BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050P01

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                265   1e-84   Nicotiana sylvestris
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                262   1e-83   Solanum lycopersicum
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           262   1e-83   Nicotiana sylvestris
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           261   4e-83   Nicotiana tomentosiformis
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           259   9e-83   Solanum tuberosum [potatoes]
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                259   1e-82   Nicotiana tomentosiformis
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           259   1e-82   Nicotiana sylvestris
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           258   6e-82   Nicotiana tomentosiformis
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           256   2e-81   Solanum tuberosum [potatoes]
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                256   4e-81   Pyrus x bretschneideri [bai li]
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            254   6e-81   
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         254   8e-81   Prunus mume [ume]
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             254   1e-80   Prunus persica
ref|NP_001274803.1|  uncharacterized protein LOC102577675               254   1e-80   Solanum tuberosum [potatoes]
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           254   1e-80   
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                254   2e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           254   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    254   2e-80   Elaeis guineensis
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     254   2e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006447906.1|  hypothetical protein CICLE_v10016107mg             250   3e-80   
ref|XP_006447904.1|  hypothetical protein CICLE_v10016107mg             252   3e-80   
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                253   3e-80   Prunus mume [ume]
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   4e-80   Malus domestica [apple tree]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                253   4e-80   Sesamum indicum [beniseed]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           253   4e-80   
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   5e-80   Pyrus x bretschneideri [bai li]
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                253   5e-80   Malus domestica [apple tree]
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   5e-80   Pyrus x bretschneideri [bai li]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                253   6e-80   Solanum lycopersicum
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    253   6e-80   
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    252   8e-80   Glycine max [soybeans]
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           252   1e-79   
gb|KHN15970.1|  60S ribosomal protein L5                                251   1e-79   Glycine soja [wild soybean]
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    252   1e-79   
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           251   1e-79   
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     251   2e-79   
gb|KHN36792.1|  60S ribosomal protein L5                                251   2e-79   Glycine soja [wild soybean]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           251   2e-79   Glycine max [soybeans]
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                251   2e-79   
gb|KDO51034.1|  hypothetical protein CISIN_1g022424mg                   248   2e-79   Citrus sinensis [apfelsine]
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           251   2e-79   Glycine max [soybeans]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             251   3e-79   Phaseolus vulgaris [French bean]
gb|ADR71225.1|  60S ribosomal protein L5A                               250   3e-79   Hevea brasiliensis [jebe]
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           251   4e-79   Phoenix dactylifera
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             250   4e-79   Citrus clementina [clementine]
gb|AFK36106.1|  unknown                                                 250   4e-79   Lotus japonicus
gb|AFK34395.1|  unknown                                                 250   5e-79   Lotus japonicus
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           250   5e-79   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP17898.1|  unnamed protein product                                252   5e-79   Coffea canephora [robusta coffee]
gb|AFK46994.1|  unknown                                                 250   5e-79   Lotus japonicus
gb|KJB71615.1|  hypothetical protein B456_011G133700                    249   5e-79   Gossypium raimondii
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                250   5e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                250   6e-79   Populus euphratica
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           249   7e-79   Glycine max [soybeans]
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           251   7e-79   Glycine max [soybeans]
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             249   7e-79   Phaseolus vulgaris [French bean]
gb|AHA84189.1|  60S ribosomal protein L5                                249   9e-79   Phaseolus vulgaris [French bean]
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             249   1e-78   Populus trichocarpa [western balsam poplar]
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           249   1e-78   Sesamum indicum [beniseed]
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  248   1e-78   Citrus sinensis [apfelsine]
gb|AFK41626.1|  unknown                                                 246   1e-78   Lotus japonicus
gb|KJB71614.1|  hypothetical protein B456_011G133700                    249   1e-78   Gossypium raimondii
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             249   1e-78   Phaseolus vulgaris [French bean]
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   249   1e-78   Phaseolus vulgaris [French bean]
ref|XP_002524859.1|  ribosomal protein L5, putative                     249   1e-78   Ricinus communis
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           249   1e-78   Cicer arietinum [garbanzo]
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   249   2e-78   Phaseolus vulgaris [French bean]
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  248   2e-78   Citrus sinensis [apfelsine]
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                248   2e-78   Fragaria vesca subsp. vesca
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           248   2e-78   Citrus sinensis [apfelsine]
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   247   3e-78   Citrus sinensis [apfelsine]
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           248   3e-78   Populus euphratica
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           248   3e-78   Citrus sinensis [apfelsine]
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           248   3e-78   Fragaria vesca subsp. vesca
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   248   3e-78   Citrus sinensis [apfelsine]
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                248   3e-78   Eucalyptus grandis [rose gum]
gb|ADR71226.1|  60S ribosomal protein L5B                               248   3e-78   Hevea brasiliensis [jebe]
gb|ACU23594.1|  unknown                                                 248   3e-78   Glycine max [soybeans]
gb|ABK95722.1|  unknown                                                 248   5e-78   Populus trichocarpa [western balsam poplar]
gb|ABK93902.1|  unknown                                                 248   5e-78   Populus trichocarpa [western balsam poplar]
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           248   5e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              247   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          247   1e-77   Sorghum bicolor [broomcorn]
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           246   1e-77   Phoenix dactylifera
emb|CBI24704.3|  unnamed protein product                                247   2e-77   Vitis vinifera
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                246   2e-77   Vitis vinifera
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           246   2e-77   Sesamum indicum [beniseed]
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             249   2e-77   
ref|XP_002524558.1|  ribosomal protein L5, putative                     246   2e-77   Ricinus communis
gb|ACJ85054.1|  unknown                                                 246   2e-77   Medicago truncatula
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           246   3e-77   Cucumis melo [Oriental melon]
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                246   3e-77   Cucumis melo [Oriental melon]
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           246   3e-77   Tarenaya hassleriana [spider flower]
gb|KJB84072.1|  hypothetical protein B456_N001600                       245   4e-77   Gossypium raimondii
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         245   4e-77   Jatropha curcas
gb|KDO51035.1|  hypothetical protein CISIN_1g022424mg                   243   4e-77   Citrus sinensis [apfelsine]
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           245   6e-77   Cucumis sativus [cucumbers]
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     247   7e-77   Eucalyptus grandis [rose gum]
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    244   8e-77   Phoenix dactylifera
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   246   8e-77   
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         244   9e-77   Tarenaya hassleriana [spider flower]
gb|KJB22671.1|  hypothetical protein B456_004G060400                    241   1e-76   Gossypium raimondii
gb|KJB22672.1|  hypothetical protein B456_004G060400                    241   1e-76   Gossypium raimondii
ref|NP_001267659.1|  60S ribosomal protein L5                           244   1e-76   Cucumis sativus [cucumbers]
gb|AFK41086.1|  unknown                                                 244   1e-76   Medicago truncatula
emb|CDP18434.1|  unnamed protein product                                245   1e-76   Coffea canephora [robusta coffee]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         244   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           243   2e-76   Cicer arietinum [garbanzo]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   243   2e-76   
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                244   2e-76   Erythranthe guttata [common monkey flower]
gb|ABK93596.1|  unknown                                                 243   2e-76   Populus trichocarpa [western balsam poplar]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          243   2e-76   
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             243   2e-76   Populus trichocarpa [western balsam poplar]
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         243   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   243   4e-76   
gb|KJB27799.1|  hypothetical protein B456_005G010200                    243   4e-76   Gossypium raimondii
gb|AFW84310.1|  hypothetical protein ZEAMMB73_937605                    240   4e-76   
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           243   4e-76   Populus euphratica
gb|KJB27798.1|  hypothetical protein B456_005G010200                    243   5e-76   Gossypium raimondii
gb|KJB22668.1|  hypothetical protein B456_004G060400                    242   6e-76   Gossypium raimondii
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    242   7e-76   
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               242   8e-76   Erythranthe guttata [common monkey flower]
gb|EPS64989.1|  hypothetical protein M569_09790                         238   1e-75   Genlisea aurea
emb|CDY52294.1|  BnaA03g57870D                                          242   2e-75   Brassica napus [oilseed rape]
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    240   2e-75   
gb|KHN27258.1|  60S ribosomal protein L5                                241   2e-75   Glycine soja [wild soybean]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         241   2e-75   Setaria italica
gb|KJB22673.1|  hypothetical protein B456_004G060400                    237   2e-75   Gossypium raimondii
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     241   2e-75   Eucalyptus grandis [rose gum]
gb|KJB22670.1|  hypothetical protein B456_004G060400                    236   2e-75   Gossypium raimondii
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     241   3e-75   Eucalyptus grandis [rose gum]
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         239   3e-75   Camelina sativa [gold-of-pleasure]
gb|AFK39593.1|  unknown                                                 240   3e-75   Lotus japonicus
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         240   4e-75   Brachypodium distachyon [annual false brome]
gb|ACR38045.1|  unknown                                                 240   5e-75   Zea mays [maize]
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           240   5e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         240   5e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             240   7e-75   
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              239   7e-75   Zea mays [maize]
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         239   8e-75   Brassica rapa
gb|KJB10809.1|  hypothetical protein B456_001G226000                    237   8e-75   Gossypium raimondii
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              239   8e-75   
ref|NP_001151284.1|  60S ribosomal protein L5-1                         239   1e-74   Zea mays [maize]
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         239   1e-74   Zea mays [maize]
ref|NP_198790.1|  60S ribosomal protein L5-2                            239   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         239   2e-74   Brachypodium distachyon [annual false brome]
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              238   2e-74   Brachypodium distachyon [annual false brome]
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         238   2e-74   
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    238   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             238   2e-74   Arabidopsis lyrata subsp. lyrata
gb|AEV92989.1|  60S ribosomal protein L5                                238   2e-74   Triticum aestivum [Canadian hard winter wheat]
gb|ACG36552.1|  60S ribosomal protein L5-1                              238   2e-74   Zea mays [maize]
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   238   2e-74   
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    238   2e-74   Arabis alpina [alpine rockcress]
ref|NP_566767.1|  60S ribosomal protein L5-1                            238   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64753.1|  ribosomal protein, putative                             238   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    238   3e-74   Arabis alpina [alpine rockcress]
