BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050N10

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001266128.1|  E3 ubiquitin-protein ligase RGLG2-like             265   2e-82   Solanum lycopersicum
ref|XP_006338634.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    261   6e-81   Solanum tuberosum [potatoes]
ref|XP_009599491.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       260   1e-80   
gb|AAX20031.1|  RING-finger protein                                     258   5e-80   Capsicum annuum
ref|XP_011101822.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    256   4e-79   
gb|EPS58379.1|  hypothetical protein M569_16435                         248   5e-79   Genlisea aurea
ref|XP_009778227.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    255   1e-78   Nicotiana sylvestris
ref|XP_011097361.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    251   4e-77   
gb|KJB33860.1|  hypothetical protein B456_006G034900                    241   2e-73   Gossypium raimondii
gb|EYU44849.1|  hypothetical protein MIMGU_mgv1a005375mg                240   3e-73   Erythranthe guttata [common monkey flower]
gb|EYU44848.1|  hypothetical protein MIMGU_mgv1a005375mg                240   7e-73   Erythranthe guttata [common monkey flower]
gb|KJB33861.1|  hypothetical protein B456_006G034900                    238   2e-72   Gossypium raimondii
gb|KHG01454.1|  E3 ubiquitin-protein ligase RGLG2 -like protein         239   2e-72   Gossypium arboreum [tree cotton]
ref|XP_007031645.1|  RING domain ligase2 isoform 1                      239   2e-72   
ref|XP_007031647.1|  RING domain ligase2 isoform 3                      239   2e-72   
ref|XP_003618769.1|  E3 ubiquitin-protein ligase RGLG2                  239   2e-72   Medicago truncatula
emb|CDP16621.1|  unnamed protein product                                237   5e-72   Coffea canephora [robusta coffee]
ref|XP_006579983.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    237   8e-72   
ref|XP_002526974.1|  copine, putative                                   236   9e-72   Ricinus communis
ref|XP_003524729.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    237   1e-71   Glycine max [soybeans]
ref|XP_004489546.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    236   1e-71   Cicer arietinum [garbanzo]
gb|KHG01849.1|  E3 ubiquitin-protein ligase RGLG2                       237   1e-71   Gossypium arboreum [tree cotton]
ref|XP_011005559.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       235   2e-71   Populus euphratica
gb|KJB75966.1|  hypothetical protein B456_012G065700                    236   3e-71   Gossypium raimondii
gb|KHG01848.1|  E3 ubiquitin-protein ligase RGLG2                       234   8e-71   Gossypium arboreum [tree cotton]
gb|KHG01850.1|  E3 ubiquitin-protein ligase RGLG2                       234   8e-71   Gossypium arboreum [tree cotton]
ref|XP_003553280.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    235   8e-71   Glycine max [soybeans]
ref|XP_004304674.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       234   1e-70   Fragaria vesca subsp. vesca
gb|KDO82164.1|  hypothetical protein CISIN_1g0427521mg                  230   1e-70   Citrus sinensis [apfelsine]
ref|XP_006438209.1|  hypothetical protein CICLE_v10031509mg             229   2e-70   
gb|KDP46390.1|  hypothetical protein JCGZ_10230                         233   2e-70   Jatropha curcas
ref|XP_003531323.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    233   3e-70   Glycine max [soybeans]
ref|XP_006585247.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    232   3e-70   Glycine max [soybeans]
gb|KHN06536.1|  E3 ubiquitin-protein ligase RGLG2                       231   4e-70   Glycine soja [wild soybean]
ref|XP_010248698.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       231   5e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008458835.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       231   5e-70   Cucumis melo [Oriental melon]
gb|AFN89139.1|  RING-type ubiquitin ligase                              232   5e-70   Mesembryanthemum crystallinum
ref|XP_004142779.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    231   6e-70   Cucumis sativus [cucumbers]
gb|KEH20743.1|  E3 ubiquitin-protein ligase RGLG2-like protein          232   6e-70   Medicago truncatula
ref|XP_007151612.1|  hypothetical protein PHAVU_004G061800g             233   7e-70   Phaseolus vulgaris [French bean]
gb|EPS60918.1|  hypothetical protein M569_13882                         229   7e-70   Genlisea aurea
gb|EYU34755.1|  hypothetical protein MIMGU_mgv1a006209mg                231   7e-70   Erythranthe guttata [common monkey flower]
gb|KDO49015.1|  hypothetical protein CISIN_1g015418mg                   229   1e-69   Citrus sinensis [apfelsine]
ref|XP_002271885.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    231   1e-69   Vitis vinifera
gb|KDO49018.1|  hypothetical protein CISIN_1g015418mg                   229   1e-69   Citrus sinensis [apfelsine]
ref|XP_003524251.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    231   1e-69   Glycine max [soybeans]
ref|XP_010660842.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    231   1e-69   Vitis vinifera
ref|XP_010089180.1|  E3 ubiquitin-protein ligase RGLG2                  231   2e-69   Morus notabilis
ref|XP_011042369.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    230   3e-69   Populus euphratica
ref|XP_006374543.1|  hypothetical protein POPTR_0015s09780g             229   4e-69   
