMSMSTQIFSGHLGTL  92

Query  350  ELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvl  529
            ELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  TGV 
Sbjct  93   ELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGASKFDMLGIYMQRSTVLLMATGVP  152

Query  530  lalIYVFSEPILIFLGQAPDIS  595
            LA++Y FS PIL+ LG++P+I+
Sbjct  153  LAVLYAFSRPILVLLGESPEIA  174



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  74

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
             GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G+ ++E+LGIYLQRSTVL
Sbjct  75   CGHLGNLELAAVSLGNNGIQMFAYGLMLGMGSAVETLCGQAYGSNRHEMLGIYLQRSTVL  134

Query  509  ltltgvl-lalIYVFSEPILIFLGQAPDISS  598
            L  TG+  L +IY+FS+PILI LG+  +I+S
Sbjct  135  LMATGIFPLMMIYIFSKPILILLGEPANIAS  165



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +2

Query  146  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            P  E      LESIL D+ +P  +R   AT +EL  L  L APAVV+YMINYLMSMSTQI
Sbjct  3    PGGEDGGGGRLESILTDSSLPLGERAWAATRVELGTLARLVAPAVVMYMINYLMSMSTQI  62

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRS V
Sbjct  63   FSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYGAQKYDMLGVYLQRSAV  122

Query  506  lltltgvllalIYVFSEPILIFLGQAPDIS  595
            LL+ TG+ LA+IY FSEPIL+FLGQ+ +I+
Sbjct  123  LLSCTGIPLAVIYAFSEPILLFLGQSLEIA  152



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +2

Query  59   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  238
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG+  +++S
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLGEPAEVAS  182



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  131  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  310
            ++S         S+ELE  L +T +P + RL+ ATW+ELK+L  LAAPAVVVY++N ++S
Sbjct  15   LISKRSSSVQPVSSELEETLSNTELPYFHRLRRATWVELKILFRLAAPAVVVYLLNNVIS  74

Query  311  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  490
            MSTQI+ GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYL
Sbjct  75   MSTQIYCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYL  134

Query  491  QRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            QRST+LL  TG+ +  IY+FS+P+L+ LG++  I+S
Sbjct  135  QRSTILLMATGIPVMFIYIFSKPLLLALGESSTIAS  170



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M S +   + P+ ES    SS      E+S+ELE +L D  +P  +RL+ ATWIELKLL 
Sbjct  1    MGSQDDQLHTPILESMQR-SSSTGSTFESSSELEKVLSDLQLPWLRRLRTATWIELKLLF  59

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VY+IN  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETL
Sbjct  60   RLAAPAVLVYLINNAMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETL  119

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  580
            CGQA+GA + E+LGIYLQR+TV+LT TG  L +IYVF++PIL+ LG+
Sbjct  120  CGQAYGANRSEMLGIYLQRATVVLTATGFPLTVIYVFAKPILLLLGE  166



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  161  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  340
            E S +LESIL D  +P  +R+  A+ +EL+LL  LAAPAVVVYMINYLMSMSTQIFSGHL
Sbjct  38   EVSGQLESILSDGSLPWPRRVLAASAVELRLLARLAAPAVVVYMINYLMSMSTQIFSGHL  97

Query  341  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  520
            G LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIYLQR+T+LL  T
Sbjct  98   GTLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAYGALKHDMLGIYLQRATILLMAT  157

Query  521  gvllalIYVFSEPILIFLGQAPDIS  595
            GV LA+IY FS PILI LG++P+I+
Sbjct  158  GVPLAVIYAFSRPILILLGESPEIA  182



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  152  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  331
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERVWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  332  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  511
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  512  tltgvllalIYVFSEPILIFLGQAPDIS  595
              TG+ LA+IY FSEPIL+ LGQ+P+I+
Sbjct  125  CCTGIPLAVIYAFSEPILLLLGQSPEIA  152



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 138/183 (75%), Gaps = 7/183 (4%)
 Frame = +2

Query  59   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  232
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  4    NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  58

Query  233  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  412
            T+IELK L  LA PAVVVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  59   TFIELKTLFQLAGPAVVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  118

Query  413  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  592
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG++  I
Sbjct  119  GMGSAVETLCGQAYGAHKYEILGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLGESDTI  178

Query  593  SSP  601
            +S 
Sbjct  179  ASA  181



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 135/179 (75%), Gaps = 6/179 (3%)
 Frame = +2

Query  65   LTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIE  244
            + +S  D +N   ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIE
Sbjct  1    MDSSNTDINNNNVHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIE  54

Query  245  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGS  424
            LK L  LAAPA++VYM+N L+SMSTQIF GHLGNLELAA SLG+TGIQ+FA+GLMLGMGS
Sbjct  55   LKNLFRLAAPAILVYMLNNLVSMSTQIFCGHLGNLELAAVSLGSTGIQVFAFGLMLGMGS  114

Query  425  AVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSP  601
            A ETLCGQA+GA KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG++  I+S 
Sbjct  115  ATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLGESSAIASA  173



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 121/145 (83%), Gaps = 5/145 (3%)
 Frame = +2

Query  164  ASNELESILMDTGIPR-WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  340
            AS +LES+L  +     W     A  IEL+LL  LAAPAVV YMINYLMSMSTQIFSGHL
Sbjct  11   ASAQLESVLTSSSSSFPWA----AAAIELRLLTRLAAPAVVTYMINYLMSMSTQIFSGHL  66

Query  341  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  520
            GNLELAAASLGNTG+QIFAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL  T
Sbjct  67   GNLELAAASLGNTGVQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLLCAT  126

Query  521  gvllalIYVFSEPILIFLGQAPDIS  595
            GV LA+IY FSEPIL+FLGQ+P+I+
Sbjct  127  GVPLAVIYAFSEPILVFLGQSPEIA  151



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  152  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  331
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  332  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  511
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  512  tltgvllalIYVFSEPILIFLGQAPDIS  595
              TG+ LA+IY FSEP+L+ LGQ+P+I+
Sbjct  125  CCTGIPLAVIYAFSEPLLLLLGQSPEIA  152



>ref|XP_011048000.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=505

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 138/182 (76%), Gaps = 7/182 (4%)
 Frame = +2

Query  59   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  232
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  233  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  412
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  413  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  592
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG++  I
Sbjct  137  GMGSAVETLCGQAYGAQKYEMLGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLGESDTI  196

Query  593  SS  598
            +S
Sbjct  197  AS  198



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  152  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  331
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  332  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  511
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  512  tltgvllalIYVFSEPILIFLGQAPDIS  595
              TG+ LA+IY FSEP+L+ LGQ+P+I+
Sbjct  125  CCTGIPLAVIYAFSEPLLLLLGQSPEIA  152



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 138/182 (76%), Gaps = 7/182 (4%)
 Frame = +2

Query  59   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  232
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  233  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  412
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  413  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  592
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG++  I
Sbjct  137  GMGSAVETLCGQAYGAQKYEMLGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLGESDTI  196