dbj|BAJ89012.1|  predicted protein                                      238   3e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB10810.1|  hypothetical protein B456_001G226000                    238   3e-74   Gossypium raimondii
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         238   4e-74   Jatropha curcas
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             238   4e-74   Eutrema salsugineum [saltwater cress]
emb|CDY50258.1|  BnaC07g47930D                                          238   4e-74   Brassica napus [oilseed rape]
emb|CDY15088.1|  BnaC03g44490D                                          238   6e-74   Brassica napus [oilseed rape]
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           239   6e-74   
emb|CDY15089.1|  BnaC03g44500D                                          238   7e-74   Brassica napus [oilseed rape]
emb|CDY27889.1|  BnaA07g04790D                                          237   8e-74   Brassica napus [oilseed rape]
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             236   1e-73   Capsella rubella
emb|CDY52293.1|  BnaA03g57860D                                          237   1e-73   Brassica napus [oilseed rape]
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             236   1e-73   Capsella rubella
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         236   1e-73   Brassica rapa
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         236   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         236   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    236   2e-73   Brassica rapa
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             234   5e-73   Capsella rubella
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         234   7e-73   Camelina sativa [gold-of-pleasure]
gb|ABK21084.1|  unknown                                                 234   9e-73   Picea sitchensis
gb|KJB84073.1|  hypothetical protein B456_N001600                       234   9e-73   Gossypium raimondii
emb|CDX86312.1|  BnaA06g30290D                                          234   1e-72   
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          232   4e-72   
dbj|BAD82173.1|  putative ribosomal protein L5                          232   5e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             232   7e-72   
ref|NP_001045083.1|  Os01g0896800                                       232   7e-72   
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        232   8e-72   Oryza sativa Indica Group [Indian rice]
gb|EPS61271.1|  hypothetical protein M569_13526                         229   1e-71   Genlisea aurea
emb|CDX85331.1|  BnaC07g26420D                                          234   1e-71   
gb|KJB22669.1|  hypothetical protein B456_004G060400                    231   1e-71   Gossypium raimondii
ref|XP_010101365.1|  60S ribosomal protein L5                           231   1e-71   
ref|XP_002876523.1|  predicted protein                                  230   3e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             230   3e-71   Eutrema salsugineum [saltwater cress]
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         230   3e-71   Oryza brachyantha
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    230   3e-71   
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    230   3e-71   Oryza brachyantha
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    230   4e-71   
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           230   1e-70   Elaeis guineensis
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                228   1e-70   Elaeis guineensis
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                228   4e-70   Nelumbo nucifera [Indian lotus]
gb|EMT23062.1|  60S ribosomal protein L5-2                              227   4e-70   
gb|AES74307.2|  60S ribosomal protein L5-2                              227   4e-70   Medicago truncatula
gb|EMT04099.1|  60S ribosomal protein L5-2                              227   7e-70   
gb|EMT20601.1|  60S ribosomal protein L5-2                              226   9e-70   
ref|XP_003604056.1|  60S ribosomal protein L5                           227   1e-69   
ref|XP_001783620.1|  predicted protein                                  225   3e-69   
gb|EMS59984.1|  60S ribosomal protein L5-2                              225   4e-69   Triticum urartu
ref|XP_001783411.1|  predicted protein                                  224   5e-69   
ref|XP_001767871.1|  predicted protein                                  224   6e-69   
ref|XP_001759628.1|  predicted protein                                  224   9e-69   
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        221   1e-67   
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      220   2e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             219   7e-67   
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             217   3e-66   Selaginella moellendorffii
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             217   3e-66   Selaginella moellendorffii
ref|XP_004310188.1|  PREDICTED: 60S ribosomal protein L5-2-like         204   1e-62   Fragaria vesca subsp. vesca
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           199   3e-59   Suberites domuncula
gb|ERG79917.1|  60s ribosomal protein l5                                191   1e-56   
gb|EPZ34992.1|  60S ribosomal protein L5                                191   3e-56   Rozella allomycis CSF55
gb|ABB29646.1|  ribosomal protein 5 large subunit                       186   6e-56   Suberites ficus
ref|XP_005536050.1|  60S ribosomal protein L5                           191   7e-56   Cyanidioschyzon merolae strain 10D
gb|KDD76608.1|  ribosomal L18p/L5e                                      189   2e-55   Helicosporidium sp. ATCC 50920
gb|KIY93440.1|  60S ribosomal protein L5                                186   4e-55   Monoraphidium neglectum
gb|AGH70151.1|  60S ribosomal protein L5                                185   7e-55   Placozoa sp. H4
gb|EJW84695.1|  60S ribosomal protein L5                                187   2e-54   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_001897856.1|  60S ribosomal protein L5                           186   2e-54   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003391604.1|  PREDICTED: 60S ribosomal protein L5-like           182   3e-54   Amphimedon queenslandica
ref|NP_001104213.1|  uncharacterized protein LOC100126642               186   7e-54   Xenopus laevis [clawed frog]
ref|XP_002736904.1|  PREDICTED: 60S ribosomal protein L5-like           185   8e-54   Saccoglossus kowalevskii
ref|XP_003145913.1|  60S ribosomal protein L5                           185   9e-54   Loa loa
ref|XP_008049787.1|  PREDICTED: 60S ribosomal protein L5                182   1e-53   Carlito syrichta
ref|XP_005717676.1|  unnamed protein product                            185   1e-53   Chondrus crispus [carageen]
ref|XP_001689859.1|  ribosomal protein L5, component of cytosolic...    185   1e-53   Chlamydomonas reinhardtii
ref|XP_005643753.1|  60S ribosomal protein L5                           184   2e-53   Coccomyxa subellipsoidea C-169
tpg|DAA34076.1|  TPA: 60S ribosomal protein L5                          182   2e-53   Amblyomma variegatum
ref|XP_002109848.1|  expressed hypothetical protein                     184   3e-53   Trichoplax adhaerens
gb|ACZ13335.1|  60S ribosomal protein L5                                184   3e-53   Bursaphelenchus xylophilus [pine wilt nematode]
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                      183   4e-53   Caenorhabditis brenneri
sp|Q627R7.2|RL5_CAEBR  RecName: Full=60S ribosomal protein L5           183   4e-53   Caenorhabditis briggsae
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 183   4e-53   Ixodes scapularis [blacklegged tick]
gb|ABO26701.1|  ribosomal protein l5                                    182   5e-53   Haliotis discus discus
ref|XP_002630158.1|  C. briggsae CBR-RPL-5 protein                      183   5e-53   Caenorhabditis briggsae
ref|XP_004337717.1|  ribosomal L18p/L5e family                          183   6e-53   Acanthamoeba castellanii str. Neff
ref|XP_001634531.1|  predicted protein                                  183   6e-53   Nematostella vectensis
ref|NP_495811.1|  Protein RPL-5                                         183   6e-53   Caenorhabditis elegans [roundworm]
ref|XP_006197385.1|  PREDICTED: 60S ribosomal protein L5                183   6e-53   Vicugna pacos
ref|XP_005706768.1|  60S ribosomal protein L5e                          183   6e-53   Galdieria sulphuraria
gb|ACN25149.1|  ribosomal-like protein                                  182   8e-53   Pectinaria gouldii
gb|AAM33437.1|  ribosomal protein L5                                    180   8e-53   Branchiostoma belcheri tsingtauense
ref|XP_002588187.1|  hypothetical protein BRAFLDRAFT_113823             183   9e-53   Branchiostoma floridae
ref|XP_010948703.1|  PREDICTED: 60S ribosomal protein L5                183   1e-52   Camelus bactrianus [camel]
gb|KHJ46023.1|  ribosomal L18p/L5e family protein                       182   1e-52   Trichuris suis
gb|ADV40159.1|  putative 60S ribosomal protein L5                       181   1e-52   Latrodectus hesperus [black widow]
ref|XP_003505203.1|  PREDICTED: 60S ribosomal protein L5                182   1e-52   Cricetulus griseus [Chinese hamsters]
ref|XP_008070593.1|  PREDICTED: 60S ribosomal protein L5                182   1e-52   Carlito syrichta
dbj|BAB33422.1|  putative senescence-associated protein                 181   1e-52   Pisum sativum [garden pea]
ref|XP_002949803.1|  component of cytosolic 80S ribosome and 60S ...    182   1e-52   Volvox carteri f. nagariensis
ref|XP_007611466.1|  PREDICTED: 60S ribosomal protein L5                182   2e-52   
ref|XP_006985881.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     182   2e-52   Peromyscus maniculatus bairdii
ref|XP_006985882.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     182   2e-52   Peromyscus maniculatus bairdii
gb|ERE68201.1|  60S ribosomal protein L5-like protein                   183   2e-52   Cricetulus griseus [Chinese hamsters]
ref|XP_005385097.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     182   2e-52   Chinchilla lanigera
ref|XP_004625113.1|  PREDICTED: 60S ribosomal protein L5-like           182   2e-52   Octodon degus
ref|XP_005385096.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     182   2e-52   Chinchilla lanigera
ref|XP_003479207.1|  PREDICTED: 60S ribosomal protein L5                182   2e-52   Cavia porcellus [guinea pig]
ref|XP_005542773.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     182   2e-52   
ref|XP_001515074.2|  PREDICTED: 60S ribosomal protein L5                182   2e-52   Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001107756.1|  60S ribosomal protein L5                           182   2e-52   Sus scrofa [pigs]
gb|AAI09371.1|  Ribosomal protein L5                                    181   2e-52   Homo sapiens [man]
gb|EHH14955.1|  hypothetical protein EGK_00972                          181   2e-52   Macaca mulatta [rhesus macaque]
ref|XP_004884145.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   
ref|XP_007533339.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   Erinaceus europaeus [common hedgehog]
ref|XP_003418527.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   Loxodonta africana [African bush elephant]
ref|XP_005542775.1|  PREDICTED: 60S ribosomal protein L5 isoform X3     181   2e-52   Macaca fascicularis [crab eating macaque]
ref|XP_007169652.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   
ref|XP_007934240.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   Orycteropus afer afer
ref|XP_005610315.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   Equus caballus [domestic horse]
ref|XP_008262168.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     181   2e-52   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006093256.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   Myotis lucifugus
ref|XP_004884144.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     181   2e-52   
ref|XP_004620003.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   Sorex araneus [Eurasian shrew]
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       182   2e-52   Necator americanus
ref|XP_010643206.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     181   2e-52   Fukomys damarensis [Damara mole rat]
ref|NP_001182608.1|  60S ribosomal protein L5                           181   2e-52   
ref|XP_007480367.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     181   2e-52   
ref|NP_000960.2|  60S ribosomal protein L5                              181   2e-52   
ref|XP_005610314.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     181   2e-52   
dbj|BAD96324.1|  ribosomal protein L5 variant                           181   2e-52   
ref|XP_007480368.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   
ref|XP_007169651.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     181   2e-52   
ref|XP_004319592.1|  PREDICTED: 60S ribosomal protein L5-like           181   2e-52   
ref|XP_004018480.1|  PREDICTED: 60S ribosomal protein L5-like           181   2e-52   
emb|CDS19989.1|  ribosomal protein l5                                   181   2e-52   
ref|XP_006728911.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   
pdb|4W20|D  Chain D, Structure Of The Mammalian 60s Ribosomal Sub...    181   2e-52   
ref|XP_003117386.1|  CRE-RPL-5 protein                                  181   2e-52   
ref|XP_007110786.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   
ref|XP_006140244.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   
ref|XP_005983309.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   
ref|XP_004699318.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   
ref|XP_004402579.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   
ref|XP_006758248.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   
ref|XP_004378798.1|  PREDICTED: 60S ribosomal protein L5                181   2e-52   
ref|XP_010643208.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     181   2e-52   
emb|CDI98331.1|  ribosomal protein l5                                   181   3e-52   
ref|XP_005879039.1|  PREDICTED: 60S ribosomal protein L5                181   3e-52   
gb|ELW72620.1|  60S ribosomal protein L5                                181   3e-52   
dbj|BAD92217.1|  ribosomal protein L5 variant                           181   3e-52   
ref|NP_989912.1|  60S ribosomal protein L5                              181   3e-52   
ref|XP_010596404.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     181   3e-52   
gb|AAX46329.1|  ribosomal protein L5                                    181   3e-52   
ref|XP_008578547.1|  PREDICTED: 60S ribosomal protein L5                181   3e-52   
gb|KFD48731.1|  hypothetical protein M513_10361                         182   3e-52   
gb|KFM66007.1|  60S ribosomal protein L5-A                              180   3e-52   
sp|Q26481.3|RL5_STYCL  RecName: Full=60S ribosomal protein L5           181   3e-52   
ref|XP_003220130.1|  PREDICTED: 60S ribosomal protein L5                181   3e-52   
ref|XP_001421418.1|  Ribosomal protein L5A, component of cytosoli...    181   3e-52   
ref|XP_005153981.1|  PREDICTED: 60S ribosomal protein L5                181   3e-52   
ref|XP_009908172.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     181   3e-52   
ref|XP_005077452.1|  PREDICTED: 60S ribosomal protein L5                181   4e-52   