ref|XP_006446649.1|  hypothetical protein CICLE_v10015247mg             229   4e-69   
ref|XP_010029080.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    231   5e-69   
ref|XP_006438208.1|  hypothetical protein CICLE_v10031509mg             229   5e-69   Citrus clementina [clementine]
ref|XP_010029085.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    231   5e-69   Eucalyptus grandis [rose gum]
ref|XP_006483979.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    229   6e-69   
ref|XP_003538591.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    229   8e-69   Glycine max [soybeans]
ref|XP_006591484.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    228   8e-69   Glycine max [soybeans]
gb|KCW59705.1|  hypothetical protein EUGRSUZ_H02465                     228   8e-69   Eucalyptus grandis [rose gum]
ref|XP_006848963.1|  hypothetical protein AMTR_s00166p00070360          228   9e-69   
ref|XP_010100348.1|  E3 ubiquitin-protein ligase RGLG2                  228   9e-69   Morus notabilis
ref|XP_002321646.1|  hypothetical protein POPTR_0015s09780g             227   1e-68   
ref|XP_004504141.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    229   1e-68   Cicer arietinum [garbanzo]
ref|XP_010250995.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    228   1e-68   Nelumbo nucifera [Indian lotus]
ref|XP_004504140.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    229   1e-68   Cicer arietinum [garbanzo]
ref|XP_010250991.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    228   1e-68   Nelumbo nucifera [Indian lotus]
ref|XP_003548557.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    227   2e-68   Glycine max [soybeans]
ref|XP_007222138.1|  hypothetical protein PRUPE_ppa005724mg             228   2e-68   
gb|KHN43980.1|  E3 ubiquitin-protein ligase RGLG2                       227   2e-68   Glycine soja [wild soybean]
gb|KJB11578.1|  hypothetical protein B456_001G266800                    227   2e-68   Gossypium raimondii
gb|KCW59704.1|  hypothetical protein EUGRSUZ_H02465                     228   2e-68   Eucalyptus grandis [rose gum]
ref|XP_004141118.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    227   3e-68   Cucumis sativus [cucumbers]
ref|XP_006470207.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    227   3e-68   Citrus sinensis [apfelsine]
ref|XP_004158327.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    227   3e-68   
gb|KDP31007.1|  hypothetical protein JCGZ_11383                         226   3e-68   Jatropha curcas
ref|XP_010102934.1|  hypothetical protein L484_018953                   221   3e-68   
ref|XP_007159686.1|  hypothetical protein PHAVU_002G258600g             227   4e-68   Phaseolus vulgaris [French bean]
ref|XP_010682022.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    227   5e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011005612.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   6e-68   Populus euphratica
ref|XP_002312658.1|  hypothetical protein POPTR_0008s18400g             226   6e-68   
ref|XP_004502384.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    227   6e-68   Cicer arietinum [garbanzo]
ref|XP_010524290.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    224   6e-68   Tarenaya hassleriana [spider flower]
ref|XP_006379955.1|  hypothetical protein POPTR_0008s18400g             227   7e-68   Populus trichocarpa [western balsam poplar]
ref|XP_003601891.1|  E3 ubiquitin-protein ligase RGLG2                  226   7e-68   Medicago truncatula
gb|AES72143.2|  E3 ubiquitin-protein ligase RGLG2-like protein          226   7e-68   Medicago truncatula
gb|AFK35251.1|  unknown                                                 226   7e-68   Medicago truncatula
gb|AES72144.2|  E3 ubiquitin-protein ligase RGLG2-like protein          226   8e-68   Medicago truncatula
ref|XP_006601923.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   8e-68   Glycine max [soybeans]
ref|XP_011034033.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   8e-68   Populus euphratica
ref|XP_011034031.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   9e-68   Populus euphratica
ref|XP_010026602.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    227   9e-68   
ref|XP_004135284.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    225   9e-68   Cucumis sativus [cucumbers]
gb|KDP26671.1|  hypothetical protein JCGZ_17829                         226   1e-67   Jatropha curcas
ref|XP_010550166.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   1e-67   Tarenaya hassleriana [spider flower]
gb|KHN27569.1|  E3 ubiquitin-protein ligase RGLG2                       225   1e-67   Glycine soja [wild soybean]
ref|XP_011071160.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       226   1e-67   Sesamum indicum [beniseed]
ref|XP_003551971.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   1e-67   Glycine max [soybeans]
ref|XP_006601922.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   1e-67   Glycine max [soybeans]
ref|XP_007163690.1|  hypothetical protein PHAVU_001G255900g             224   2e-67   Phaseolus vulgaris [French bean]
ref|XP_003601892.1|  E3 ubiquitin-protein ligase RGLG2                  226   2e-67   
ref|XP_007044867.1|  Copine family isoform 1                            225   3e-67   
ref|XP_003601893.1|  E3 ubiquitin-protein ligase RGLG2                  226   3e-67   
ref|XP_007163691.1|  hypothetical protein PHAVU_001G255900g             224   4e-67   Phaseolus vulgaris [French bean]