Query  593  SS  598
            +S
Sbjct  197  AS  198



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 127/163 (78%), Gaps = 7/163 (4%)
 Frame = +2

Query  110  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  289
            P P SD V        S +S+ELE +L D  +P  +R + ATWIELKLL  LAAPAV++Y
Sbjct  18   PPPPSDAV-------ASHSSSELEKVLSDADLPCLKRYRKATWIELKLLFKLAAPAVMMY  70

Query  290  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  469
            +IN  MSMST+IFSGHLGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+GAG+Y
Sbjct  71   LINNAMSMSTRIFSGHLGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYGAGRY  130

Query  470  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            E+LG+YLQR+TV+L +  + + ++YV S P+L+F+G++  +++
Sbjct  131  EMLGVYLQRATVVLMMFSLPIVVVYVLSRPLLLFIGESKQVAT  173



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +2

Query  59   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  238
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG+  +++S
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLGEPAEVAS  182



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +2

Query  140  SPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            +P       SN ELE IL D  +P  +R+  A  +E +LL +LAAPAVVVY+INY+MSMS
Sbjct  19   TPRSNSKHGSNGELERILTDDTLPFLRRVGAALCVEFRLLFFLAAPAVVVYLINYVMSMS  78

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            TQIFSGHLGNLELAA++LGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LG+Y+QR
Sbjct  79   TQIFSGHLGNLELAASALGNNGIQVFAYGLMLGMGSAVETLCGQAYGARKFGMLGVYMQR  138

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            STVLL+L G+++ +IY FSE IL+FLGQ+ +I++
Sbjct  139  STVLLSLAGIVVTVIYAFSERILLFLGQSEEIAA  172



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   185 bits (470),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 136/180 (76%), Gaps = 6/180 (3%)
 Frame = +2

Query  59   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  238
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG+  +++S
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLGEPAEVAS  182



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM
Sbjct  41   IELRLLTRLAAPAVVMYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  100

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDIS  595
            GSAVETLCGQA+GA KY++LGIYLQRS VLL  TGV LA++Y FSEPIL+FLGQ+P+I+
Sbjct  101  GSAVETLCGQAYGAQKYDMLGIYLQRSAVLLCATGVPLAVVYAFSEPILVFLGQSPEIA  159



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  152  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  331
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  332  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  511
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQ+S +LL
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQKSAILL  131

Query  512  tltgvllalIYVFSEPILIFLGQAPDISS  598
            TLTG +L ++Y+  +PILI LG++  I+S
Sbjct  132  TLTGFVLTIVYISCKPILIILGESNKIAS  160



>gb|KJB69294.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=497

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 135/186 (73%), Gaps = 13/186 (7%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  220
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  221  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  400
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  401  GLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  580
            GLMLGMGSAVETLCGQA+GA +Y +LG+YLQRST++LTLTG+ L L+YVFS+PI+I LG+
Sbjct  121  GLMLGMGSAVETLCGQAYGAHRYSMLGVYLQRSTIVLTLTGIPLVLVYVFSKPIMIVLGE  180

Query  581  APDISS  598
            +  ++S
Sbjct  181  STAVAS  186



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 6/180 (3%)
 Frame = +2

Query  59   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  238
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSGLEKVLSDTELPFFKRLRLATL  62

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQA+GA +Y++LGIYLQRST++LTLTG+ L L Y+FS+PIL+ LG+  +++S
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSTIVLTLTGIPLMLAYIFSKPILMLLGEPAEVAS  182



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +2

Query  152  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  331
            + ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  5    DGADASERLESILTAEAA---ASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61

Query  332  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  511
            GHLGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL
Sbjct  62   GHLGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLL  121

Query  512  tltgvllalIYVFSEPILIFLGQAPDIS  595
             +TGV LA+IY FSEPIL+FLGQ+P+I+
Sbjct  122  CVTGVPLAVIYAFSEPILVFLGQSPEIA  149



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 135/186 (73%), Gaps = 13/186 (7%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  220
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  221  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  400
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  401  GLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  580
            GLMLGMGSAVETLCGQA+GA +Y +LG+YLQRST++LTLTG+ L L+YVFS+PI+I LG+
Sbjct  121  GLMLGMGSAVETLCGQAYGAHRYSMLGVYLQRSTIVLTLTGIPLVLVYVFSKPIMIVLGE  180

Query  581  APDISS  598
            +  ++S
Sbjct  181  STAVAS  186



>gb|KDP20756.1| hypothetical protein JCGZ_21227 [Jatropha curcas]
Length=999

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE IL +T     QR + AT +ELK L YLAAPA+VVY++N ++SMSTQI  GHLGN
Sbjct  30   SDELEQILCNTQFTYLQRTRKATLVELKTLFYLAAPAIVVYLLNNVVSMSTQILVGHLGN  89

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GAGKY++LG+YLQRST+LLT TG+
Sbjct  90   LELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAGKYDMLGVYLQRSTILLTATGI  149

Query  527  llalIYVFSEPILIFLGQAPDISSP  601
             + LIYVFS+PILI LG++ +I+S 
Sbjct  150  PITLIYVFSKPILILLGESKEIASA  174


 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 132/189 (70%), Gaps = 13/189 (7%)
 Frame = +2

Query  32   EQAAPRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPR  211
            E+   +F  +   N + ++ N       P        PP      S+ELE IL +  +  
Sbjct  488  EEKREKFSTYRKINHMANNQNSLLRKHSP--------PP-----VSSELEDILSNMELSY  534

Query  212  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQI  391
             QRLK A  +ELK L  LA PAV+VY++N ++SMSTQIF GHLGNLELAAASLGNTGIQ+
Sbjct  535  SQRLKSAVLVELKTLFLLAGPAVIVYLLNNVVSMSTQIFCGHLGNLELAAASLGNTGIQV  594

Query  392  FAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIF  571
            FAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRSTV+LT  G+ L LIY FS+ IL+ 
Sbjct  595  FAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVILTAAGIPLTLIYAFSKQILLL  654

Query  572  LGQAPDISS  598
            LG++ +I++
Sbjct  655  LGESKEIAA  663



>gb|KCW76957.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=458

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = +2

Query  125  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  262
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  263  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  442
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  443  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GQA+GA KYE+LG+YLQRST+LL  T + +  IY+FS+ +L+ LG++  I+S
Sbjct  127  GQAYGAHKYEMLGVYLQRSTILLMATAIPVMFIYIFSKQLLLLLGESTSIAS  178



>ref|XP_007212447.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
 gb|EMJ13646.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
Length=490

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 131/161 (81%), Gaps = 7/161 (4%)
 Frame = +2

Query  137  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  295
            S P     EASN+       LE +L DT +P ++RL+LATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTALEASNQGDGLESPLEKVLSDTQLPSFKRLRLATWIELNLLFRLAAPAVLVYVV  74

Query  296  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  475
            N  MS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NNFMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  476  LGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G+ P +++
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFGETPKLAA  175



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 129/160 (81%), Gaps = 6/160 (4%)
 Frame = +2