ref|XP_006265613.1|  PREDICTED: 60S ribosomal protein L5                181   4e-52   
ref|XP_005107604.1|  PREDICTED: 60S ribosomal protein L5-like           181   4e-52   
ref|XP_010973953.1|  PREDICTED: 60S ribosomal protein L5                183   4e-52   
ref|NP_001079437.1|  60S ribosomal protein L5-B                         181   4e-52   
sp|P15125.2|RL5A_XENLA  RecName: Full=60S ribosomal protein L5-A        181   5e-52   
sp|P15126.2|RL5B_XENLA  RecName: Full=60S ribosomal protein L5-B        181   5e-52   
ref|XP_007437567.1|  PREDICTED: 60S ribosomal protein L5                181   6e-52   
gb|ACO09732.1|  60S ribosomal protein L5                                177   6e-52   
ref|XP_008578545.1|  PREDICTED: 60S ribosomal protein L5                180   6e-52   
tpg|DAA23524.1|  TPA: ribosomal protein L5-like                         180   6e-52   
ref|XP_004002245.1|  PREDICTED: 60S ribosomal protein L5                180   6e-52   
gb|EPY76441.1|  60S ribosomal protein L5                                181   7e-52   
ref|XP_006001656.1|  PREDICTED: 60S ribosomal protein L5                180   7e-52   
emb|CBX33183.1|  ribosomal protein L5                                   180   7e-52   
ref|NP_001187210.1|  ribosomal protein L5b                              180   8e-52   
ref|XP_007233671.1|  PREDICTED: 60S ribosomal protein L5-like           180   8e-52   
ref|NP_112361.1|  60S ribosomal protein L5                              180   8e-52   
ref|XP_009288765.1|  PREDICTED: 60S ribosomal protein L5                182   8e-52   
ref|XP_002675028.1|  predicted protein                                  180   8e-52   
emb|CCQ18634.1|  60S ribosomal protein L5                               180   8e-52   
ref|XP_006882544.1|  PREDICTED: 60S ribosomal protein L5                180   9e-52   
ref|XP_005298201.1|  PREDICTED: 60S ribosomal protein L5                180   9e-52   
emb|CBI38286.3|  unnamed protein product                                176   9e-52   
gb|ACD65156.1|  putative 60S ribosomal protein RPL5                     178   9e-52   
ref|NP_001270867.1|  60S ribosomal protein L5                           180   9e-52   
ref|XP_004417183.1|  PREDICTED: 60S ribosomal protein L5-like           180   9e-52   
ref|XP_004349238.1|  ribosomal protein L5                               180   9e-52   
ref|XP_006250647.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     180   9e-52   
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              180   9e-52   
ref|XP_011399144.1|  60S ribosomal protein L5-1                         180   1e-51   
gb|ACD65111.1|  putative 60S ribosomal protein RPL5                     177   1e-51   
ref|XP_007058944.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     180   1e-51   
ref|XP_005346907.1|  PREDICTED: 60S ribosomal protein L5-like           179   1e-51   
ref|XP_009273931.1|  PREDICTED: 60S ribosomal protein L5                179   1e-51   
ref|XP_009680869.1|  PREDICTED: 60S ribosomal protein L5                181   1e-51   
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  178   1e-51   
gb|ACO09827.1|  60S ribosomal protein L5                                179   1e-51   
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   179   1e-51   
ref|XP_005592505.1|  PREDICTED: 60S ribosomal protein L5-like           179   1e-51   
ref|XP_011283311.1|  PREDICTED: 60S ribosomal protein L5                181   1e-51   
pdb|2ZKR|NN  Chain n, Structure Of A Mammalian Ribosomal 60s Subu...    179   1e-51   
ref|NP_001291805.1|  ribosomal protein L5                               179   2e-51   
ref|XP_001639289.1|  predicted protein                                  179   2e-51   
ref|XP_003973919.1|  PREDICTED: 60S ribosomal protein L5-like           181   2e-51   
gb|AFM87418.1|  60S ribosomal protein L5-B                              179   2e-51   
gb|KHG14330.1|  60S ribosomal L5                                        178   2e-51   
ref|XP_005422184.1|  PREDICTED: 60S ribosomal protein L5                179   2e-51   
ref|XP_005482139.1|  PREDICTED: 60S ribosomal protein L5                179   2e-51   
gb|ELR57120.1|  60S ribosomal protein L5                                179   2e-51   
ref|NP_001279040.1|  ribosomal protein L5                               179   2e-51   
ref|XP_006727091.1|  PREDICTED: 60S ribosomal protein L5-like           177   2e-51   
gb|AFM86790.1|  60S ribosomal protein L5-A                              179   2e-51   
ref|XP_008628716.1|  PREDICTED: 60S ribosomal protein L5                179   2e-51   
ref|XP_009087107.1|  PREDICTED: 60S ribosomal protein L5                179   2e-51   
ref|XP_002751148.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     179   2e-51   
gb|KDO24705.1|  hypothetical protein SPRG_10239                         179   2e-51   
gb|AFM88682.1|  ribosomal protein L5                                    179   2e-51   
gb|AFM87698.1|  60S ribosomal protein L5-A                              179   2e-51   
gb|EOA96368.1|  60S ribosomal protein L5                                179   2e-51   
gb|AFM88396.1|  ribosomal protein L5                                    179   2e-51   
emb|CAD91421.1|  ribosomal protein L5                                   178   2e-51   
ref|XP_008334234.1|  PREDICTED: 60S ribosomal protein L5                180   2e-51   
ref|XP_006093255.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     179   2e-51   
gb|AFM87650.1|  60S ribosomal protein L5-like protein                   179   2e-51   
gb|KFV85217.1|  60S ribosomal protein L5                                179   2e-51   
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                     179   2e-51   
ref|XP_010159869.1|  PREDICTED: 60S ribosomal protein L5                179   2e-51   
ref|XP_005521032.1|  PREDICTED: 60S ribosomal protein L5                179   2e-51   
gb|ABX44805.1|  putative 60S ribosomal protein RP5L                     175   2e-51   
gb|ACO07680.1|  60S ribosomal protein L5                                179   2e-51   
ref|NP_001232619.1|  putative ribosomal protein L5                      179   2e-51   
gb|AFM88337.1|  ribosomal protein L5                                    179   2e-51   
dbj|BAJ07363.1|  Tt5 protein                                            174   2e-51   
gb|ABI26260.1|  ribosomal protein L5                                    179   2e-51   
gb|KFO07226.1|  60S ribosomal protein L5                                179   2e-51   
ref|XP_004206528.1|  PREDICTED: 60S ribosomal protein L5-like           179   2e-51   
ref|XP_010196863.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
gb|AFM86481.1|  ribosomal protein L5                                    179   3e-51   
ref|XP_011442103.1|  PREDICTED: 60S ribosomal protein L5-like           175   3e-51   
ref|XP_010713879.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|XP_007073490.1|  PREDICTED: 60S ribosomal protein L5-like           182   3e-51   
ref|XP_003767272.1|  PREDICTED: 60S ribosomal protein L5                180   3e-51   
gb|ETE73605.1|  60S ribosomal protein L5                                179   3e-51   
gb|KFO98657.1|  60S ribosomal protein L5                                179   3e-51   
gb|AFM85809.1|  ribosomal protein L5                                    179   3e-51   
ref|XP_007882704.1|  PREDICTED: 60S ribosomal protein L5-like           179   3e-51   
gb|AFM90058.1|  ribosomal protein L5                                    179   3e-51   
ref|XP_005026595.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
gb|AFM89421.1|  ribosomal protein L5                                    179   3e-51   
ref|XP_010291146.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|XP_009512323.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|XP_009959874.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|XP_008942395.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|XP_010005060.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
gb|KFP17477.1|  60S ribosomal protein L5                                179   3e-51   
ref|XP_009075975.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
gb|KFO56565.1|  60S ribosomal protein L5                                179   3e-51   
ref|XP_005727289.1|  PREDICTED: 60S ribosomal protein L5-like           179   3e-51   
gb|KFO69584.1|  60S ribosomal protein L5                                179   3e-51   
ref|XP_006790548.1|  PREDICTED: 60S ribosomal protein L5-like           179   3e-51   
ref|XP_004552954.1|  PREDICTED: 60S ribosomal protein L5-like           179   3e-51   
ref|NP_001079377.1|  60S ribosomal protein L5-A                         178   3e-51   
ref|XP_010303651.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|XP_009818493.1|  PREDICTED: 60S ribosomal protein L5                178   3e-51   
ref|XP_010022288.1|  PREDICTED: 60S ribosomal protein L5                178   3e-51   
ref|XP_009963721.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|XP_008489183.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
emb|CAG05644.1|  unnamed protein product                                178   3e-51   
gb|KFM02490.1|  60S ribosomal protein L5                                178   3e-51   
ref|XP_006534747.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     178   3e-51   
ref|XP_005445628.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|XP_009920773.1|  PREDICTED: 60S ribosomal protein L5                179   3e-51   
ref|NP_058676.1|  60S ribosomal protein L5                              178   3e-51   
ref|XP_004752780.1|  PREDICTED: 60S ribosomal protein L5                181   3e-51   
ref|XP_005451204.1|  PREDICTED: 60S ribosomal protein L5-like           178   4e-51   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           178   4e-51   
ref|XP_006021921.1|  PREDICTED: 60S ribosomal protein L5                178   4e-51   
ref|XP_009492195.1|  50S ribosomal protein L5e                          178   4e-51   
ref|XP_002501941.1|  predicted protein                                  178   4e-51   
ref|XP_007641146.1|  PREDICTED: 60S ribosomal protein L5                178   4e-51   
ref|XP_005985559.1|  PREDICTED: 60S ribosomal protein L5-like           178   4e-51   
ref|XP_537074.4|  PREDICTED: 60S ribosomal protein L5 isoform 1         182   4e-51   
ref|XP_009554761.1|  PREDICTED: 60S ribosomal protein L5                178   4e-51   
dbj|BAF98650.1|  ribosomal protein L5                                   178   4e-51   
ref|XP_011354001.1|  PREDICTED: 60S ribosomal protein L5                179   4e-51   
ref|XP_007235270.1|  PREDICTED: 60S ribosomal protein L5-like           178   4e-51   
ref|XP_005690639.1|  PREDICTED: 60S ribosomal protein L5-like           177   4e-51   
ref|XP_008406082.1|  PREDICTED: 60S ribosomal protein L5                180   5e-51   
dbj|BAE31169.1|  unnamed protein product                                178   5e-51   
gb|EDL14330.1|  mCG1026389                                              178   5e-51   
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     178   5e-51   
ref|XP_010581057.1|  PREDICTED: 60S ribosomal protein L5                179   5e-51   
ref|NP_001030383.1|  60S ribosomal protein L5                           178   5e-51   
ref|XP_005806012.1|  PREDICTED: 60S ribosomal protein L5-like           179   5e-51   
ref|XP_010732697.1|  PREDICTED: 60S ribosomal protein L5                179   5e-51   
gb|ELK34439.1|  60S ribosomal protein L5                                179   6e-51   
ref|XP_010870379.1|  PREDICTED: 60S ribosomal protein L5                178   6e-51   
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             178   6e-51   
gb|AFM89559.1|  ribosomal protein L5                                    177   6e-51   
ref|XP_004068201.1|  PREDICTED: 60S ribosomal protein L5                177   7e-51   
emb|CEG01741.1|  Ribosomal protein L18/L5                               177   7e-51   
gb|ACH70882.1|  Ribosomal protein L5b                                   177   8e-51   
ref|XP_009939484.1|  PREDICTED: 60S ribosomal protein L5                179   8e-51   
emb|CDW60565.1|  Ribosomal L18p and Ribosomal L18 c domain contai...    178   8e-51   
ref|NP_988881.1|  ribosomal protein L5                                  177   8e-51   
ref|XP_009580381.1|  PREDICTED: 60S ribosomal protein L5                179   8e-51   
ref|XP_004018164.1|  PREDICTED: 60S ribosomal protein L5-like           180   9e-51   
ref|XP_004848203.1|  PREDICTED: 60S ribosomal protein L5-like           177   9e-51   
ref|XP_004589426.1|  PREDICTED: 60S ribosomal protein L5-like           177   1e-50   
gb|AAO25760.1|  ribosomal protein L5b                                   175   1e-50   
ref|XP_004635786.1|  PREDICTED: 60S ribosomal protein L5                177   1e-50   
gb|ACN10317.1|  60S ribosomal protein L5                                177   1e-50   
ref|NP_001187035.1|  ribosomal protein L5a                              177   1e-50   
gb|AFM86403.1|  60S ribosomal protein L5-A                              177   1e-50   
gb|KGL78260.1|  60S ribosomal protein L5                                177   1e-50   
ref|NP_001002106.1|  ribosomal protein L5                               177   1e-50   
ref|XP_004468431.1|  PREDICTED: 60S ribosomal protein L5-like           177   1e-50   
gb|KFM05083.1|  60S ribosomal protein L5                                177   1e-50   
ref|XP_006114225.1|  PREDICTED: 60S ribosomal protein L5                177   1e-50   
ref|XP_005050402.1|  PREDICTED: 60S ribosomal protein L5                178   1e-50   
gb|ACO07720.1|  60S ribosomal protein L5                                177   1e-50   
ref|XP_010339421.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    177   1e-50   
gb|ACI34044.1|  60S ribosomal protein L5                                177   1e-50   
ref|XP_009883197.1|  PREDICTED: 60S ribosomal protein L5                179   1e-50   
sp|O22608.1|RL5_DUNSA  RecName: Full=60S ribosomal protein L5           176   1e-50   
ref|XP_007058943.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     177   1e-50   
gb|ACH70844.1|  ribosomal protein L5a                                   177   1e-50   
gb|AFM74205.1|  ribosomal protein L5                                    177   1e-50   
gb|AFU54189.1|  ribosomal protein L5                                    172   1e-50   
gb|EMP36618.1|  60S ribosomal protein L5                                177   1e-50   
ref|NP_001279541.1|  60S ribosomal protein L5-like                      177   1e-50   
gb|KIN05730.1|  hypothetical protein OIDMADRAFT_16965                   177   1e-50   
tpg|DAA56365.1|  TPA: hypothetical protein ZEAMMB73_635593              172   1e-50   
gb|ADO28300.1|  60S ribosomal protein l5                                177   1e-50   
ref|XP_003283302.1|  60S ribosomal protein L5                           177   1e-50   
gb|ADO29334.1|  60S ribosomal protein l5                                177   1e-50   
ref|XP_002130156.1|  PREDICTED: 60S ribosomal protein L5                177   2e-50   
ref|XP_007554751.1|  PREDICTED: 60S ribosomal protein L5                177   2e-50   
ref|XP_010214453.1|  PREDICTED: 60S ribosomal protein L5                177   2e-50   
gb|ACI69521.1|  60S ribosomal protein L5                                177   2e-50   
gb|KFZ66474.1|  60S ribosomal protein L5                                176   2e-50   
gb|AER35073.1|  60S ribosomal protein L5                                176   2e-50   
gb|KGO46596.1|  Ribosomal protein L5 eukaryotic/L18 archaeal, C-t...    177   2e-50   
ref|XP_008295524.1|  PREDICTED: 60S ribosomal protein L5                178   2e-50   