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       231   4e-67   Glycine soja [wild soybean]
ref|XP_002515058.1|  copine, putative                                   225   4e-67   
emb|CDP12686.1|  unnamed protein product                                223   5e-67   Coffea canephora [robusta coffee]
gb|KHN00030.1|  E3 ubiquitin-protein ligase RGLG1                       223   5e-67   Glycine soja [wild soybean]
ref|XP_003555130.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    223   5e-67   Glycine max [soybeans]
ref|XP_006439965.1|  hypothetical protein CICLE_v10020205mg             219   8e-67   
ref|XP_008221938.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       223   8e-67   
ref|XP_010524288.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    223   9e-67   Tarenaya hassleriana [spider flower]
ref|XP_010524289.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    223   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_008446129.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    223   1e-66   Cucumis melo [Oriental melon]
ref|XP_008464939.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    223   1e-66   Cucumis melo [Oriental melon]
ref|XP_002282202.2|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       223   1e-66   Vitis vinifera
ref|XP_008341364.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       223   1e-66   
ref|XP_009371747.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       223   1e-66   Pyrus x bretschneideri [bai li]
gb|KJB51127.1|  hypothetical protein B456_008G202700                    219   1e-66   Gossypium raimondii
ref|XP_002318092.2|  hypothetical protein POPTR_0012s09190g             222   2e-66   
ref|XP_011040451.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    222   2e-66   Populus euphratica
gb|KEH22094.1|  E3 ubiquitin-protein ligase RGLG2-like protein          221   2e-66   Medicago truncatula
gb|ACA04857.1|  putative copine I                                       215   3e-66   Picea abies
ref|XP_010026980.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   5e-66   Eucalyptus grandis [rose gum]
ref|XP_006439964.1|  hypothetical protein CICLE_v10020205mg             220   5e-66   
ref|XP_009370343.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   5e-66   
gb|EYU22544.1|  hypothetical protein MIMGU_mgv1a006738mg                221   5e-66   Erythranthe guttata [common monkey flower]
gb|KHG28565.1|  E3 ubiquitin-protein ligase RGLG2                       221   6e-66   Gossypium arboreum [tree cotton]
gb|KHG28566.1|  E3 ubiquitin-protein ligase RGLG2                       221   6e-66   Gossypium arboreum [tree cotton]
gb|KHG03783.1|  E3 ubiquitin-protein ligase RGLG2 -like protein         222   7e-66   Gossypium arboreum [tree cotton]
ref|XP_006399953.1|  hypothetical protein EUTSA_v10013466mg             221   9e-66   Eutrema salsugineum [saltwater cress]
ref|XP_006476914.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   9e-66   Citrus sinensis [apfelsine]
gb|KJB51128.1|  hypothetical protein B456_008G202700                    219   1e-65   Gossypium raimondii
ref|XP_010912939.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   1e-65   Elaeis guineensis
gb|KJB51125.1|  hypothetical protein B456_008G202700                    219   1e-65   Gossypium raimondii
gb|KDO69439.1|  hypothetical protein CISIN_1g012303mg                   221   1e-65   Citrus sinensis [apfelsine]
gb|KJB51126.1|  hypothetical protein B456_008G202700                    220   1e-65   Gossypium raimondii
gb|KDO69440.1|  hypothetical protein CISIN_1g012303mg                   221   1e-65   Citrus sinensis [apfelsine]
ref|XP_007037786.1|  RING domain ligase2 isoform 1                      220   1e-65   
ref|XP_010420077.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    220   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_003622329.1|  E3 ubiquitin-protein ligase RGLG2                  220   1e-65   Medicago truncatula
ref|XP_010519134.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_006408532.1|  hypothetical protein EUTSA_v10020651mg             220   2e-65   Eutrema salsugineum [saltwater cress]
ref|XP_010927545.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   2e-65   
ref|XP_006439963.1|  hypothetical protein CICLE_v10020205mg             219   2e-65   Citrus clementina [clementine]
gb|KDO69441.1|  hypothetical protein CISIN_1g012303mg                   219   2e-65   Citrus sinensis [apfelsine]
ref|XP_006476915.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   3e-65   Citrus sinensis [apfelsine]
gb|ABK24359.1|  unknown                                                 219   3e-65   Picea sitchensis
gb|KJB51129.1|  hypothetical protein B456_008G202700                    219   3e-65   Gossypium raimondii
gb|EPS73512.1|  hypothetical protein M569_01244                         218   3e-65   Genlisea aurea
gb|KJB51124.1|  hypothetical protein B456_008G202700                    219   3e-65   Gossypium raimondii
ref|XP_010932261.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   4e-65   Elaeis guineensis
ref|XP_010927546.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    216   7e-65   
ref|XP_004236287.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       218   8e-65   Solanum lycopersicum
ref|XP_004138080.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   8e-65   Cucumis sativus [cucumbers]
ref|XP_008797006.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   1e-64   