Query  137  SSPPHE------ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  298
            S P +E        E S+ LE +L DT +P ++RL+LATWIELKLL  LAAPAV VY++N
Sbjct  13   SEPAYESLASASHGEESSSLEKVLSDTQLPYFKRLRLATWIELKLLFRLAAPAVFVYVVN  72

Query  299  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  478
              MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA  Y++L
Sbjct  73   NTMSVSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYGAQMYDML  132

Query  479  GIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GIYLQR+TV+L++TG+ L  +++ S+PIL+  G++  ++S
Sbjct  133  GIYLQRATVVLSITGIPLLAVFILSKPILLLFGESSALAS  172



>ref|XP_006467446.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467447.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Citrus 
sinensis]
Length=488

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 125/159 (79%), Gaps = 6/159 (4%)
 Frame = +2

Query  104  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  283
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  284  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  463
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  464  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  580
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLGE  165



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = +2

Query  125  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  262
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  263  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  442
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  443  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GQA+GA KYE+LG+YLQRST+LL  T + +  IY+FS+ +L+ LG++  I+S
Sbjct  127  GQAYGAHKYEMLGVYLQRSTILLMATAIPVMFIYIFSKQLLLLLGESTSIAS  178



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 130/159 (82%), Gaps = 7/159 (4%)
 Frame = +2

Query  137  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  295
            S P    +EAS         LE +L DT +  ++RL+LA+WIELKLL  LAAPAV+VY++
Sbjct  15   SEPDSAAAEASGHGDGLESLLEKVLSDTQLSSFKRLRLASWIELKLLFRLAAPAVLVYIV  74

Query  296  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  475
            NYLMS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NYLMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  476  LGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  592
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G+ P +
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFGETPKL  173



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS  LESIL DT  P  +R   A  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  13   ASCRLESILTDTSAPLAERAWAAGTVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  72

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
             LELAAASLGNTG+Q FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +LL LTG
Sbjct  73   TLELAAASLGNTGVQTFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVILLALTG  132

Query  524  vllalIYVFSEPILIFLGQAPDIS  595
            + LA++Y FSEP+L+ +GQ+P+I+
Sbjct  133  IPLAVMYAFSEPLLLLMGQSPEIA  156



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            +D +    + PL       S  P      S+ LE  L D  +  + R++ ATWIEL +L 
Sbjct  9    IDCAENEVHQPLLHYYKSFSPEPC----VSDLLEDTLSDNSLSLFWRIQRATWIELGILF  64

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
            +LAAPAVVVY+ N L+SMSTQIF GHLGNLELAAASLGN GIQ FAYGLMLGMGSAVETL
Sbjct  65   HLAAPAVVVYLFNNLISMSTQIFCGHLGNLELAAASLGNNGIQTFAYGLMLGMGSAVETL  124

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQA+GA KY +LGIYLQRST+LL  TG+ L +IY+FS+PIL+ LG++P I+S
Sbjct  125  CGQAYGANKYGMLGIYLQRSTILLMATGIPLMIIYIFSKPILLLLGESPTIAS  177



>gb|KDO78208.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=507

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 125/159 (79%), Gaps = 6/159 (4%)
 Frame = +2

Query  104  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  283
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  284  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  463
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  464  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  580
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLGE  165



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 125/159 (79%), Gaps = 6/159 (4%)
 Frame = +2

Query  104  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  283
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  284  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  463
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  464  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  580
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLGE  165



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            ++P  ++ + + +LE IL DT +   +RL+ A  IELKLL +LA PA  VYMINY+MSMS
Sbjct  15   TNPDSDQPQNNEQLERILSDTQLSTLKRLQSAIVIELKLLFHLATPAAFVYMINYVMSMS  74

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            T++FSGHLGNLELAA SLGN+GIQ+ AYGLMLGMGSAVETLCGQA+G  +YE+LGIYLQR
Sbjct  75   TRVFSGHLGNLELAAVSLGNSGIQLLAYGLMLGMGSAVETLCGQAYGGRRYEMLGIYLQR  134

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ST++L  TG+ +A++Y+FS+PILIFL +  +I+S
Sbjct  135  STIILMATGIPIAVLYIFSKPILIFLHEPVEIAS  168



>ref|XP_008347106.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Malus domestica]
Length=508

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
             S+ELE  L +T +  +QRL+ ATW+E K+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  25   VSSELEDTLNNTDLSNFQRLRTATWLETKILYRLAAPAVVVYLLNNVISMSTQIFCGHLG  84

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG
Sbjct  85   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLLATG  144

Query  524  vllalIYVFSEPILIFLGQ  580
            + L  +Y+FS+P+L+ LG+
Sbjct  145  IPLXXVYIFSKPLLLALGE  163



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = +2

Query  149  HE-ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            HE E  AS  LESIL DT  P   R  LA  +EL+LL  LA PAVVVYMIN++MSMSTQI
Sbjct  7    HEHEHAASCRLESILTDTSAPLATRAWLAGAVELRLLARLATPAVVVYMINFVMSMSTQI  66

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
              GHLG LELAAASLGNTG+Q  AYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +
Sbjct  67   LCGHLGTLELAAASLGNTGVQTMAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVI  126

Query  506  lltltgvllalIYVFSEPILIFLGQAPDIS  595
            LL LTG+ LA++Y FSEP+L+ +GQ+P+I+
Sbjct  127  LLGLTGIPLAVMYAFSEPLLLLMGQSPEIA  156



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = +2

Query  146  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  325
            PH+     ++LE++L D  +  + RL+LATWIELKLL YLAAPAV+VYMIN  MS+ST+I
Sbjct  32   PHQ---VDSKLETVLTDMELTYFNRLRLATWIELKLLFYLAAPAVMVYMINNFMSLSTRI  88

Query  326  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  505
            F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+G+ +Y +LGIY+QR+ V
Sbjct  89   FAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGSSRYNMLGIYMQRAMV  148

Query  506  lltltgvllalIYVFSEPILIFLGQAPDISS  598
            +LT TG+ L +IYV S+P+L+ LG++ +++S
Sbjct  149  VLTATGIPLTIIYVLSKPLLLLLGESTEVAS  179



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 129/159 (81%), Gaps = 7/159 (4%)
 Frame = +2

Query  143  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  301
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  302  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  481
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA +Y +LG
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGALRYNMLG  140

Query  482  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            +YLQRST++LTLTG+ LAL YVFS+PILI LG++  ++S
Sbjct  141  VYLQRSTIVLTLTGIPLALAYVFSKPILILLGESAMVAS  179



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 129/159 (81%), Gaps = 7/159 (4%)
 Frame = +2

Query  143  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  301
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  302  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  481
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA +Y +LG
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGALRYNMLG  140

Query  482  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            +YLQRST++LTLTG+ LAL YVFS+PILI LG++  ++S
Sbjct  141  VYLQRSTIVLTLTGIPLALAYVFSKPILILLGESAMVAS  179