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EA GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEK
Sbjct  121  GNLEANGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEK  177



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+E  GEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNLEVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELPRYGL+VG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN++  GEDYSVEP EGRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEK
Sbjct  121  GNLDVNGEDYSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEK  177



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   261 bits (666),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP+YGL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EA+GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEK
Sbjct  121  GNTEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEK  177



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   259 bits (663),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+VSASIAGDMILASAYA+ELPRYGL+VG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQVVSASIAGDMILASAYANELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+E  GEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNLEVNGEDYSVEPAENRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+E  GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNLEVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP+YGL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EA+GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   258 bits (658),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP YGL+VG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPHYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN++  GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEK
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEK  177



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP++GL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EA+GEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EK
Sbjct  121  GNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEK  177



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   254 bits (648),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   254 bits (650),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LASAYAHELPRYGL+VG TNYAAAYCTGLLLARR+L KLEMA+EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEK
Sbjct  121  GNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEK  177



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LASAYAHELPRYGL+VG TNYAAAYCTGLLLARR+L KLEMA+EYE
Sbjct  61   VAQIISASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEK
Sbjct  121  GNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEK  177



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN+DI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP +GL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN++  GEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGG+DIPHSEK
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEK  177



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIVSASIAGDMILASAYA ELP +GL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   ITQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN++  GEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGG+DIPHSEK
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEK  177



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK+RAYFKR+QVKF+RRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFRRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASI GD +LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L KLEM +EYE
Sbjct  61   TAQIISASITGDSVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLTKLEMDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SASIAGDMILA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EY+
Sbjct  61   IAQILSASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPTESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEY+
Sbjct  61   IAQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDK  177



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASI GD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM E+YE
Sbjct  61   TAQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_006447906.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61146.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=217

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_006447904.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61144.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=268

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQILSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +2

Query  53   AVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN  232
            A TMAF+K QKT+AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTN
Sbjct  15   AWTMAFVKAQKTKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTN  74

Query  233  KDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAE  412
            KDIIAQI+SA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +
Sbjct  75   KDIIAQILSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDD  134

Query  413  EYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EY+GN+EATGEDYSVEP + RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  135  EYQGNLEATGEDYSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  194



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   253 bits (645),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F K QK+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFAKAQKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGDMILASAYA ELP++GL+VG TNYAAAYCTGLLLARR+L+KLEM EEY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EA+GEDYSVE  E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EK
Sbjct  121  GNPEASGEDYSVELAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEK  177



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = +2

Query  8    FYFPPDNHSAAEAIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKN  187
            F+   D +     +G +   ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKN
Sbjct  3    FFLWHDKYQ--HCLGFILKVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKN  60

Query  188  KYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTG  367
            KYNTPKYRFVVRF+NKDI+AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTG
Sbjct  61   KYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTG  120

Query  368  lllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgal  547
            LLLARR+L+ LEM EEYEGNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGAL
Sbjct  121  LLLARRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGAL  180

Query  548  kgaldggldIPHSEK  592
            KGALDGGLDIPHS+K
Sbjct  181  KGALDGGLDIPHSDK  195



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   252 bits (643),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  56   VTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  235
            +   F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNK
Sbjct  1    MCQGFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNK  60

Query  236  DIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEE  415
            DIIAQI+SA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EE
Sbjct  61   DIIAQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEE  120

Query  416  YEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            Y+GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+K
Sbjct  121  YQGNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDK  179



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASIAGD++LA+AYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +2

Query  56   VTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  235
            +  AF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNK
Sbjct  1    MLQAFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNK  60

Query  236  DIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEE  415
            D+ AQI+SASI GD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM E+
Sbjct  61   DVTAQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDED  120

Query  416  YEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            YEGNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  YEGNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  179



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K  K+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKALKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>gb|KDO51034.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=217

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGDM+LA+AY+HELP++GLEVG TNYAAAYCTGLLLARR L+KLEM EEYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  KTRAY KRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTLKTRAYSKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDK  177



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEK  177



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSA+IAGD++LASAYAHELPRYGLE+G TNYAAAYCTGLLLARR LQKLEM EEYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEK  177



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AY KR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTQKTKAYSKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQ++SASIAGD++LASAYAHELP+YGLEVG TNYAAAYCTGLLLARR+L+ LEM +EY+
Sbjct  61   CAQVISASIAGDLVLASAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  44   AIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVR  223
            A  AV MAF+K QKT+AYFKR+QV FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR
Sbjct  49   APTAVAMAFVKAQKTKAYFKRYQVPFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVR  108

Query  224  FTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklE  403
            FT KDIIAQIVSASIAGD++LA+AY+HELP +GLEVG TNYAAAY TGLLLARR+L+KLE
Sbjct  109  FTKKDIIAQIVSASIAGDLVLAAAYSHELPHFGLEVGLTNYAAAYATGLLLARRVLKKLE  168

Query  404  MAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPH  583
            M EEYEGNVEATGEDYSVEPG+ RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH
Sbjct  169  MDEEYEGNVEATGEDYSVEPGDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  228

Query  584  SEK  592
            SEK
Sbjct  229  SEK  231



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSA+IAGD++LASAYAHELPRYGLE+G TNYAAAYCTGLLLARR LQKLEM EEYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEK  177



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSA+IAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLL RR+L+ LEM EEY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALD GLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDK  177



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKR+QVK+KRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSQKTKAYFKRYQVKYKRRRVGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELP YGLE G TNYAAAYCTGLLLARR+L+ LEM EEY+
Sbjct  61   AAQIISASIAGDLVLASAYAHELPHYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEPGE RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LASAYAHELPRYGLE G TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQITSASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   249 bits (637),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELP+YGLEVG TNYAAAYCTGLLLARR+L  LEM EEYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLNTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   251 bits (641),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  42   MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  101

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  102  VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  161

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  162  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  218



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   249 bits (637),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   249 bits (637),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LASAYAHELPRYGLE G TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIASASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASI GDM+LA+AYAHELP YGLEVG +NYAAAYCTGLLLARR+L+KLEM +EY+
Sbjct  61   VAQIVSASITGDMVLAAAYAHELPHYGLEVGLSNYAAAYCTGLLLARRVLKKLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSA+I GD +LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|AFK41626.1| unknown [Lotus japonicus]
Length=207

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF  538
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVF
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLVKTTTGNRVF  159



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSA+IAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLL RR+L+ LEM EEY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALD GLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDK  177



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AYA+ELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP YGL+VG TNYAAAYCTGLLLARR L+ LEM EEY+
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHYGLDVGLTNYAAAYCTGLLLARRTLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELP +GLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEA+GEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS++
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDQ  177



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSA+I GD +LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LASAYAHELP YGL+ G TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPHYGLDFGLTNYAAAYCTGLLLARRVLKTLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDYSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSA+I GD +LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA+ K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSRAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASI GD +LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  K RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKASKPRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+S++I+GD++LASAY+HELPRYGL VG TNYAA+YCTGLLLARR L+KLEM EEYE
Sbjct  61   VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEPGE RRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D+PHSEK
Sbjct  121  GNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEK  177



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SA+I GDM+LASAY+HELP YGLE G TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+S+EP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEK  177



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGDM+LA+AY+HELP++GLEVG TNYAAAYCTGLLLARR L+KLEM EEYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EATGEDYSVEP E RRPFRALLDVGL+RTTTGN VFGALKGALDGGLDIPHS+K
Sbjct  121  GNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNHVFGALKGALDGGLDIPHSDK  177



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K +K++AYFKR++VKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSRKSKAYFKRYRVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPVESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASI GD +LASAYAHELPRYGLEVG TNYAAAYCTGLLLARRLL+ LEM EEYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEK  177



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI SASI GD +LASAYAHELPRYGLEVG TNYAAAYCTGLLLARRLL+ LEM EEYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+S+SIAGD++LASA+AHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEY+
Sbjct  61   VAQIISSSIAGDLVLASAFAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLD+PHS+K
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGVLKGALDGGLDVPHSDK  177



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  177



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  5    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  64

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSASIAGDM+LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYEGN
Sbjct  65   QIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  124

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGED+SVEP EGRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  125  VEATGEDFSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  179



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  KTRAYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTLKTRAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   TAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATG+D+SVE  E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGDDFSVESAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  53   AVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN  232
            A  M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTN
Sbjct  30   ASAMVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTN  89

Query  233  KDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAE  412
            KDIIAQI SASIAGD++LASAY+HELP YGLEVG TNYAAAYCTGLLLARR+L+ LEM  
Sbjct  90   KDIIAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDG  149

Query  413  EYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EYEGNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  150  EYEGNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  209



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI SASIAGD++LASAY+HELP YGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   IAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+ SASIAGD +LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+KL+M +EYE
Sbjct  61   IAQVSSASIAGDHVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLRKLDMDKEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  88   MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  147

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSA+I GD +LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  148  IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  207

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  208  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  264



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKTRAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKTRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ++ + I GD++LA+AY+HELP YGL+VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   IAQVIHSRIVGDIVLAAAYSHELPCYGLDVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EATGEDYSVEPGE RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNTEATGEDYSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEK  177



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AY+HELP +GL+VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVS+SIAGDM+LASAY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   TAQIVSSSIAGDMVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS K
Sbjct  121  GNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVK  177



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEA+GED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEASGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+ ASI+GD++LA+AY HELP YGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEPGE RRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEK
Sbjct  121  GNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEK  177



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LASAY+HELP YGLEVG TNYAAAYCTGLLLARR L+ LEM +EY+
Sbjct  61   VAQIVSASIAGDLVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRTLKMLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDNRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KDO51035.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=252

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF  538
            G+VEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVF
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVF  159



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   245 bits (625),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+R TNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRITNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVS+SIAGDMILA+AY+HELPRYGLEVG TNYAAAYCTGLL+ARR+L+KLEM +EYE
Sbjct  61   TAQIVSSSIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLVARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS K
Sbjct  121  GNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVK  177



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = +2

Query  47   IGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRF  226
            +  +   F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF
Sbjct  60   VSGLKQVFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRF  119

Query  227  TNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEM  406
            TNKDI AQI+SA+I GDM+LASAY+HELP YGLE G TNYAAAYCTGLLLARR+L+ LEM
Sbjct  120  TNKDITAQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEM  179

Query  407  AEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHS  586
              EYEGNVEATGED+S+EP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS
Sbjct  180  DSEYEGNVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS  239

Query  587  EK  592
            EK
Sbjct  240  EK  241



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   244 bits (624),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ++SASIAGD++LA+A  HELPRYGLEVG TNYAAAYC GLLLARR+L+ LEM EEY+
Sbjct  61   IAQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATG D+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+K
Sbjct  121  GNIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDK  177



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKD+
Sbjct  57   MAYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDL  116

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIV ASIAGD++LASAYAHELPRYGLEVG TNYAAAYC GLLLARR+L++LEM  EYE
Sbjct  117  IAQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYE  176

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+K
Sbjct  177  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDK  233



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+IAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EATGED+SVEP + RRPFRALLDVGLLRTTTGNR+FGALKGALDGGLDIPHS+K
Sbjct  121  GNTEATGEDFSVEPTDTRRPFRALLDVGLLRTTTGNRIFGALKGALDGGLDIPHSDK  177