ref|XP_002298557.2|  hypothetical protein POPTR_0001s35660g             218   1e-64   
ref|XP_007215340.1|  hypothetical protein PRUPE_ppa005347mg             218   1e-64   Prunus persica
ref|XP_009419388.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008464499.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    217   1e-64   Cucumis melo [Oriental melon]
ref|XP_006351421.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    217   1e-64   Solanum tuberosum [potatoes]
gb|KCW52958.1|  hypothetical protein EUGRSUZ_J02261                     217   1e-64   Eucalyptus grandis [rose gum]
ref|XP_008379181.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   1e-64   
gb|KGN63523.1|  hypothetical protein Csa_1G002920                       218   1e-64   
emb|CDX70564.1|  BnaC03g06480D                                          218   1e-64   
ref|NP_001240870.1|  uncharacterized protein LOC100809850               217   2e-64   Glycine max [soybeans]
gb|KJB61002.1|  hypothetical protein B456_009G335200                    218   2e-64   Gossypium raimondii
ref|XP_011101825.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    215   2e-64   
ref|XP_010927542.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    217   2e-64   
gb|EEE53061.1|  hypothetical protein OsJ_35797                          214   3e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131405.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    217   3e-64   Brassica rapa
ref|XP_006297977.1|  hypothetical protein CARUB_v10014021mg             214   3e-64   
ref|XP_007137991.1|  hypothetical protein PHAVU_009G171800g             216   3e-64   Phaseolus vulgaris [French bean]
ref|XP_010492244.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    217   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009131403.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    217   3e-64   Brassica rapa
ref|XP_010453560.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       217   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002884269.1|  hypothetical protein ARALYDRAFT_896079             216   3e-64   
ref|XP_006857662.1|  hypothetical protein AMTR_s00061p00153710          214   6e-64   
ref|XP_010531508.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    216   6e-64   
ref|XP_011071995.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    215   7e-64   Sesamum indicum [beniseed]
ref|XP_010033344.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    215   7e-64   
emb|CDX78576.1|  BnaA03g04880D                                          216   8e-64   
emb|CDY37509.1|  BnaA05g33740D                                          216   9e-64   Brassica napus [oilseed rape]
ref|XP_010033343.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    215   9e-64   Eucalyptus grandis [rose gum]
ref|XP_010485387.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    216   9e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010904547.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       216   1e-63   Elaeis guineensis
ref|XP_009147449.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    215   1e-63   Brassica rapa
ref|XP_006287685.1|  hypothetical protein CARUB_v10000894mg             213   1e-63   
ref|XP_006664503.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    215   1e-63   
ref|XP_002511290.1|  copine, putative                                   214   1e-63   Ricinus communis
emb|CDY09854.1|  BnaC09g43070D                                          215   1e-63   Brassica napus [oilseed rape]
emb|CDY49066.1|  BnaC05g48940D                                          215   1e-63   Brassica napus [oilseed rape]
ref|XP_004309992.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    214   2e-63   Fragaria vesca subsp. vesca
emb|CDX69581.1|  BnaA10g19300D                                          215   2e-63   
ref|XP_009121662.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    215   2e-63   Brassica rapa
ref|NP_186814.1|  E3 ubiquitin-protein ligase RGLG1                     215   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008807474.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    215   2e-63   
ref|XP_009147448.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    215   2e-63   Brassica rapa
emb|CDX91935.1|  BnaC03g32370D                                          214   3e-63   
gb|ACR36132.1|  unknown                                                 216   3e-63   Zea mays [maize]
ref|XP_006287684.1|  hypothetical protein CARUB_v10000894mg             214   3e-63   Capsella rubella
ref|XP_004970988.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    214   3e-63   Setaria italica
ref|NP_196946.1|  E3 ubiquitin-protein ligase RGLG2                     214   3e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CAN81848.1|  hypothetical protein VITISV_036819                     213   4e-63   Vitis vinifera
ref|XP_010496283.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       214   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_007209145.1|  hypothetical protein PRUPE_ppa005852mg             213   4e-63   Prunus persica
ref|XP_008230495.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    214   5e-63   Prunus mume [ume]
ref|XP_009795957.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    213   5e-63   Nicotiana sylvestris
ref|XP_002873665.1|  hypothetical protein ARALYDRAFT_488284             214   5e-63   
ref|NP_001150002.1|  copine family protein                              215   6e-63   Zea mays [maize]