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +2

Query  143  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQ  322
            PP    E S++LE IL D G+    R K ATW+ELKLL  LAAPA++VY++N L++MSTQ
Sbjct  20   PPPVGEEVSSDLEQILTDDGLTFSTRYKKATWVELKLLTRLAAPAIIVYLLNNLLNMSTQ  79

Query  323  IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRSt  502
            IF G LGNLELA ++L N GIQ+F YG+MLGMGSAVETLCGQA+GA KYE+LGIYLQRST
Sbjct  80   IFCGQLGNLELAGSALANNGIQLFVYGVMLGMGSAVETLCGQAYGAHKYEMLGIYLQRST  139

Query  503  vlltltgvllalIYVFSEPILIFLGQAPDISS  598
            +LL  TG+ L  +Y+FS+P+L+ LG++ D+++
Sbjct  140  ILLVATGIPLLFLYIFSKPLLLLLGESRDVAA  171



>ref|XP_010093281.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB53806.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=534

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            M+S N   ++P+  +    S    E    S+ELE  L ++ +  ++R + AT +ELK L 
Sbjct  1    MESINNDLHEPILATKEASSILSPEA--ISSELEETLSNSDLSYFRRFQAATCLELKTLY  58

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPAV+VY++N + SMSTQI  GHLGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  59   RLAAPAVIVYLLNNVTSMSTQILCGHLGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETL  118

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            CGQA+GA KYELLG+YLQRST+LL  TGV L LIY+FS+PILIFLG++  I+S
Sbjct  119  CGQAYGAHKYELLGVYLQRSTILLMATGVPLTLIYIFSKPILIFLGESESIAS  171



>gb|EYU29855.1| hypothetical protein MIMGU_mgv1a004845mg [Erythranthe guttata]
Length=507

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 128/175 (73%), Gaps = 9/175 (5%)
 Frame = +2

Query  83   DSSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  256
             S N    +PL  P S+G          E S+ELE +L DT +  W+R + A  IEL+ L
Sbjct  3    SSKNKGVSEPLLEPNSNG-------GTEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYL  55

Query  257  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  436
              LA PAVVVY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVET
Sbjct  56   LRLAGPAVVVYLLNSVISMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVET  115

Query  437  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSP  601
            LCGQA+GA +YE+LGIY+QRS +LL  TG+ L LIY+FS+P+LI LG++  ++S 
Sbjct  116  LCGQAYGAQQYEMLGIYMQRSIILLMATGIPLMLIYIFSKPLLILLGESDRVASA  170



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 129/159 (81%), Gaps = 7/159 (4%)
 Frame = +2

Query  137  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  295
            S P    +EAS         LE +L DT +  ++RL+LATWIELKLL  LAAPAV+VY++
Sbjct  15   SEPDLAAAEASGHGDGFESPLEKVLSDTQLSSFKRLRLATWIELKLLFRLAAPAVLVYIV  74

Query  296  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  475
            NYLMS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSA+ETLCGQA+GA  Y++
Sbjct  75   NYLMSLSTRLFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSALETLCGQAYGAENYDM  134

Query  476  LGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  592
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G+ P +
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFGETPKL  173



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 128/164 (78%), Gaps = 5/164 (3%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL ES+      P    + S+ELE IL DT + R QR + A+ IEL+ L  LAAP+++V
Sbjct  5    EPLLESE-----EPILAEQISSELEEILSDTSLSRIQRFRRASVIELRNLFRLAAPSIIV  59

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G  K
Sbjct  60   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGGHK  119

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            YE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++S
Sbjct  120  YEMLGIYLQRSTILLMLTGIPLMVAYLFSKPILILLGQSKKVAS  163



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS  LESIL DT  P  +R  LA  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  15   ASCLLESILTDTSAPLARRAWLAGAVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  74

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
             LELAAASLGN G+Q FA+GLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +LL LTG
Sbjct  75   TLELAAASLGNCGVQTFAFGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVILLGLTG  134

Query  524  vllalIYVFSEPILIFLGQAPDIS  595
            + LA++Y FSEP+L+ +GQ+P+I+
Sbjct  135  IPLAVMYAFSEPLLLLMGQSPEIA  158



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  158  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  337
            + +S+ELE +L DT +P   R K ATWIEL+LL  LAAPAV++YMIN  MSMST+IFSGH
Sbjct  34   THSSSELEKVLSDTDLPFLTRYKKATWIELRLLFKLAAPAVMMYMINNAMSMSTRIFSGH  93

Query  338  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  517
            LGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L L
Sbjct  94   LGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYGARRYEMLGVYLQRATVVLML  153

Query  518  tgvllalIYVFSEPILIFLGQAPDISSP  601
              + +  +Y+ S  IL+ +G+   +++P
Sbjct  154  FSLPIVAVYLLSRQILLLIGEEEQVATP  181



>ref|XP_011048008.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Populus 
euphratica]
Length=485

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 135/180 (75%), Gaps = 3/180 (2%)
 Frame = +2

Query  65   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  238
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG+   ++S
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLGEPTTVAS  179



>gb|KDO78210.1| hypothetical protein CISIN_1g043801mg, partial [Citrus sinensis]
Length=215

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  197  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  376
            T +  +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF GHLGNLELAA SLGN
Sbjct  10   TSLSFFQRIKKATWIELKSLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGN  69

Query  377  TGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSE  556
            TGIQ+FAYGLMLGMGSA ETLCGQA+GA KY++LG+YLQRS V+LT TG+ L +IY+FS+
Sbjct  70   TGIQVFAYGLMLGMGSATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYIFSK  129

Query  557  PILIFLGQ  580
             IL+ LG+
Sbjct  130  QILLLLGE  137



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLGN  85

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  527  llalIYVFSEPILIFLGQ  580
             L +IY+FS+P+L+ LG+
Sbjct  146  PLMIIYIFSKPLLLALGE  163



>ref|XP_008371179.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=340

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +2

Query  56   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  214
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  215  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  394
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  395  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  574
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  575  GQAP  586
            G+ P
Sbjct  185  GEPP  188



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL ES+     P    ++ S+ELE IL DT +   QR   A+ +EL+ L  LAAPA++V
Sbjct  13   EPLLESE----PPTLAAAKISSELEEILSDTSLSHLQRFGRASVVELRNLFRLAAPAIIV  68

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA K
Sbjct  69   YLLNNITSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAHK  128

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            YE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++S
Sbjct  129  YEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLGQSKKVAS  172



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLGN  85

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  527  llalIYVFSEPILIFLGQ  580
             L +IY+FS+P+L+ LG+
Sbjct  146  PLMIIYIFSKPLLLALGE  163



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  259
            MDS +   + P+ ES    SS      E+S+ELE +L D  +P  +RL  ATWIELKLL 
Sbjct  1    MDSQDDQLHTPILESMQC-SSSTGNTFESSSELEKVLSDLQLPWLRRLLKATWIELKLLF  59

Query  260  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  439
             LAAPA++VY+IN  MS+ST++F+GHLGNLELAAA+LG + IQ+ AYGLMLGMGSAVETL
Sbjct  60   RLAAPAILVYLINNAMSLSTRVFAGHLGNLELAAATLGKSSIQL-AYGLMLGMGSAVETL  118