>gb|KJB22671.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGG+DIPHS+K
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDK  177



>gb|KJB22672.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGG+DIPHS+K
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDK  177



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGD++LASAY+HELP+YGLEVG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LA+AY+HELP +GL+VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TT GNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTIGNRVFGALKGALDGGLDIPHSDK  177



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = +2

Query  80   QKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVS  259
            QKT+AYFKR+QV+FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+AQIVS
Sbjct  37   QKTKAYFKRYQVQFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS  96

Query  260  ASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEAT  439
            ASIAGD++LASAYAHELPRYGLE+G TNYAAAYCTGLLLARR+L++L+M EEYEGNVEAT
Sbjct  97   ASIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRVLKELQMDEEYEGNVEAT  156

Query  440  GEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EK
Sbjct  157  GEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEK  207



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++LASAY HELPRYGLEVG T+YAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSASIAGDIVLASAYGHELPRYGLEVGLTSYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGD++LA+AY+HELP +GLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   IAQIVSASIAGDIVLAAAYSHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEA+GED+SVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEASGEDFSVEPADTRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +2

Query  56   VTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  235
            +  A++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNK
Sbjct  1    MVQAYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNK  60

Query  236  DIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEE  415
            D+IAQIV ASIAGD++LASAYAHELPRYGLEVG TNYAAAYC GLLLARR+L++LEM  E
Sbjct  61   DLIAQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAE  120

Query  416  YEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            YEGNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+K
Sbjct  121  YEGNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDK  179



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIVSA+I GD +LA+AYAHELP +GLEVG +NYAAAYCTGLLL+RR+L+ LEM EEYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLEVGLSNYAAAYCTGLLLSRRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYCKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+ AS+AGD+++A+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  178



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+ AS+AGD+++A+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAHKSRAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+IAGD++L +AY+HELPRYGLE+G TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSATIAGDVVLTAAYSHELPRYGLEIGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIVSASIAGD +LA+AYA ELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SA+I GDMILASAY+HELPRYGLEVG TNYAAAYCTGLLL RR+L+ LEM +EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGN VFGALKGALD GLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDK  177



>gb|AFW84310.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=233

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  178



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+ AS+AGD+++A+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM EEYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SA+I GDMILASAY+HELPRYGLEVG TNYAAAYCTGLLL RR+L+ LEM +EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGN VFGALKGALD GLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDK  177



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   242 bits (618),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGG+DIPHS+K
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDK  177



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
            AF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDII
Sbjct  4    AFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDII  63

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQ++SASIAGD++LA+A  HELPRYGLEVG TNYAAAYC GLLLARR+L+ LEM EEY+G
Sbjct  64   AQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQG  123

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            N+EATG D+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+K
Sbjct  124  NIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDK  179



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   242 bits (617),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIVSA+I GD +LA+AYAHELP +GL+VG +NYAAAYCTGLLL+RR+L+KLEM EEYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLDVGLSNYAAAYCTGLLLSRRVLKKLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|EPS64989.1| hypothetical protein M569_09790, partial [Genlisea aurea]
Length=207

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QK++AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIIA
Sbjct  1    FVKSQKSKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  60

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSA+IAGD +LA+AY+HEL  YGLEVG TNYAAAYCTGLLL RR+L+KL++ +EY+GN
Sbjct  61   QIVSATIAGDRVLAAAYSHELRHYGLEVGLTNYAAAYCTGLLLGRRVLKKLDLDQEYKGN  120

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGEDYSVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALD G+DIPHS+K
Sbjct  121  VEATGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDAGIDIPHSDK  175



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +2

Query  59   TMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD  238
            TM F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  30   TMVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKD  89

Query  239  IIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEY  418
            I+AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEY
Sbjct  90   IVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEY  149

Query  419  EGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EGN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  150  EGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  207



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  178



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  134  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP  313
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI+AQI+SASIAGD++LA+AYAHELP
Sbjct  28   EGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP  87

Query  314  RYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL  493
            RYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYEGNVEATGEDYSVEP E RRPFRAL
Sbjct  88   RYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRAL  147

Query  494  LDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  148  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  180



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSASIAGDM+LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYEGN
Sbjct  64   QIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  124  VEATGEDFSVEPADERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  178



>gb|KJB22673.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=197

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF  538
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVF
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVF  159



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KJB22670.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=171

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF  538
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVF
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVF  159



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+SASIAGD++LA+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M FIK QK RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNT KYRFVVR TNKDI
Sbjct  1    MVFIKAQKPRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTAKYRFVVRSTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+S++IAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   IAQIISSTIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E R PFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAETRGPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGL VG TNYAAAYCTGLLLARR+L+  E+ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLTVGLTNYAAAYCTGLLLARRILKYRELDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  178



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            Q++ ASIAGDM+LA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EY+GN
Sbjct  64   QVIYASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGEDY+VEP E RRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  124  VEATGEDYAVEPTESRRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  178



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   240 bits (613),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 171/195 (88%), Gaps = 4/195 (2%)
 Frame = +2

Query  8    FYFPPDNHSAAEAIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKN  187
            F   P  HS+ +     TM F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKN
Sbjct  8    FRLFPSLHSSPQQ----TMVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKN  63

Query  188  KYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTG  367
            KYNTPKYRFVVRFTNKDI+AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTG
Sbjct  64   KYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTG  123

Query  368  lllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgal  547
            LLLARR+L+ LEM +EYEGN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGAL
Sbjct  124  LLLARRVLKMLEMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGAL  183

Query  548  kgaldggldIPHSEK  592
            KGALDGGLDIPHS+K
Sbjct  184  KGALDGGLDIPHSDK  198



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  178



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KJB10809.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=230

 Score =   237 bits (604),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AY+HELP YGLEVG TNYAAAYC GLLLARR+L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATG+D++VEP E RRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEK
Sbjct  121  GNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEK  177



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDKEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  178



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRF+VRFTNKDIIA
Sbjct  4    FVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFIVRFTNKDIIA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSASI GD+ILA+AY+ ELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYEGN
Sbjct  64   QIVSASITGDIILAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  124  VEATGEDFSVEPAEERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP   RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPSGERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKFRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEA+GED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEASGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F++ QK  AY+KRFQV+FKRRR+GKTDYRAR RLINQ+KNKY+TPKYRFVVRFTNKDI
Sbjct  1    MGFVRTQKANAYYKRFQVQFKRRRDGKTDYRARIRLINQEKNKYSTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+SASIAGDM+LASAY+HELPRYGLEVG  NYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIMSASIAGDMVLASAYSHELPRYGLEVGLANYAAAYCTGLLLARRVLKLRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+ VEP +GRRPFRALLDVGL+RTTTGNRVF ALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFCVEPADGRRPFRALLDVGLIRTTTGNRVFAALKGALDGGLDIPHSDK  177



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKF+RRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFRRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  K+ AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKSNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQI+SASIAGDM+LASAY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEK  178



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNY-AAAYCTGlllarrllqklEMAEEY  418
             AQIVSASIAGD +LA+AYA ELP YGLEVG TNY AAAYCTGLLLARR+L+KLEM +EY
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAAYCTGLLLARRVLKKLEMDDEY  120

Query  419  EGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EGNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  EGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+VSA+IAGD++LASAYAHELPRYGL+VG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEA+GEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+VSA+IAGD++LASAYAHELPRYGL+VG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEA+GEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDK  177



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AY+HELP YGLEVG TNYAAAYC GLLLARR+L++LEM  EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATG+D++VEP E RRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEK
Sbjct  121  GNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEK  177



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQI+ ++IAGD++LA+AY+HELP+YGLEVG TNYAAAYCTGLLLARR+L+ L+M  EYE
Sbjct  61   TAQIIHSTIAGDIVLAAAYSHELPKYGLEVGLTNYAAAYCTGLLLARRVLKTLQMDGEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP   RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPAGERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP YGL VG TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPHYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +2

Query  59   TMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD  238
            +  F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  8    SWVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKD  67

Query  239  IIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEY  418
            I+AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEY
Sbjct  68   IVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEY  127

Query  419  EGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EGN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  128  EGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  185



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  35   VFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIV  94

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYEG
Sbjct  95   AQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEG  154

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            N+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  155  NLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  210



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  56   VTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  235
            V  AF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK
Sbjct  80   VYQAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNK  139

Query  236  DIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEE  415
             I+AQI+SASIAGD++LA+AY+HELP YGLEVG TNYAAAYCTGLLLARR+L+KLEM +E
Sbjct  140  FIVAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQE  199

Query  416  YEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            YEGNVEATGED+SVEP E RRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  200  YEGNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  258



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  78   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  137

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  138  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  194



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  8    FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  67

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  68   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  127

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  128  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  184



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  26   VFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIV  85

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEYEG
Sbjct  86   AQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEG  145

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            N+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  146  NLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  201



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM EEY 
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYG  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+I GD++LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+LQ LEM  EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EATGEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASI GD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIVGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYC GLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCAGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN+EATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   234 bits (597),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR VVRF+NKD+
Sbjct  1    MVFVKAQKTRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFSNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ A++AGD+++A+AY+ ELPRYGLEVG TNYAAAYCTGLLLARR+L++LEM EEY 
Sbjct  61   VAQIIYATLAGDVVMAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDEEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EA+GEDYSVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNEEASGEDYSVEPNDARRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   234 bits (597),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 160/177 (90%), Gaps = 3/177 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+ ASI+GD++LA+AY HELP YGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  58   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEPGE RRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEK
Sbjct  118  GNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEK  174



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  13   FVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  72

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIVSA+I GD++LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+LQ LEM  EYEGN
Sbjct  73   QIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEGN  132

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
             EATGEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  133  AEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDK  187



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SASIAGD++LAS+YAHELPRYGLEVG TNYAAAYCTGLLLARR+L++LEM  EYE
Sbjct  61   IAQIISASIAGDLVLASSYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDSEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDK  177



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L    + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 3/180 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldgg---ldIPHSEK  592
            GNV ATGED+S+EP E RRPFRALLDVGL+RTTTGNRVFGALK         LDIPHS+K
Sbjct  121  GNVVATGEDFSIEPTESRRPFRALLDVGLIRTTTGNRVFGALKVLKGALDGGLDIPHSDK  180



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AY+KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  134  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP  313
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+AQIVSA+IAGD +LA+AYAHEL 
Sbjct  1    EGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSATIAGDRVLAAAYAHELR  60

Query  314  RYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL  493
             YGLEVG TNYAAAYCTGLLL RR+L KL++ +EYEGNVEATGEDYSVEP E RRPFRAL
Sbjct  61   HYGLEVGLTNYAAAYCTGLLLGRRVLNKLDLDQEYEGNVEATGEDYSVEPAESRRPFRAL  120

Query  494  LDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            LDVGLLRTTTGNRVFGALKGALD G+DIPHS+K
Sbjct  121  LDVGLLRTTTGNRVFGALKGALDAGIDIPHSDK  153



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDII
Sbjct  94   VFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDII  153

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
            AQIVSA+I GD++LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+LQ LEM  EYEG
Sbjct  154  AQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEG  213

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            N EATGEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  214  NAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDK  269



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 3/177 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI+ ASI+GD++LA+AYAHELPRYGLEVG TNYAAAYC GLLLARR L++LEM  EYE
Sbjct  58   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED++VEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGG+DIPHS+K
Sbjct  118  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDK  174



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 166/177 (94%), Gaps = 3/177 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
             AF+K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV   TNK+I
Sbjct  9    FAFVKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFV---TNKNI  65

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQIVSASIAGD++LA+AY++ELP+YGLEVG TNYAAAYCTGLL+ARR+L++LEM  EYE
Sbjct  66   IAQIVSASIAGDIVLAAAYSYELPQYGLEVGLTNYAAAYCTGLLVARRVLKQLEMDGEYE  125

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  126  GNVEATGEDFSVEPTENRRPFRALLDVGLIQTTTGNRVFGALKGALDGGLDIPHSEK  182



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRAR-NRLINQDKNKYNTPKYRFVVRFTNKD  238
            M  +K Q +R Y  R+QVK++RRR+GKTDYRAR  RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  1    MVLVKPQNSRPYSMRYQVKYRRRRDGKTDYRARIRRLINQDKNKYNTPKYRFVVRFTNKD  60

Query  239  IIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEY  418
            I AQ+VSASIAGD+ILA+AYAHELP+YGL VG TNY+AAYCTGLLLARR+L+  EM  EY
Sbjct  61   ITAQLVSASIAGDVILAAAYAHELPQYGLNVGLTNYSAAYCTGLLLARRVLKMFEMDAEY  120