ref|XP_009125973.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       213   6e-63   Brassica rapa
ref|XP_008786705.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    214   7e-63   Phoenix dactylifera
ref|XP_003526988.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    213   7e-63   Glycine max [soybeans]
gb|KJB31093.1|  hypothetical protein B456_005G175700                    213   7e-63   Gossypium raimondii
ref|XP_009403629.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       213   7e-63   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX74310.1|  BnaA03g27370D                                          213   7e-63   
emb|CDX91062.1|  BnaC02g05350D                                          213   8e-63   
ref|XP_009134597.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       213   1e-62   Brassica rapa
gb|AFW76346.1|  hypothetical protein ZEAMMB73_695996                    209   1e-62   
ref|XP_006646587.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    211   1e-62   Oryza brachyantha
ref|XP_010044533.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    212   1e-62   Eucalyptus grandis [rose gum]
ref|XP_010435648.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    213   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004962600.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    214   1e-62   Setaria italica
ref|XP_008239359.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    212   1e-62   Prunus mume [ume]
ref|XP_010044532.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    213   1e-62   Eucalyptus grandis [rose gum]
ref|XP_010044531.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    213   1e-62   Eucalyptus grandis [rose gum]
dbj|BAD35623.1|  unknown protein                                        211   2e-62   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146212.1|  uncharacterized protein LOC100279782               212   2e-62   Zea mays [maize]
tpg|DAA56240.1|  TPA: hypothetical protein ZEAMMB73_877987              212   2e-62   
tpg|DAA56239.1|  TPA: hypothetical protein ZEAMMB73_877987              212   2e-62   
ref|XP_009608151.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    211   2e-62   Nicotiana tomentosiformis
ref|XP_002458953.1|  hypothetical protein SORBIDRAFT_03g043290          212   2e-62   Sorghum bicolor [broomcorn]
ref|NP_001066593.1|  Os12g0288400                                       214   2e-62   
dbj|BAH19894.1|  AT5G14420                                              212   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682339.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    212   3e-62   
gb|EEC69114.1|  hypothetical protein OsI_38028                          214   4e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_002279018.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       210   5e-62   Vitis vinifera
gb|EYU44842.1|  hypothetical protein MIMGU_mgv1a024648mg                209   5e-62   Erythranthe guttata [common monkey flower]
ref|NP_001058043.1|  Os06g0608800                                       211   6e-62   
gb|EEC80951.1|  hypothetical protein OsI_23663                          211   6e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_004965913.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    210   7e-62   Setaria italica
ref|XP_010682336.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    211   8e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU22209.1|  hypothetical protein MIMGU_mgv1a006782mg                210   9e-62   Erythranthe guttata [common monkey flower]
ref|XP_003578709.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    212   9e-62   Brachypodium distachyon [annual false brome]
ref|NP_001147447.1|  copine-1                                           210   1e-61   Zea mays [maize]
ref|XP_008650441.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    209   1e-61   
ref|XP_004299159.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    209   1e-61   Fragaria vesca subsp. vesca
ref|XP_009412691.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    209   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY27584.1|  BnaA09g28230D                                          203   2e-61   Brassica napus [oilseed rape]
ref|NP_001145987.1|  uncharacterized protein LOC100279516               210   2e-61   Zea mays [maize]
gb|AFW84239.1|  hypothetical protein ZEAMMB73_082799                    210   3e-61   
gb|ACN85268.1|  copine-1                                                209   3e-61   Oryza alta
ref|XP_006656233.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    209   3e-61   Oryza brachyantha
ref|XP_008389744.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    209   3e-61   
emb|CDP13252.1|  unnamed protein product                                208   4e-61   Coffea canephora [robusta coffee]
ref|XP_011005762.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   4e-61   Populus euphratica
ref|XP_004502383.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    209   5e-61   Cicer arietinum [garbanzo]
ref|XP_008778640.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    205   5e-61   
gb|EYU44844.1|  hypothetical protein MIMGU_mgv1a019091mg                206   6e-61   Erythranthe guttata [common monkey flower]
ref|XP_010252862.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   6e-61   Nelumbo nucifera [Indian lotus]