Query  440  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  580
            CGQA+GA +YE+LG+YLQR+TV+LT TG  L +IYVF++PIL+ LG+
Sbjct  119  CGQAYGADRYEMLGVYLQRATVVLTATGFPLTVIYVFAKPILLLLGE  165



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE IL +  + R +RL  ATW+ELK+L  LAAPA+VVYM+N+L+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRLLRATWVELKILFPLAAPAIVVYMLNFLVSISTQMFCGHLGN  93

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAAASLGNTG+Q F +G+MLGMGSAVETLCGQA+GA KYE+LG+Y+QRST+LLTLTG+
Sbjct  94   LELAAASLGNTGVQGFVFGIMLGMGSAVETLCGQAYGANKYEMLGVYMQRSTILLTLTGL  153

Query  527  llalIYVFSEPILIFLGQAPDISSP  601
            +L  IY+F +PIL+ L ++P I+S 
Sbjct  154  ILMFIYIFCKPILLGLHESPAIASA  178



>gb|EYU29854.1| hypothetical protein MIMGU_mgv1a005159mg [Erythranthe guttata]
Length=495

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +2

Query  89   SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  268
            + GA   PL ES     + P    E S+ELE IL D  +  W+R + A+ IEL+    LA
Sbjct  6    NKGAVNQPLLESYK--PALPEAAEEVSSELEEILSDATLSWWRRYQKASVIELRYFFRLA  63

Query  269  APAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQ  448
             PAV+VY++N + SMSTQIF GHLGNLELAA+SLGN GIQ+ AYGLMLGMGSAVETLCGQ
Sbjct  64   GPAVIVYLLNNVTSMSTQIFCGHLGNLELAASSLGNNGIQLLAYGLMLGMGSAVETLCGQ  123

Query  449  AFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            A+GA KYE+LGIY+QRS VLL +TG+ L L+Y+F +PIL+ LG++  ++S
Sbjct  124  AYGAHKYEMLGIYMQRSVVLLMVTGLPLMLVYIFCKPILLLLGESKSVAS  173



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLGN  85

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  527  llalIYVFSEPILIFLGQ  580
             L +IY+FS+P+L+ LG+
Sbjct  146  PLMIIYIFSKPLLLALGE  163



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 129/161 (80%), Gaps = 7/161 (4%)
 Frame = +2

Query  137  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  295
            S P     EASN        LE +L DT +P ++RL+ ATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTAPEASNHGDGLESPLEKVLSDTQLPFFKRLRSATWIELNLLFRLAAPAVLVYVV  74

Query  296  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  475
            N  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NNSMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  476  LGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G+ P +++
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFGETPKLAA  175



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 135/180 (75%), Gaps = 3/180 (2%)
 Frame = +2

Query  65   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  238
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG+   ++S
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLGEPTTVAS  179



>ref|XP_002518493.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43880.1| multidrug resistance pump, putative [Ricinus communis]
Length=510

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  158  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  337
            S  S+ELE IL +T +  +QRLK A  +ELK+L  LA PAV VY++N ++SMSTQIF GH
Sbjct  28   SPVSSELEEILSNTNLSCFQRLKKAALLELKILFRLAGPAVFVYLLNNVVSMSTQIFCGH  87

Query  338  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  517
            LGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRS +LL  
Sbjct  88   LGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSAILLAA  147

Query  518  tgvllalIYVFSEPILIFLGQAPDISS  598
            TG+ L +IY FS+ IL+ LG++ +I+S
Sbjct  148  TGIPLTIIYSFSKQILLLLGESKEIAS  174



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L++TG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSVTGI  140

Query  527  llalIYVFSEPILIFLGQAPDISSP  601
             L ++Y+FS+ IL+ LG++  ++S 
Sbjct  141  PLTVVYLFSKNILLALGESKLVASA  165



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L++TG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSVTGI  140

Query  527  llalIYVFSEPILIFLGQAPDISSP  601
             L ++Y+FS+ IL+ LG++  ++S 
Sbjct  141  PLTVVYLFSKNILLALGESKLVASA  165



>ref|XP_006348109.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=427

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            + LA++Y+FS+ IL+ LG++  ++S
Sbjct  139  IPLAVVYLFSKNILLALGESKQVAS  163



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 135/180 (75%), Gaps = 3/180 (2%)
 Frame = +2

Query  65   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  238
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG+   ++S
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLGEPTTVAS  179



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S  LESIL D  +   +RL  AT +E++LL  LAAPAVVVYM+N L+S+ TQ+FSGHLGN
Sbjct  14   SRRLESILADLTMSWPRRLWSATTVEMQLLFPLAAPAVVVYMLNNLLSLGTQVFSGHLGN  73

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+
Sbjct  74   LELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVLLMATGI  133

Query  527  llalIYVFSEPILIFLGQAPDISS  598
             LA++Y FS P+L+ LGQ+P+I++
Sbjct  134  PLAVVYAFSRPLLLLLGQSPEIAT  157



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL ES+  + +    E + S+ELE IL DT +   QR K A+ IEL+ L  LAAPA++V
Sbjct  5    EPLLESESPILASAATE-KISSELEEILSDTSLSCIQRFKRASVIELRNLFRLAAPAIIV  63

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G  K
Sbjct  64   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGGHK  123

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            YE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++S
Sbjct  124  YEMLGIYLQRSTILLMLTGLPLMVAYLFSKPILILLGQSKKVAS  167



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  131  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  310
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  14   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  73

Query  311  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  490
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+
Sbjct  74   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGANKYEMLGIYM  133

Query  491  QRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            QR+ ++LT+TG+ L ++Y+F +PIL+ LG+ P+++S
Sbjct  134  QRAIIVLTITGIPLTVVYIFCKPILLLLGEPPEVAS  169



>ref|XP_009618512.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=418

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 6/165 (4%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  283
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  284  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  463
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA 
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAH  126

Query  464  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            KYE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++S
Sbjct  127  KYEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLGQSKKLAS  171



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  131  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  310
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  13   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  72

Query  311  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  490
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+
Sbjct  73   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGANKYEMLGIYM  132

Query  491  QRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            QR+ ++LT+TG+ L ++Y+F +PIL+ LG+ P+++S
Sbjct  133  QRAIIVLTITGIPLTVVYIFCKPILLLLGEPPEVAS  168



>ref|XP_010546899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546908.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  131  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  310
            ++ SP  +ESEA + LES+L DT +P ++RL LA+ +E+K L +LAAPAV VY+IN  MS
Sbjct  13   LLDSPKPQESEADHRLESVLSDTHLPYFRRLYLASMLEMKFLFHLAAPAVFVYLINNGMS  72

Query  311  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  490
            + T+IF+GHLG+LELAA+SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE++G+YL
Sbjct  73   ILTRIFAGHLGSLELAASSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMMGVYL  132