Query  419  EGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EGN+EA+GED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  EGNLEASGEDFSVEPTENRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK + YFKR+QVKF+RRREGKTDYRAR RLINQDKNKYN+PK+R+VVRFTNKDI
Sbjct  1    MVFVKPQKKQPYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNSPKFRYVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIVSA+I GD +LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+L+ LEM  EYE
Sbjct  61   IVQIVSATITGDNVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN EATGEDYSVEP E RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNAEATGEDYSVEPTETRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDK  177



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
            AF+K+QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    AFVKLQKTHAYHKRFQVKFKRRRQGKTDYRARVRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
             QI  A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYEG
Sbjct  63   CQIAYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRDLDQEYEG  122

Query  425  NVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            NVEA GEDYSVEP + RRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EK
Sbjct  123  NVEAAGEDYSVEPSDERRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEK  178



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  7    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  66

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLE G TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  67   QIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  126

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  127  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  181



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLE G TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 163/181 (90%), Gaps = 4/181 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQIVSA+I GD++LASAYAHELPRYGL+ G TNYAAAYCTGLLLARR+LQ LEM  EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  422  GNVE----ATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            GN E    ATGEDYSVEP + RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+
Sbjct  121  GNAEVRLIATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSD  180

Query  590  K  592
            K
Sbjct  181  K  181



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = +2

Query  14   FPPDNHSAAEAIGAVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKY  193
             PP +   A   G+  M ++K QKT+AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKY
Sbjct  14   LPPKSDLGAPKRGSA-MVYVKTQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKY  72

Query  194  NTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGll  373
            NTPKYRFVVRFTNKDIIAQI+SASIAGD++LA+AY+HELPRYGLEVG TNYAAAYCTGLL
Sbjct  73   NTPKYRFVVRFTNKDIIAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLL  132

Query  374  larrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkg  553
            LARR+L+ LEM EEYEGNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFGALKG
Sbjct  133  LARRVLKMLEMDEEYEGNVEATGEDFSVEPTESRRPFRALLDVGLVRTTTGNRVFGALKG  192

Query  554  aldggldIPHSEK  592
            ALDGGLDIPHS+K
Sbjct  193  ALDGGLDIPHSDK  205



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++K QKT+AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKTQKTKAYFKRYQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SASIAGD++LA+AYAHELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM EEYE
Sbjct  61   IAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP E RRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDFSVEPTESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDK  177



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NK I
Sbjct  1    MAFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKHI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI+SASIAGDMILA+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   IAQIISASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGEDYSVEP E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   227 bits (579),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 3/177 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ EEYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  118  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  174



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   227 bits (579),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  1    MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            + QIVSA+IAGD++LA+AYAHELP++GL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  61   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNV ATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  GNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDK  177



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 3/177 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ +EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  118  GNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  174



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   226 bits (577),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 3/177 (2%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M +IK QKTRAY KRFQVKFKRRR GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRRGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
             AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ EEYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  118  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  174



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  32   MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  91

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            + QIVSA+IAGD++LA+AYAHELP++GL VG TNYAAAYCTGLLLARR+L+ LEM +EYE
Sbjct  92   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  151

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GNV ATGEDYSVEP + RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  152  GNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDK  208



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A++AGD++L SAYAHELPRYGL+ G TNYAAAYCTGLLLARR L+  E+ +EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN  ATGEDY+VE GEG+RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEK
Sbjct  121  GNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEK  177



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 161/180 (89%), Gaps = 3/180 (2%)
 Frame = +2

Query  53   AVTMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN  232
            A    +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TN
Sbjct  2    AAAPVYIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TN  58

Query  233  KDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAE  412
            KD+ AQIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+  ++ E
Sbjct  59   KDVTAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDE  118

Query  413  EYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            EYEGNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  119  EYEGNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A++AGD++L SAYAHELPRYGL+ G TNYAAAYCTGLLLARR L+  ++ +EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNYDLDDEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN +ATGEDY+VE GEG+RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEK
Sbjct  121  GNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEK  177



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A++AGD++L SAYAHELPRYGL+ G TNYAAAYCTGLLLARR L+  E+ +EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN +ATGEDY+VE GEG+RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEK
Sbjct  121  GNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEK  177



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRYVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A++AGD++L SAYAHELPRYGL+ G TNYAAAYCTGLLLARR L+  E+ +EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN  ATGEDY+VE GEG+RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEK
Sbjct  121  GNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEK  177



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI A
Sbjct  7    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITA  63

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L    + +EYEGN
Sbjct  64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGN  123

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  178



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = +2

Query  68   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA  247
            F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI A
Sbjct  4    FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITA  60

Query  248  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGN  427
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTGLLLARR+L+   + +EYEGN
Sbjct  61   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN  120

Query  428  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  121  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDK  175



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  164  RLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTN  343
            RLINQDKNKYNTPKYRFVVRF+NKDI+AQI SASI GD +LASAYAHELPRYGLEVG TN
Sbjct  30   RLINQDKNKYNTPKYRFVVRFSNKDIVAQITSASITGDTVLASAYAHELPRYGLEVGLTN  89

Query  344  YAAAYCTGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTT  523
            YAAAYCTGLLLARRLL+ LEM EEYEGNVEATGED+SVEP + RRPFRALLDVGL+RTTT
Sbjct  90   YAAAYCTGLLLARRLLKMLEMDEEYEGNVEATGEDFSVEPADTRRPFRALLDVGLVRTTT  149

Query  524  GNRVFgalkgaldggldIPHSEK  592
            GNRVFGALKGALDGGLDIPHSEK
Sbjct  150  GNRVFGALKGALDGGLDIPHSEK  172



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A+IAGD+I+A+AYAHELPRYGL+VG TNYAAAYCTGLLLARRLL K+ MA+ YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN +  GEDY+VE   E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEK  178



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A+IAGD+I+A+AYAHELPRYGL+VG TNYAAAYCTGLLLARRLL K+ MA+ YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN +  GEDY+VE   E RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEK
Sbjct  121  GNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEK  178



>ref|XP_004310188.1| PREDICTED: 60S ribosomal protein L5-2-like [Fragaria vesca subsp. 
vesca]
Length=171

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  176  QDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAA  355
            +DKNKYNTPKYRFVV FTNKDI+AQI+S++I+GD++LASAY+HELPRYGL VG TNYAA+
Sbjct  14   KDKNKYNTPKYRFVVCFTNKDIVAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAAS  73

Query  356  YCTGlllarrllqklEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRV  535
            YCTGLLLARR L+KLEM EEYEGN+EATGED+SVEPGE RRPFRALLDVGL+ TTTGNRV
Sbjct  74   YCTGLLLARRTLKKLEMDEEYEGNLEATGEDFSVEPGENRRPFRALLDVGLVLTTTGNRV  133

Query  536  FgalkgaldggldIPHSEK  592
            FGALKGALDGG+D+PHSEK
Sbjct  134  FGALKGALDGGIDVPHSEK  152



>sp|Q4KTI3.1|RL5_SUBDO RecName: Full=60S ribosomal protein L5 [Suberites domuncula]
 gb|AAX48835.1| L5 [Suberites domuncula]
Length=293

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRREGKTDYRAR RL+ QDKNKYNTPKYR V+RFTN DI
Sbjct  1    MPFVKVIKNKAYFKRYQVKFRRRREGKTDYRARKRLVVQDKNKYNTPKYRIVIRFTNTDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI+ A I GD +L SAYAHELPRYG++VG TNYAAAYCTGLLLARRLL  L +A++Y 
Sbjct  61   ICQIIYAKIEGDKVLVSAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTNLGLADKYA  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHS  586
            G  +  GED++VE  G+G RPFRA LDVGL RTTTGNRVF A+KGA+DGG+DIPHS
Sbjct  121  GQTDIDGEDFNVEHMGDGPRPFRAFLDVGLTRTTTGNRVFAAMKGAVDGGIDIPHS  176



>gb|ERG79917.1| 60s ribosomal protein l5 [Ascaris suum]
Length=258

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVK KRRREGKTDY AR RL  QDKNKYNTPKYRF+VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRFIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD+I+ +AY+HELPRYG++VG TNYAAAY TGLLLARR L KL MA+ Y+
Sbjct  61   IAQIAYSRIEGDVIVCAAYSHELPRYGIKVGLTNYAAAYATGLLLARRHLTKLNMADAYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G  E  GEDY+VE    R PFRA+LDVGL RTTTG ++F A+KG  DGG+DIPHSE
Sbjct  121  GVEEVDGEDYNVEQEGERAPFRAVLDVGLARTTTGAKIFAAMKGVADGGIDIPHSE  176



>gb|EPZ34992.1| 60S ribosomal protein L5 [Rozella allomycis CSF55]
Length=297

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+K  K +AYFKRFQ K++RRREGKTDY AR RLI QDKNKYN+PKYR VVRFTNKDI
Sbjct  1    MPFVKEIKNKAYFKRFQTKYRRRREGKTDYYARKRLIIQDKNKYNSPKYRMVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+V A I GD+++ASAYAHELPRYG++VG TNYAAAYC GLLLARR+L K  +A +YE
Sbjct  61   ICQMVYARIQGDVVIASAYAHELPRYGVQVGLTNYAAAYCVGLLLARRVLTKFNLASKYE  120

Query  422  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  EA GE ++VE  E G RPF+A LDVGL RT+TG RVFGA+KGA DGG+ IPHSEK
Sbjct  121  GQTEADGEIFNVEAIEDGPRPFKAYLDVGLRRTSTGARVFGAMKGAADGGIFIPHSEK  178



>gb|ABB29646.1| ribosomal protein 5 large subunit, partial [Suberites ficus]
Length=145

 Score =   186 bits (471),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  134  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP  313
            EGKTDYRAR RL+ QDKNKYNTPKYR V+RFTN DII QIV A I GD +L SAYAHELP
Sbjct  2    EGKTDYRARKRLVVQDKNKYNTPKYRIVIRFTNTDIICQIVYAKIEGDKVLVSAYAHELP  61

Query  314  RYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEGNVEATGEDYSVE-PGEGRRPFRA  490
            RYG++VG TNYAAAYCTGLLLARRLL  L +A +YEG  +  GED++VE  G+G RPFRA
Sbjct  62   RYGVKVGLTNYAAAYCTGLLLARRLLSNLGLAYKYEGQTDIDGEDFNVEHMGDGPRPFRA  121

Query  491  LLDVGLLRTTTGNRVF  538
             LDVGL RTTTGNRVF
Sbjct  122  FLDVGLTRTTTGNRVF  137



>ref|XP_005536050.1| 60S ribosomal protein L5 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM79764.1| 60S ribosomal protein L5 [Cyanidioschyzon merolae strain 10D]
Length=298

 Score =   191 bits (484),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+KV K +AYFKRFQVK +RRREGKTDY AR  LI  DK KYNTPKYR VVR TN D+
Sbjct  1    MAFVKVVKNKAYFKRFQVKPRRRREGKTDYHARRALIIVDKTKYNTPKYRLVVRITNSDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIV+A + GD ++A+AYAHELPRYG++VG TN+AAAY TGLL+ARR L  L +A+ Y+
Sbjct  61   ICQIVTARVEGDKVIAAAYAHELPRYGIKVGLTNFAAAYATGLLVARRTLTILGLADAYQ  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G VEA GE Y VEP    RPFRA+LDVGL+RTTTG+RVF A+KGA+DGG+DIPHSEK
Sbjct  121  GKVEADGELYQVEPVGETRPFRAVLDVGLVRTTTGHRVFAAMKGAVDGGIDIPHSEK  177



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K  +Y+ R+QVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MPAMKVVKNSSYYSRYQVKYRRRREGKTDYRARLRLVTQDKNKYNTPKYRMVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            + Q+  +++AGD+++ASAY+HELP+YGL VG TNYAAAY TGLLLARR+L K  +A+ Y 
Sbjct  61   VCQLAYSTLAGDVVVASAYSHELPKYGLTVGLTNYAAAYATGLLLARRVLSKYNLAKAYA  120

Query  422  GNVEATGEDYSVEPGEG-RRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            GN E  GEDY+VE  EG +RPF ALLD GL RT+TG++VF ALKGALDGGLD+PHSEK
Sbjct  121  GNTEDVGEDYNVEEIEGEKRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSEK  178