dbj|BAJ96252.1|  predicted protein                                      208   6e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX84957.1|  BnaC05g20980D                                          206   7e-61   
ref|NP_001045146.1|  Os01g0908700                                       207   7e-61   
gb|EMS50180.1|  E3 ubiquitin-protein ligase RGLG2                       208   7e-61   Triticum urartu
ref|XP_003564886.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       208   8e-61   Brachypodium distachyon [annual false brome]
gb|EMT11740.1|  hypothetical protein F775_05193                         208   9e-61   
ref|XP_002315654.1|  hypothetical protein POPTR_0010s05940g             206   1e-60   
gb|EEE55855.1|  hypothetical protein OsJ_04480                          207   1e-60   Oryza sativa Japonica Group [Japonica rice]
gb|EMS57170.1|  hypothetical protein TRIUR3_17359                       207   1e-60   Triticum urartu
ref|XP_010942537.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    206   1e-60   Elaeis guineensis
ref|XP_008357726.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    208   2e-60   
gb|EEC72000.1|  hypothetical protein OsI_04857                          207   2e-60   Oryza sativa Indica Group [Indian rice]
dbj|BAB92575.1|  P0497A05.19                                            208   2e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KDP35547.1|  hypothetical protein JCGZ_08985                         206   2e-60   Jatropha curcas
ref|XP_002308745.1|  hypothetical protein POPTR_0006s00450g             205   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010246555.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    206   2e-60   Nelumbo nucifera [Indian lotus]
dbj|BAK07422.1|  predicted protein                                      207   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABG34341.1|  copine-like protein                                     207   3e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009359243.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       206   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_003563639.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    206   4e-60   Brachypodium distachyon [annual false brome]
ref|XP_008778633.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    205   4e-60   
gb|KEH35020.1|  E3 ubiquitin-protein ligase RGLG2-like protein          205   4e-60   
ref|XP_010647336.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    205   5e-60   
dbj|BAJ99595.1|  predicted protein                                      207   5e-60   
ref|XP_006415815.1|  hypothetical protein EUTSA_v10007950mg             203   6e-60   
ref|XP_009417358.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    203   9e-60   
ref|XP_009113808.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    203   1e-59   
ref|XP_004501852.1|  PREDICTED: uncharacterized protein LOC101503410    211   1e-59   
ref|XP_011096142.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    203   2e-59   
ref|XP_009417355.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    202   2e-59   
ref|XP_008340126.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       204   3e-59   
ref|XP_009385432.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    202   3e-59   
gb|EYU44845.1|  hypothetical protein MIMGU_mgv1a011343mg                199   4e-59   
ref|XP_009623420.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    198   5e-59   
ref|XP_009395842.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    201   6e-59   
ref|XP_008794750.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    201   7e-59   
ref|XP_010927541.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    199   1e-58   
ref|XP_010033345.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    200   1e-58   
ref|XP_010415369.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    201   1e-58   
ref|XP_010246559.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    197   2e-58   
ref|XP_010470709.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    201   2e-58   
gb|KHN34573.1|  E3 ubiquitin-protein ligase RGLG1                       199   2e-58   
ref|XP_010511739.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    201   2e-58   
ref|XP_010415367.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    201   3e-58   
ref|XP_010928040.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    200   3e-58   
ref|XP_010470708.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    201   3e-58   
ref|XP_006391217.1|  hypothetical protein EUTSA_v10019546mg             201   4e-58   
ref|XP_010511738.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    201   5e-58   
gb|EYU44847.1|  hypothetical protein MIMGU_mgv1a009476mg                196   5e-58   
ref|XP_010927540.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    199   5e-58   
ref|XP_008797058.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    199   6e-58   
ref|XP_010928039.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    200   6e-58   
ref|XP_006301528.1|  hypothetical protein CARUB_v10021966mg             199   7e-58   
gb|EMT11739.1|  hypothetical protein F775_05192                         199   7e-58   
ref|XP_010927538.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    199   8e-58   
ref|XP_002888625.1|  hypothetical protein ARALYDRAFT_475885             200   9e-58   
ref|XP_009792794.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    196   1e-57   