Query  491  QRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            QRSTV+L LTG+ + L++VFS+PIL FLG+  +++S
Sbjct  133  QRSTVVLALTGLPMTLLFVFSKPILTFLGEPAEVAS  168



>gb|EPS61219.1| hypothetical protein M569_13580, partial [Genlisea aurea]
Length=159

 Score =   168 bits (425),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +2

Query  161  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  340
            E S++LE  L +T +P+W+RL+ A  IEL++L  LA PAV+ Y++  ++S STQIF GH+
Sbjct  2    EVSSDLEDALSNTAVPQWRRLERAVRIELRILSRLAGPAVISYLLGNVISTSTQIFCGHI  61

Query  341  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  520
            GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+GA +YE+LG+Y+QRST+LL  T
Sbjct  62   GNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYGAHRYEMLGMYMQRSTILLMAT  121

Query  521  gvllalIYVFSEPILIFLGQAPDISS  598
            G+ L L Y FS P+L+ LG++  ++S
Sbjct  122  GIPLMLFYAFSRPLLVLLGESERVAS  147



>ref|XP_009618511.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=439

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 6/165 (4%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  283
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  284  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  463
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA 
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAH  126

Query  464  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            KYE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++S
Sbjct  127  KYEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLGQSKKLAS  171



>gb|EYU29852.1| hypothetical protein MIMGU_mgv1a004818mg [Erythranthe guttata]
Length=508

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 127/173 (73%), Gaps = 5/173 (3%)
 Frame = +2

Query  83   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  262
              + G   DPL ES     S      E S+ELE +L DT +  W+R + A  IEL+ L  
Sbjct  4    SKNKGETTDPLLES-----SYGGGVEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYLLR  58

Query  263  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  442
            LA PAV+VY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVETLC
Sbjct  59   LAGPAVLVYLLNSVVSMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVETLC  118

Query  443  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSP  601
            GQA+GA +YE+LGIY+QRS +LL LTG+ L  +Y+FS+P+L+ LG++  ++S 
Sbjct  119  GQAYGAQQYEMLGIYMQRSVILLMLTGIPLTFVYIFSKPLLVLLGESDRVASA  171



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  239  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  418
            IE KLL  LAAPAV+VYMINYLMSMSTQIF GHLGNLELAAASLGNTGIQ+FAYGL+LGM
Sbjct  2    IESKLLFNLAAPAVIVYMINYLMSMSTQIFPGHLGNLELAAASLGNTGIQVFAYGLLLGM  61

Query  419  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            GSAVETLCGQA+GA KYE+LG+YLQRSTVLLTLT ++L L+YVFSEPIL+FLG++P I+S
Sbjct  62   GSAVETLCGQAYGARKYEMLGVYLQRSTVLLTLTSLVLTLLYVFSEPILLFLGESPAIAS  121



>gb|KDP20757.1| hypothetical protein JCGZ_21228 [Jatropha curcas]
Length=301

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            + E   S+ELE IL ++ IP +QR + ATW+ELK +  LAAPA VVY++N ++SMST I 
Sbjct  3    NNEKPVSSELEQILSNSEIPCFQRPRRATWLELKTVFSLAAPAAVVYLLNNVVSMSTLIL  62

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
             GHLGNL+LA+ASL N GIQ+FA+GL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST++
Sbjct  63   CGHLGNLQLASASLSNNGIQLFAFGLLLGMGSAVETLCGQAYGAQKYEMLGIYLQRSTIV  122

Query  509  ltltgvllalIYVFSEPILIFLGQAPDISS  598
            L  T + L LIY  S+PIL+ LG++ +I+S
Sbjct  123  LMATSIPLTLIYALSKPILVLLGESKEIAS  152



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF GHLGN
Sbjct  26   SSELEDTLNNTDFSYFQRLRTATWLEAKTLCRLAAPAVVVYLLNNVITLSTQIFCGHLGN  85

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  527  llalIYVFSEPILIFLGQ  580
             L +IY+FS+P+L+ LG+
Sbjct  146  PLMIIYIFSKPLLLALGE  163



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE IL +  + R +R+  ATW+ELK+L  LAAPA+VVYM+NYL+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRILRATWVELKILFPLAAPAIVVYMLNYLVSISTQMFCGHLGN  93

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            LELAAASLGN G+Q F +G+MLGMGSAVETLCGQA+GA KYE+LG+Y+QRST+LLTLTG+
Sbjct  94   LELAAASLGNMGVQGFVFGIMLGMGSAVETLCGQAYGANKYEMLGVYMQRSTILLTLTGL  153

Query  527  llalIYVFSEPILIFLGQAPDISSP  601
            +L  IY+F +PIL+ L ++P I+S 
Sbjct  154  ILMFIYIFCKPILLGLHESPTIASA  178



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS+ELE +L D+ +P +QRL+ A+WI+ +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIKFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQRST++L+LTG
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRSTIVLSLTG  142

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            + LA++Y+FS+ +L+ LG+A  ++S
Sbjct  143  IPLAVVYLFSKNLLLALGEAKPVAS  167



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
             S ELE  L +T +  +QRL+  TW+ELK+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  4    VSRELEDTLNNTELSYFQRLRTGTWLELKILFRLAAPAVVVYLLNNVISMSTQIFCGHLG  63

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIY+QRST+LL  T 
Sbjct  64   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYMQRSTILLLATS  123

Query  524  vllalIYVFSEPILIFLGQ  580
            + L +IY+F + IL+ LG+
Sbjct  124  IPLMIIYIFCKQILLGLGE  142



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 132/175 (75%), Gaps = 3/175 (2%)
 Frame = +2

Query  80   MDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKL  253
            MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+WIELKL
Sbjct  1    MDSKESRGELQEPLVLSSTEPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASWIELKL  59

Query  254  LCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVE  433
            L  LAAPAV VY+IN  +S+ST+IFSGHLGNLE AA SL N+G+Q+F YGLMLGMGSAVE
Sbjct  60   LFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFAAVSLANSGVQLFVYGLMLGMGSAVE  119

Query  434  TLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            TLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG+   ++S
Sbjct  120  TLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLGEPTTVAS  174



>ref|XP_008371177.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
             S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF GHLG
Sbjct  24   VSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIFCGHLG  83

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG
Sbjct  84   NLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLXATG  143

Query  524  vllalIYVFSEPILIFLGQ  580
            + L + Y+FS+P+L+ LG+
Sbjct  144  IPLXIXYIFSKPLLLALGE  162



>ref|XP_008371097.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
             S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF GHLG
Sbjct  24   VSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIFCGHLG  83

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG
Sbjct  84   NLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLXATG  143

Query  524  vllalIYVFSEPILIFLGQ  580
            + L + Y+FS+P+L+ LG+
Sbjct  144  IPLXIXYIFSKPLLLALGE  162



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  167  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  346
            S+ELE +L D+ +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDSQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  347  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  526
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L+LTG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSLTGI  140

Query  527  llalIYVFSEPILIFLGQAPDISSP  601
             LA++Y+FS+ IL+ LG++  ++S 
Sbjct  141  PLAVVYLFSKNILLALGESKLVASA  165