>gb|KIY93440.1| 60S ribosomal protein L5 [Monoraphidium neglectum]
Length=199

 Score =   186 bits (471),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++KV KT AYF R+QVK++RRR+GKTDYRAR RL  QDKNKYNT KYR VVRF+NKD+
Sbjct  1    MGYVKVLKTSAYFSRYQVKYRRRRQGKTDYRARLRLCTQDKNKYNTHKYRLVVRFSNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
              Q+V ASIAGD+++A+AYAHELP+YGL VG  NYAAAYC GLLLARR+L K  +AE Y 
Sbjct  61   TCQVVYASIAGDVVVAAAYAHELPKYGLSVGLKNYAAAYCVGLLLARRVLTKFGLAEHYA  120

Query  422  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  E  GEDY+V+P E G RPF  LLD GL RT+TG++ F ALKGALDGGLDIPH+EK
Sbjct  121  GQEEPDGEDYNVDPVEDGPRPFSCLLDAGLKRTSTGSKTFAALKGALDGGLDIPHNEK  178



>gb|AGH70151.1| 60S ribosomal protein L5, partial [Placozoa sp. H4]
Length=206

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVK+KRRREGKTDY AR RL  QDKNKYNTPKYR VVR TNKD+
Sbjct  1    MTFVKVVKNKAYFKRFQVKYKRRREGKTDYFARKRLCTQDKNKYNTPKYRMVVRLTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI SA + GD I  +AY+HELPRYG+++G TNYAA YCTGLLLARR+L KL +A +Y 
Sbjct  61   ICQIASAKLEGDEIFCAAYSHELPRYGVKIGLTNYAACYCTGLLLARRVLTKLNLANKYV  120

Query  422  GNVEATGEDYSV-EPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  E  GED+ V EP EG R FR  LDVGL RTTTG R+FGALKGA+DGGL+IPH  K
Sbjct  121  GVEEVDGEDFEVEEPDEGARSFRCFLDVGLARTTTGARIFGALKGAVDGGLNIPHQHK  178



>gb|EJW84695.1| 60S ribosomal protein L5 [Wuchereria bancrofti]
Length=295

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTN+D+
Sbjct  1    MGFVKVVKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNRDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD+++ SAY+HELPRYG++VG TNYA+AY TGLLLARR L  + +AE Y+
Sbjct  61   IAQIAYSRIEGDVVVCSAYSHELPRYGIKVGLTNYASAYATGLLLARRHLLNIGLAETYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G  EATG+DY+VE    R PFRA+LDVGL RT TG +VF  +KG  DGG+D+PHSE
Sbjct  121  GVEEATGDDYNVEKEGERAPFRAVLDVGLARTVTGAKVFAVMKGVADGGVDVPHSE  176



>ref|XP_001897856.1| 60S ribosomal protein L5 [Brugia malayi]
 emb|CDP94073.1| Protein BM-RPL-5, isoform b [Brugia malayi]
Length=295

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTN+D+
Sbjct  1    MGFVKVVKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNRDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD+++ SAY+HELPRYG++VG TNYA+AY TGLLLARR L  + +AE Y+
Sbjct  61   IAQIAYSRIEGDVVVCSAYSHELPRYGIKVGLTNYASAYATGLLLARRHLLNIGLAEAYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G  EATG+DY+VE    R PFRA+LDVGL RT TG +VF  +KG  DGG+D+PHSE
Sbjct  121  GVEEATGDDYNVEKEGERAPFRAVLDVGLARTVTGAKVFAVMKGVADGGIDVPHSE  176



>ref|XP_003391604.1| PREDICTED: 60S ribosomal protein L5-like, partial [Amphimedon 
queenslandica]
Length=167

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F KV K ++YFKR+QVK++RRREGKTDY AR RLI QDKNKYN PKYR VVR TN DI
Sbjct  1    MGFFKVIKDKSYFKRYQVKYRRRREGKTDYYARKRLIIQDKNKYNAPKYRLVVRLTNTDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QIV+A I GD+ LA+AYAHELPRYG++VG  NY+AAYCTGLLLARR+L KL +A++YE
Sbjct  61   ICQIVNAKIDGDVTLAAAYAHELPRYGIKVGLKNYSAAYCTGLLLARRVLTKLNLADKYE  120

Query  422  GNVEATGEDYSV-EPGEGRRPFRALLDVGLLRTTTGNRVF  538
            GN +  GEDY+V   GE  RP R  LD+GL+RTTTG RVF
Sbjct  121  GNDDINGEDYNVMSMGESPRPLRCYLDIGLVRTTTGQRVF  160



>ref|NP_001104213.1| uncharacterized protein LOC100126642 [Xenopus laevis]
 gb|AAI53791.1| LOC100126642 protein [Xenopus laevis]
Length=302

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 5/182 (3%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MAF+K+ K +AY+KRFQVK++RRREGKTDY AR RL+ Q KNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKLVKNKAYYKRFQVKYRRRREGKTDYYARKRLVAQSKNKYNTPKYRLVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQ+  A I GD I+A+AY+HELPRYG++VG TNYAA Y TGLL+ARRLL KL +A++YE
Sbjct  61   IAQVAYAKIEGDQIIAAAYSHELPRYGIKVGLTNYAACYATGLLVARRLLTKLGLADQYE  120

Query  422  GNVEAT--GED---YSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHS  586
            GN EA   GED   Y VE     RPFR  LDVGL+RTTTG +VF  +KGA+DGGLDIPH+
Sbjct  121  GNTEAAAPGEDGGLYHVEAEGDSRPFRCFLDVGLVRTTTGAKVFAVMKGAVDGGLDIPHN  180

Query  587  EK  592
            EK
Sbjct  181  EK  182



>ref|XP_002736904.1| PREDICTED: 60S ribosomal protein L5-like [Saccoglossus kowalevskii]
Length=294

 Score =   185 bits (470),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A I GD+I+ +AYAHELPRYG++VG TNY+AAYCTGLL+ARRLL K E+A+ Y+
Sbjct  61   ICQVAYARIEGDIIICAAYAHELPRYGVKVGLTNYSAAYCTGLLVARRLLTKFELADLYK  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  E  G++Y+VE  +G+   FR  LDVGL RTTTG R+FG LKGA DGGLDIPHS K
Sbjct  121  GQEEVDGDEYTVESEDGKPGAFRCFLDVGLARTTTGARIFGCLKGAADGGLDIPHSVK  178



>ref|XP_003145913.1| 60S ribosomal protein L5 [Loa loa]
 gb|EFO18156.1| 60S ribosomal protein L5 [Loa loa]
Length=306

 Score =   185 bits (470),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTN+D+
Sbjct  1    MGFVKVVKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNRDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD+++ SAY+HELPRYG++VG TNYA+AY TGLLLARR L K+ +AE Y+
Sbjct  61   IAQIAYSRIEGDVVVCSAYSHELPRYGIKVGLTNYASAYATGLLLARRHLLKIGLAETYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHS  586
            G  EATG+DY+VE    R PFRA+LDVGL RT TG +VF  +KG  DGG+D+PHS
Sbjct  121  GVEEATGDDYNVEKEGERAPFRAVLDVGLARTVTGAKVFAVMKGVADGGIDVPHS  175



>ref|XP_008049787.1| PREDICTED: 60S ribosomal protein L5, partial [Tarsius syrichta]
Length=199

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GD+I+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRLL    M + YE
Sbjct  61   ICQIAYARIEGDVIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNSFGMDKTYE  120

Query  422  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS K
Sbjct  121  GQVEVTGDEYNVESVDGKAGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTK  178



>ref|XP_005717676.1| unnamed protein product [Chondrus crispus]
 emb|CDF37805.1| unnamed protein product [Chondrus crispus]
Length=296

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            MA +K  K +AY KR+Q K++RRREGKTDY+AR RL+ QDK KYN+P+YR VVRFTNKDI
Sbjct  1    MARVKFAKNKAYSKRYQTKWRRRREGKTDYQARRRLVTQDKRKYNSPRYRLVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+V+A I GD IL SAYAHELPRYG++ G TN+AAAYC GLL ARR L KL + E Y+
Sbjct  61   ICQVVAARIQGDEILTSAYAHELPRYGIKHGLTNFAAAYCVGLLCARRHLSKLGLDELYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  E +GE Y +E  + +RPF ALLD+GL RTTTG +VF  +KGA+DGG++IPH+EK
Sbjct  121  GVEEVSGEMYEIEEDDEKRPFTALLDIGLTRTTTGKKVFATMKGAVDGGMNIPHNEK  177



>ref|XP_001689859.1| ribosomal protein L5, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09597.1| ribosomal protein L5 [Chlamydomonas reinhardtii]
Length=293

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M ++KV KT  YF RFQVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRFTN+DI
Sbjct  1    MGYVKVIKTSPYFSRFQVKYRRRREGKTDYRARLRLVKQDKNKYNTPKYRLVVRFTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
              QIV ++I GD++ A+AYAHELP YGLE G TNYAA YC GLL+ARR+L K  + + Y 
Sbjct  61   TCQIVRSTIKGDIVEAAAYAHELPDYGLECGLTNYAACYCVGLLVARRILTKFGLDKHYP  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEKGL  598
            G  E  GEDY++EP  EG RPF  LLD GL RT+TG++VFG LKGALDGGLDIPH+EK L
Sbjct  121  GQTEPDGEDYNIEPVEEGPRPFFCLLDTGLKRTSTGSKVFGCLKGALDGGLDIPHNEKRL  180



>ref|XP_005643753.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE19209.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K+  Y  R+QVK++RRREGKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MGHVKVVKSGPYHSRYQVKYRRRREGKTDYRARLRLTTQDKNKYNTPKYRFVVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A++AGD+I+ASAY+HEL  YGL VG TNYAA Y TGLLLARR+L K  +A+ Y 
Sbjct  61   ICQVAYATVAGDVIVASAYSHELVNYGLSVGLTNYAATYATGLLLARRVLTKFGLADAYV  120

Query  422  GNVEATGEDYSVEPG-EGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  EATGEDY+VE   EG RPF ALLD GL RT+TG++VF ALKGALDGGLDIPHS+K
Sbjct  121  GQEEATGEDYNVEAAEEGPRPFTALLDTGLKRTSTGSKVFAALKGALDGGLDIPHSDK  178



>tpg|DAA34076.1| TPA_exp: 60S ribosomal protein L5 [Amblyomma variegatum]
Length=210

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RL+ QDKNKYN+PKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARRRLVVQDKNKYNSPKYRMIVRITNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GD+I+ +AYAHELPRYG+ +G TNY AAYCTGLLLARR+LQK ++ E Y+
Sbjct  61   ICQIAYARIEGDVIVCAAYAHELPRYGVRLGLTNYPAAYCTGLLLARRMLQKFKLDEVYK  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  EATGEDY VE  +G+   FR  LDVGL RTTTG R+FG LKGA+DGG+DIPHS K
Sbjct  121  GCEEATGEDYCVESEDGQPGAFRCFLDVGLARTTTGARIFGCLKGAVDGGMDIPHSNK  178



>ref|XP_002109848.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV28014.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=297

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVK+KRRREGKTDY AR RL  QDKNKYN+PKYR VVR TNKD+
Sbjct  1    MTFVKVVKNKAYFKRFQVKYKRRREGKTDYFARKRLCTQDKNKYNSPKYRMVVRLTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A + GD I  +AY+HELPRYG++VG TNYAA YCTGLLLARR+L KL +A++Y 
Sbjct  61   ICQIACAKLEGDEIFCAAYSHELPRYGIKVGLTNYAACYCTGLLLARRVLTKLNLADKYV  120

Query  422  GNVEATGEDYSV-EPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  E  GED+ V EP EG R FR  LDVGL RTTTG R+FG LKGA+DGGL+IPH  K
Sbjct  121  GVEEPDGEDFEVEEPDEGARAFRCFLDVGLARTTTGARIFGTLKGAVDGGLNIPHQHK  178



>gb|ACZ13335.1| 60S ribosomal protein L5 [Bursaphelenchus xylophilus]
Length=297

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K RAYFKRFQ K KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTNKD+
Sbjct  1    MGLVKVVKNRAYFKRFQTKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            IAQI  + I GD++++SAYAHELPRYG++VG TNYAAAY TGLLLARR L+ +++   Y+
Sbjct  61   IAQIAYSKIGGDVVVSSAYAHELPRYGIKVGLTNYAAAYATGLLLARRHLKSIKLDTLYK  120