ref|XP_008797027.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    199   1e-57   
ref|XP_010052495.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    198   1e-57   
ref|XP_009792793.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    196   2e-57   
gb|EYU44846.1|  hypothetical protein MIMGU_mgv1a009476mg                196   2e-57   
gb|EYU44843.1|  hypothetical protein MIMGU_mgv1a018122mg                195   2e-57   
ref|XP_002977516.1|  hypothetical protein SELMODRAFT_176218             197   2e-57   
ref|NP_564907.1|  Copine (Calcium-dependent phospholipid-binding ...    198   2e-57   
ref|XP_002972204.1|  hypothetical protein SELMODRAFT_148275             197   2e-57   
gb|KDO49014.1|  hypothetical protein CISIN_1g015418mg                   197   2e-57   
ref|XP_002525032.1|  copine, putative                                   197   3e-57   
ref|XP_009333912.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    198   4e-57   
ref|NP_849857.1|  Copine (Calcium-dependent phospholipid-binding ...    198   4e-57   
ref|XP_007159860.1|  hypothetical protein PHAVU_002G273900g             197   5e-57   
ref|XP_006307662.1|  hypothetical protein CARUB_v10009290mg             196   5e-57   
ref|XP_009589142.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    196   5e-57   
emb|CDY01855.1|  BnaC06g28950D                                          197   6e-57   
ref|XP_006349743.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    197   6e-57   
ref|XP_009769353.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    196   7e-57   
ref|XP_006349745.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    196   8e-57   
ref|XP_009105330.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       197   8e-57   
emb|CDY56212.1|  BnaAnng14100D                                          197   8e-57   
ref|XP_008367487.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    197   9e-57   
ref|XP_008374368.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    197   9e-57   
ref|XP_009589140.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    196   1e-56   
ref|XP_010251001.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   1e-56   
ref|XP_010470707.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    200   1e-56   
ref|XP_009769351.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    196   1e-56   
ref|XP_002890706.1|  hypothetical protein ARALYDRAFT_890218             195   2e-56   
ref|XP_006307664.1|  hypothetical protein CARUB_v10009290mg             195   3e-56   
ref|XP_004247214.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       195   3e-56   
ref|XP_009617437.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    192   4e-56   
ref|XP_010478000.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    194   6e-56   
ref|XP_010499161.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    193   8e-56   
dbj|BAJ95185.1|  predicted protein                                      194   1e-55   
ref|XP_011099706.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       194   1e-55   
ref|XP_006659095.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    192   1e-55   
ref|NP_001062128.1|  Os08g0494300                                       192   1e-55   
ref|XP_010460441.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    193   2e-55   
ref|XP_010251000.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    187   2e-55   
gb|ADZ04649.1|  hypothetical protein                                    193   2e-55   
ref|XP_002516315.1|  copine, putative                                   191   2e-55   
ref|XP_010250997.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    187   2e-55   
ref|XP_009366697.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    191   3e-55   
ref|XP_009366698.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    191   3e-55   
ref|XP_009366700.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    190   3e-55   
ref|XP_004502961.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    193   3e-55   
gb|EEC82864.1|  hypothetical protein OsI_27723                          192   3e-55   
ref|NP_001060941.1|  Os08g0135400                                       192   3e-55   
ref|XP_004502959.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    192   3e-55   
ref|XP_009366696.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    191   4e-55   
gb|KDO51651.1|  hypothetical protein CISIN_1g0139001mg                  192   4e-55   
gb|ADZ04633.1|  hypothetical protein                                    192   5e-55   
ref|XP_006432148.1|  hypothetical protein CICLE_v100012031mg            191   5e-55   
ref|XP_009366693.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    191   5e-55   
ref|XP_003602643.1|  E3 ubiquitin-protein ligase mib1                   192   6e-55   
gb|KEH35604.1|  E3 ubiquitin-protein ligase RGLG2-like protein          192   6e-55   
gb|AES72894.2|  E3 ubiquitin-protein ligase RGLG2-like protein          192   7e-55   
ref|XP_011014300.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    191   7e-55   
dbj|BAJ90048.1|  predicted protein                                      191   8e-55   
gb|KEH35605.1|  E3 ubiquitin-protein ligase RGLG2-like protein          192   9e-55   
ref|XP_008355636.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   9e-55   
ref|XP_006465084.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    191   9e-55   
gb|EAZ37602.1|  hypothetical protein OsJ_21935                          189   1e-54   