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            + LA++Y+FS+ IL+ LG++  ++S
Sbjct  139  IPLAVVYLFSKNILLALGESKQVAS  163



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            + LA++Y+FS+ IL+ LG++  ++S
Sbjct  139  IPLAVVYLFSKNILLALGESKQVAS  163



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 120/160 (75%), Gaps = 5/160 (3%)
 Frame = +2

Query  116  PESDGVVSSP-----PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  280
            P SD  +S P            S ELE  L +T +  +QR +  TW+ELK L  LAAPAV
Sbjct  3    PSSDNELSEPLLLSKSSSMHIVSRELEDTLNNTELSYFQRFRTGTWLELKTLFRLAAPAV  62

Query  281  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  460
            VVY++N ++SMSTQIF GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  63   VVYLLNNVISMSTQIFCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  122

Query  461  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  580
             KY++LGIY+QRST+LL  T + L +IY+F + IL+ LG+
Sbjct  123  HKYDMLGIYMQRSTILLLATSIPLMIIYIFCKEILLGLGE  162



>emb|CDY33130.1| BnaCnng07010D [Brassica napus]
Length=308

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 128/176 (73%), Gaps = 19/176 (11%)
 Frame = +2

Query  80   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  250
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPFFHRLREATMIESK  59

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            LL  LAAPAV+VYMI               GNLELAAASLGNTGIQI AYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMI---------------GNLELAAASLGNTGIQISAYGLMLGMGSAV  104

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIYVFS+PIL+FLG++P+I+S
Sbjct  105  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYVFSKPILLFLGESPEIAS  160



>gb|EPS67796.1| hypothetical protein M569_06975, partial [Genlisea aurea]
Length=484

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  161  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  340
            E S+ LE +L +  + RW+RL+ AT IELK+LC LA PAVV Y++  ++SMSTQIF GH+
Sbjct  13   EISSHLEDVLSNAEMARWRRLQKATSIELKILCRLAGPAVVSYLLGNVISMSTQIFCGHV  72

Query  341  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  520
            GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+GA +YE+LGIY+QRS VLL  T
Sbjct  73   GNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYGAHRYEMLGIYMQRSAVLLMAT  132

Query  521  gvllalIYVFSEPILIFLGQAPDISS  598
            G+ + LIY FSEP+L+ LG++  ++S
Sbjct  133  GIPMMLIYAFSEPLLLLLGESERVAS  158



>gb|ABK24492.1| unknown [Picea sitchensis]
Length=513

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = +2

Query  161  EASNELESILMDTGIPRW-QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  337
            +  N LE IL +     W + ++ A ++E KLLC LA PAV+VYM+NY+MSM+TQIFSGH
Sbjct  20   DDKNRLEVILSNADDQPWIKMMRDAVFLESKLLCRLALPAVIVYMVNYIMSMATQIFSGH  79

Query  338  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  517
            LGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA  Y++LGIYLQRSTVLL  
Sbjct  80   LGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLCGQAYGAKNYDMLGIYLQRSTVLLMA  139

Query  518  tgvllalIYVFSEPILIFLGQAPDISS  598
              + L LIYVFS+P+L+ L ++  I+S
Sbjct  140  AAIPLTLIYVFSKPLLLLLRESEKIAS  166



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 123/157 (78%), Gaps = 3/157 (2%)
 Frame = +2

Query  137  SSPP---HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLM  307
            SSP    H   E ++ LE IL DT +P  +RL+LA+ IELKLL  LAAPAV VYMIN  M
Sbjct  14   SSPEPELHAHCEVNSRLEKILNDTQLPYLKRLRLASVIELKLLFRLAAPAVFVYMINNFM  73

Query  308  SMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIY  487
            S+ST++F+GHLGNLELAAA+LGN+GIQ+ AYG MLGMGSAVETLCGQA+GA + E+LGIY
Sbjct  74   SLSTRVFAGHLGNLELAAAALGNSGIQLLAYGFMLGMGSAVETLCGQAYGAHRNEMLGIY  133

Query  488  LQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            LQR+TV+LT+T + +  IY+ S+ IL+ LG+   ++S
Sbjct  134  LQRATVVLTITAIPMTAIYLVSKQILLLLGEPTSVAS  170



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  328
            H   E  + LE +L D+ +  ++RL+LA+ IEL+LL  LAAPAV VYMIN  MS+ST++F
Sbjct  34   HRGHEVDSRLEKVLTDSDLSFFKRLRLASGIELRLLFRLAAPAVFVYMINNAMSLSTRVF  93

Query  329  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  508
             GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++
Sbjct  94   CGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAYGALRYDMLGVYLQRSTIV  153

Query  509  ltltgvllalIYVFSEPILIFLGQA  583
            LTLTG+ L + YV SEPILI LG++
Sbjct  154  LTLTGIPLTVAYVLSEPILILLGES  178



>ref|XP_008364095.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Malus 
domestica]
Length=509

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +2

Query  56   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  214
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  215  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  394
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  395  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  574
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  575  GQAP  586
            G+ P
Sbjct  185  GEPP  188



>ref|XP_010533821.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010533822.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Tarenaya 
hassleriana]
Length=313

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            STV+L LTG+ + ++YV S+PIL FLG+  D++S
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVAS  166



>ref|XP_010533820.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Tarenaya 
hassleriana]
Length=315

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            STV+L LTG+ + ++YV S+PIL FLG+  D++S
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVAS  166



>ref|XP_010533819.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Tarenaya 
hassleriana]
Length=320

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            STV+L LTG+ + ++YV S+PIL FLG+  D++S
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVAS  166



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPAV VY+IN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAVAVYLINNAMSMSTRIFSGQLG  78

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            + LA++Y+FS+ IL+ LG++  ++S
Sbjct  139  IPLAVVYIFSKNILLALGESKLVAS  163



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +2

Query  56   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  214
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  215  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  394
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  395  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  574
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  575  GQAP  586
            G+ P
Sbjct  185  GEPP  188



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +2

Query  56   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  214
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  215  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  394
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  395  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  574
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  575  GQAP  586
            G+ P
Sbjct  185  GEPP  188



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +2

Query  56   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  214
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  215  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  394
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  395  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  574
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  575  GQAP  586
            G+ P
Sbjct  185  GEPP  188



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +2

Query  56   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  214
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  215  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  394
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  395  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  574
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  575  GQAP  586
            G+ P
Sbjct  185  GEPP  188



>ref|XP_010533818.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=328

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            STV+L LTG+ + ++YV S+PIL FLG+  D++S
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVAS  166



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +2

Query  56   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  214
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  215  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  394
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  395  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  574
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  575  GQAP  586
            G+ P
Sbjct  185  GEPP  188



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  224  KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYG  403
            ++ + ++++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYG
Sbjct  80   RVVSQVDMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYG  139

Query  404  LMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQA  583
            LMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV LA++Y FS PIL+ LG++
Sbjct  140  LMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPLAVLYAFSRPILVLLGES  199

Query  584  PDISS  598
            P+I+S
Sbjct  200  PEIAS  204



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  164  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  343
            AS+ELE +L D+ +P +QRL+ A+WIE +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIEFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  344  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  523
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+ A ++E+LG+YLQRSTV+L+LTG
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYXAHRHEMLGVYLQRSTVVLSLTG  142

Query  524  vllalIYVFSEPILIFLGQAPDISS  598
            + LA++Y+FS+ +L+ LG+A  ++S
Sbjct  143  IPLAVVYLFSKNLLLALGEAKPVAS  167



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = +2

Query  80   MDSSNGAAYDPLPESDGVVSSPPHEESE-----ASNELESILMDTGIPRWQRLKLATWIE  244
            M +SNG   D   + D       HE         S+ELE IL +  + R +R+  AT++E
Sbjct  1    MGTSNGCRID-YADLDESYQPILHERRSFSGETVSSELEEILSNMELSRSRRILRATFLE  59

Query  245  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGS  424
            LK+L  LAAPA+VVY++N+L+S+STQIF GHLGNL+LA ASLG TGIQ+F +G+MLGMGS
Sbjct  60   LKILFPLAAPAIVVYLLNFLISISTQIFCGHLGNLQLAGASLGTTGIQVFIFGIMLGMGS  119

Query  425  AVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSP  601
            AVETLCGQA+GA KYE+LGIY+QRST+LLTL+G++L  IY+F +PIL+ L ++P I+S 
Sbjct  120  AVETLCGQAYGAHKYEMLGIYMQRSTILLTLSGLVLMFIYIFCKPILLGLHESPSIASA  178



>gb|EMT19998.1| hypothetical protein F775_52364 [Aegilops tauschii]
Length=957

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  230  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  409
            AT +E+++L  LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLM
Sbjct  4    ATAVEMRMLVRLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLM  63

Query  410  LGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPD  589
            LGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  TG+ LA++Y FS PILI LG++P+
Sbjct  64   LGMGSAVETLCGQAYGANKFDMLGIYMQRSTVLLMATGIPLAVLYAFSRPILILLGESPE  123

Query  590  ISS  598
            I+S
Sbjct  124  IAS  126



>ref|XP_010533817.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
Length=351

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = +2

Query  137  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            STV+L LTG+ + ++YV S+PIL FLG+  D++S
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVAS  166



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  SPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMST  319
            + P    E S  LE IL D   P  +R+  A  +E++LL  +AAPA+VVY++N ++S+ST
Sbjct  6    ASPSSSHELSRRLEGILRDGEAPWARRVCKAAVVEVRLLMPIAAPAIVVYVLNNVLSIST  65

Query  320  QIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  499
            QIF GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LG+Y+QRS
Sbjct  66   QIFCGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYMQRS  125

Query  500  tvlltltgvllalIYVFSEPILIFLGQAPDIS  595
            TVLL  TGV LA++Y FS PIL+ LG++P+I+
Sbjct  126  TVLLMATGVPLAVLYAFSRPILVLLGESPEIA  157



>ref|XP_009361291.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
 ref|XP_009361361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +2

Query  170  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  349
            +ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF GHLGNL
Sbjct  27   SELEDTLNNTDFSYFQRLRTATWLETKTLCRLAAPAVVVYLLNNVITLSTQIFCGHLGNL  86

Query  350  ELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvl  529
            ELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+GA KYE+LGIY+Q ST LL  TG+ 
Sbjct  87   ELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQISTTLLVATGIP  146

Query  530  lalIYVFSEPILIFLGQ  580
            L +IY+FS+P+L+ LG+
Sbjct  147  LTIIYIFSKPLLLALGE  163



>ref|XP_009614258.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=432

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +2

Query  107  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  286
            +PL E    V +  H     S+ELE+IL DT +  +++L  A+ +ELK L  LAAP+++V
Sbjct  12   EPLLEPKEPVVAVEH----VSSELENILSDTSLSNFEQLGRASVVELKNLFRLAAPSIIV  67

Query  287  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  466
            Y++N + SMSTQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA K
Sbjct  68   YLLNNITSMSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHK  127

Query  467  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            YE LGIYLQRST+LL L+G+ + + Y+FS+PILI LG++  ++S
Sbjct  128  YESLGIYLQRSTILLMLSGIPIMVAYLFSKPILILLGESEKVAS  171



>ref|XP_009362007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=444

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +2

Query  56   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  214
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  215  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  394
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  395  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  499
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_011037659.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 131/176 (74%), Gaps = 5/176 (3%)
 Frame = +2

Query  71   NSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  250
            +S ++ +    Y+P+       S  P      S+ELE IL     PR QR+  AT +ELK
Sbjct  7    DSRIEYAEDEPYEPILHDKRSFSGEP-----VSSELEEILSVMEFPRSQRILRATRLELK  61

Query  251  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  430
            +L  LAAPA+VVY++N+L+S+ST +F GHLGNL+LAAASLGNTG+Q F YG++ GMGSAV
Sbjct  62   ILSRLAAPAIVVYLLNFLISISTHVFCGHLGNLQLAAASLGNTGVQGFVYGIVFGMGSAV  121

Query  431  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ETLCGQA+GA +YE+LGIY+QRST+LLTL+G++L  IY+F +PIL+ L ++P I+S
Sbjct  122  ETLCGQAYGARRYEMLGIYMQRSTILLTLSGLVLMFIYIFCKPILLGLHESPSIAS  177



>ref|XP_004232715.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 124/159 (78%), Gaps = 5/159 (3%)
 Frame = +2

Query  137  SSPPHEESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  301
            S P  EE EA     S+ELE IL+D  +  +QRL+ A+ +E   L  LAAPA++VY++N 
Sbjct  8    SEPLIEEKEATVEHVSSELEDILLDARLSHFQRLRRASAVEFSNLFRLAAPAIIVYLLNN  67

Query  302  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  481
            + S+STQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA KYE LG
Sbjct  68   VTSVSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHKYETLG  127

Query  482  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            IYLQRST+LL L+G+ + + Y++S+PILI LG++  ++S
Sbjct  128  IYLQRSTILLMLSGIPIMVAYLYSKPILILLGESEKVAS  166



>ref|XP_006348111.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=509

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 122/154 (79%), Gaps = 5/154 (3%)
 Frame = +2

Query  152  EESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  316
            E+ EA     S+ELE IL DT +  +QRL  A+ +E + L  LAAPA++VY++N + SMS
Sbjct  18   EQKEAAVEHVSSELEDILSDTRLSHFQRLGRASAVEFRNLFRLAAPAIIVYLLNNVTSMS  77

Query  317  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  496
            TQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA KYE LGIYLQR
Sbjct  78   TQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHKYETLGIYLQR  137

Query  497  StvlltltgvllalIYVFSEPILIFLGQAPDISS  598
            ST+LL L+G+ + + Y+FS+PILI LG++  ++S
Sbjct  138  STILLMLSGIPIMVAYLFSKPILILLGESEKVAS  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520