Query  422  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G  E  GEDY+VE  G+   PF+A+LDVGL RTTTG +VF  +KG  DGG+++PHSE
Sbjct  121  GTEEVNGEDYNVEQEGDNPNPFQAVLDVGLARTTTGAKVFAVMKGVADGGINVPHSE  177



>gb|EGT59634.1| hypothetical protein CAEBREN_19650 [Caenorhabditis brenneri]
Length=293

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQ+  + I GD+++ASAYAHELPRYGL+ G TNYAAAY TGLLLARR L+ + +   Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSE  176



>sp|Q627R7.2|RL5_CAEBR RecName: Full=60S ribosomal protein L5 [Caenorhabditis briggsae]
 emb|CAP22065.2| Protein CBR-RPL-5 [Caenorhabditis briggsae]
Length=294

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  1    MGLVKVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQ+  + I GD+++ASAYAHELPRYGL+ G TNYAAAY TGLLLARR L+ + +   Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSE  176



>ref|XP_002434050.1| 60S ribosomal protein L5, putative [Ixodes scapularis]
 gb|EEC05450.1| 60S ribosomal protein L5, putative [Ixodes scapularis]
Length=297

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARRRLVVQDKNKYNTPKYRMIVRITNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A I GD+I+ +AYAHELPRYG+++G TNYAAAYCTGLLLARR+LQK ++ E Y+
Sbjct  61   ICQVAYARIEGDVIVCAAYAHELPRYGVKLGLTNYAAAYCTGLLLARRMLQKFKLDEIYK  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  EA GEDY VE  +G+   FR  LDVGL RTTTG R+FGALKGA+DGG+DIPHS K
Sbjct  121  GQEEANGEDYCVESIDGQPGAFRCFLDVGLARTTTGARIFGALKGAVDGGMDIPHSNK  178



>gb|ABO26701.1| ribosomal protein l5 [Haliotis discus discus]
Length=251

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 149/178 (84%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKF+RRREG+TDY AR RLI Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGRTDYFARKRLIFQEKNKYNTPKYRLIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GD+I+A+AY+HELPRYG++VG TNYAAAYCTGLLLARRLLQKL++   Y 
Sbjct  61   ICQIAYARIEGDIIIAAAYSHELPRYGVKVGLTNYAAAYCTGLLLARRLLQKLKLDSIYT  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  EA GE+Y VE  +G+   FRA LD+GL+RTTTG RVFGALKGA+DGG+DIPHS K
Sbjct  121  GVEEANGEEYYVEDEDGKPGAFRAYLDIGLVRTTTGARVFGALKGAVDGGIDIPHSMK  178



>ref|XP_002630158.1| C. briggsae CBR-RPL-5 protein [Caenorhabditis briggsae]
Length=297

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  4    MGLVKVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  63

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQ+  + I GD+++ASAYAHELPRYGL+ G TNYAAAY TGLLLARR L+ + +   Y+
Sbjct  64   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  123

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE
Sbjct  124  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSE  179



>ref|XP_004337717.1| ribosomal L18p/L5e family [Acanthamoeba castellanii str. Neff]
 gb|ELR15704.1| ribosomal L18p/L5e family [Acanthamoeba castellanii str. Neff]
Length=291

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K R+YFKR+QVK++RRREGKTDY+ARN++I Q KNKYNTPKYR VVR TNKDI
Sbjct  1    MGFVKVVKNRSYFKRYQVKYRRRREGKTDYQARNKMIIQAKNKYNTPKYRLVVRVTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GDMI+ +AY+HELPRYGL+ G TNYAA Y TGLLLARR L KL +AE+Y+
Sbjct  61   ICQIAYAKIKGDMIMTAAYSHELPRYGLKTGLTNYAACYATGLLLARRHLTKLNLAEKYQ  120

Query  422  GNVEATGEDYS--VEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G  E TGED+S  ++  EG +PF+A LD GL RT+TG ++F +LKGA DGGLDIPHS+
Sbjct  121  GKTEVTGEDWSYNLDEIEGPKPFKATLDSGLARTSTGAKLFASLKGACDGGLDIPHSD  178



>ref|XP_001634531.1| predicted protein [Nematostella vectensis]
 gb|EDO42468.1| predicted protein [Nematostella vectensis]
Length=296

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARKRLITQDKNKYNTPKYRFVVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
              QI  A + GD+I+ +AYAHELPRYG++VG TNYAAAYCTGLLLARRLL KL + E Y 
Sbjct  61   TCQIAYAKLEGDVIICAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTKLNLHEIYT  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  E  G++Y+VE  +G    FR  LDVGL RT+TG RVFGALKGA+DGGL+IPHS K
Sbjct  121  GTEEVNGDEYNVESIDGSPGAFRCFLDVGLARTSTGARVFGALKGAVDGGLEIPHSMK  178



>ref|NP_495811.1| Protein RPL-5 [Caenorhabditis elegans]
 sp|P49405.1|RL5_CAEEL RecName: Full=60S ribosomal protein L5 [Caenorhabditis elegans]
 emb|CAA90251.1| RPL-5 [Caenorhabditis elegans]
Length=293

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRITNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQ+  + I GD+++ASAY+HELPRYGL+VG TNYAAAY TGLLLARR L+ + +   Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYSHELPRYGLKVGLTNYAAAYATGLLLARRHLKTIGLDSTYK  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSE  589
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSE  176



>ref|XP_006197385.1| PREDICTED: 60S ribosomal protein L5 [Vicugna pacos]
Length=297

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR VVR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMVVRVTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRLL +  M + YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS K
Sbjct  121  GQVEVTGDEYNVESIDGQPSAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTK  178



>ref|XP_005706768.1| 60S ribosomal protein L5e [Galdieria sulphuraria]
 gb|EME30248.1| 60S ribosomal protein L5e [Galdieria sulphuraria]
Length=299

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVK +RRREGKTDYRAR +LI QD  KY++PKYR VVRFTN+DI
Sbjct  1    MVFVKVVKNKAYFKRFQVKPRRRREGKTDYRARLKLITQDLRKYSSPKYRLVVRFTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            + Q V A + GD IL++AYAHELPRYG++VG TN+AAAY TGLLLARR L+KL + E Y 
Sbjct  61   VCQFVYARLEGDHILSAAYAHELPRYGIKVGLTNFAAAYATGLLLARRTLKKLNLDEVYV  120

Query  422  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G     GE + VEP   RRPFRA LDVGL+RTTTGN+VF A+KGA+DGG+DIPH+EK
Sbjct  121  GKESVDGEFFEVEPQGERRPFRAFLDVGLIRTTTGNKVFAAMKGAVDGGVDIPHNEK  177



>gb|ACN25149.1| ribosomal-like protein [Pectinaria gouldii]
Length=269

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = +2

Query  65   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDII  244
             F+KVQKT AYF R+QVKFKRRREGKTDY AR RLI QDKNKYNTPKYR +VRFTNKDII
Sbjct  3    GFVKVQKTTAYFSRYQVKFKRRREGKTDYFARKRLICQDKNKYNTPKYRLIVRFTNKDII  62

Query  245  AQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYEG  424
             QI  A IAGD I+ SAYAHELPRYGL+VG TNY+AAYCTGLL+ARR+L+KL + + YE 
Sbjct  63   TQIAYARIAGDFIICSAYAHELPRYGLKVGLTNYSAAYCTGLLMARRVLKKLNLDQVYEV  122

Query  425  NVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            N E   E+Y VEP +G   P +  LDVGL RT+TG ++F  LKGA DGGL+IPH  K
Sbjct  123  NTEVQ-EEYHVEPKDGESDPLKVYLDVGLSRTSTGTKLFSVLKGASDGGLNIPHGTK  178



>gb|AAM33437.1| ribosomal protein L5 [Branchiostoma belcheri tsingtauense]
Length=207

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKF+RRREG TDY AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGVTDYYARKRLVIQEKNKYNTPKYRLIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A I GD+I+ +AYAHELPRYG++VG TNYAAAYCTGLLLARR+L+K  +   YE
Sbjct  61   ICQVAYARIEGDVIVCAAYAHELPRYGIKVGLTNYAAAYCTGLLLARRILKKFSLDTIYE  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVF  538
            G  E  G++Y+VE  +G+ RPFR  LDVGL+RT+TG RVF
Sbjct  121  GCTEIDGDEYNVEEVDGQPRPFRCFLDVGLVRTSTGARVF  160



>ref|XP_002588187.1| hypothetical protein BRAFLDRAFT_113823 [Branchiostoma floridae]
 gb|EEN44198.1| hypothetical protein BRAFLDRAFT_113823 [Branchiostoma floridae]
Length=322

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKRFQVKF+RRREG TDY AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGVTDYYARKRLVIQEKNKYNTPKYRLIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I Q+  A I GD+I+++AYAHELPRYG++VG TNYAAAYCTGLLLARR+L+K  +   YE
Sbjct  61   ICQVAYARIEGDIIVSAAYAHELPRYGIKVGLTNYAAAYCTGLLLARRILKKFSLDTIYE  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  +  G++Y+VE  +G+ RPFR  LDVGL+RT+TG RVFGA+KGA+DGGLDIPHS K
Sbjct  121  GCTDIDGDEYNVEEVDGQPRPFRCFLDVGLVRTSTGARVFGAMKGAVDGGLDIPHSTK  178



>ref|XP_010948703.1| PREDICTED: 60S ribosomal protein L5 [Camelus bactrianus]
Length=329

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 150/189 (79%), Gaps = 3/189 (2%)
 Frame = +2

Query  35   AAEAIGAV--TMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKY  208
            A+  +G++   M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKY
Sbjct  22   ASRGLGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKY  81

Query  209  RFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrl  388
            R VVR TN+DII QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRL
Sbjct  82   RMVVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRL  141

Query  389  lqklEMAEEYEGNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldg  565
            L +  M + YEG VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DG
Sbjct  142  LNRFGMDKIYEGQVEVTGDEYNVESIDGQPSAFTCYLDAGLARTTTGNKVFGALKGAVDG  201

Query  566  gldIPHSEK  592
            GL IPHS K
Sbjct  202  GLSIPHSTK  210



>gb|KHJ46023.1| ribosomal L18p/L5e family protein [Trichuris suis]
Length=305

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QVKF+RRR+GKTDY+AR  L+ QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGFLKVVKNKAYFKRYQVKFRRRRQGKTDYQARRFLVVQDKNKYNTPKYRLIVRITNKDV  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            +AQI  A I GD++L SAY+HELPRYG++VG TNYAAAYCTGLLLARR L+K  +   Y+
Sbjct  61   VAQIAYAKIGGDVVLTSAYSHELPRYGVKVGLTNYAAAYCTGLLLARRHLKKRNLDSVYK  120

Query  422  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G  EATGEDY+VE  EG+   FR  LDVGL RTTTG+RVFG +KGA+DGGLDIPH  +
Sbjct  121  GVEEATGEDYNVESEEGQPGAFRCFLDVGLARTTTGSRVFGVMKGAVDGGLDIPHEHR  178



>gb|ADV40159.1| putative 60S ribosomal protein L5 [Latrodectus hesperus]
Length=281

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K ++YFKRFQVKF+RRREGKTDY AR +L+ QDKNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVIKNKSYFKRFQVKFRRRREGKTDYYARVKLVVQDKNKYNTPKYRMIVRFTNKDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GD+I+ +AYAHELPRYG++VG TNYAAAYC GLLLARRLL K +M E Y+
Sbjct  61   ITQIAYARIEGDVIVCAAYAHELPRYGIKVGLTNYAAAYCVGLLLARRLLHKFKMGEIYQ  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G VEA GED+ VE  +G+   FR  LDVGL +TTTG ++FGA+KGA+DGGLDIPHS K
Sbjct  121  GLVEANGEDFCVEDVDGQPGAFRCYLDVGLAKTTTGAKIFGAMKGAVDGGLDIPHSNK  178



>ref|XP_003505203.1| PREDICTED: 60S ribosomal protein L5 [Cricetulus griseus]
 gb|EGW05788.1| 60S ribosomal protein L5 [Cricetulus griseus]
Length=297

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  62   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  241
            M F+KV K +AYFKR+QV+F+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  242  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGlllarrllqklEMAEEYE  421
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTGLLLARRLL +  M + YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  422  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFgalkgaldggldIPHSEK  592
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VFGALKGA+DGGL IPHS K
Sbjct  121  GQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTK  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520