ref|XP_003525130.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    191   1e-54   
ref|XP_011022915.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   2e-54   
ref|XP_011040117.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   2e-54   
ref|XP_011014272.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    190   2e-54   
gb|EMT16285.1|  hypothetical protein F775_32201                         194   3e-54   
ref|XP_004293813.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   3e-54   
ref|XP_006578783.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   4e-54   
ref|XP_010674439.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       188   4e-54   
gb|EYU27634.1|  hypothetical protein MIMGU_mgv1a009116mg                187   4e-54   
gb|KHN31170.1|  E3 ubiquitin-protein ligase RGLG1                       189   5e-54   
ref|XP_006373569.1|  hypothetical protein POPTR_0016s00470g             188   5e-54   
ref|XP_006578782.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   5e-54   
ref|XP_002316157.2|  hypothetical protein POPTR_0010s18200g             189   6e-54   
ref|XP_011031152.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   6e-54   
ref|XP_011040112.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    188   6e-54   
ref|XP_003523218.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   6e-54   
ref|XP_007137784.1|  hypothetical protein PHAVU_009G155300g             189   6e-54   
ref|XP_011031151.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   6e-54   
ref|XP_007137785.1|  hypothetical protein PHAVU_009G155300g             189   7e-54   
gb|KDP27728.1|  hypothetical protein JCGZ_19705                         188   8e-54   
ref|XP_007212314.1|  hypothetical protein PRUPE_ppa006783mg             187   9e-54   
ref|XP_001761538.1|  predicted protein                                  185   9e-54   
ref|XP_011465074.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    187   1e-53   
ref|XP_006422303.1|  hypothetical protein CICLE_v10005036mg             186   1e-53   
ref|XP_007048456.1|  Copine (Calcium-dependent phospholipid-bindi...    187   1e-53   
ref|XP_006855118.1|  hypothetical protein AMTR_s00031p00212930          187   1e-53   
ref|XP_007212315.1|  hypothetical protein PRUPE_ppa006783mg             186   2e-53   
gb|KDP31456.1|  hypothetical protein JCGZ_15336                         188   2e-53   
ref|XP_002306262.2|  hypothetical protein POPTR_0005s06680g             187   2e-53   
ref|XP_004488557.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    187   2e-53   
ref|XP_010649350.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   2e-53   
ref|XP_004288136.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    187   2e-53   
ref|XP_006382872.1|  hypothetical protein POPTR_0005s06680g             187   2e-53   
ref|XP_003631930.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   2e-53   
ref|XP_007048452.1|  Copine family isoform 3                            187   2e-53   
gb|EYU20648.1|  hypothetical protein MIMGU_mgv1a007011mg                187   2e-53   
ref|XP_002309925.1|  hypothetical protein POPTR_0007s04370g             186   2e-53   
ref|XP_002974682.1|  hypothetical protein SELMODRAFT_102156             187   3e-53   
ref|XP_007048455.1|  Copine family isoform 6                            187   3e-53   
ref|XP_006422304.1|  hypothetical protein CICLE_v10005036mg             186   3e-53   
ref|XP_007048450.1|  Copine family isoform 1                            187   3e-53   
ref|XP_010649348.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   3e-53   
ref|XP_010247786.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    187   3e-53   
ref|XP_002266834.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   3e-53   
ref|XP_007212316.1|  hypothetical protein PRUPE_ppa006783mg             186   3e-53   
ref|XP_007048451.1|  Copine family isoform 2                            187   4e-53   
ref|XP_011031153.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   4e-53   
ref|XP_004973794.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    187   4e-53   
ref|XP_008227410.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    185   4e-53   
ref|XP_010907788.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       186   5e-53   
ref|XP_003574693.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    186   5e-53   
ref|XP_008225986.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       187   5e-53   
ref|XP_009782421.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       187   5e-53   
ref|XP_009340213.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   5e-53   
ref|XP_009340215.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   5e-53   
ref|XP_002963397.1|  hypothetical protein SELMODRAFT_141864             186   5e-53   
ref|XP_008648442.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    186   6e-53   
ref|XP_010905316.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   6e-53   
gb|KDO61520.1|  hypothetical protein CISIN_1g042398mg                   186   7e-53   
ref|XP_006422305.1|  hypothetical protein CICLE_v10005036mg             186   8e-53   
gb|EMS53474.1|  E3 ubiquitin-protein ligase RGLG2                       190   8e-53   
gb|KJB48938.1|  hypothetical protein B456_008G094400                    183   9e-53   
ref|XP_008227408.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    185   1e-52   
gb|AFW83893.1|  hypothetical protein ZEAMMB73_890555                    179   1e-52   
ref|XP_007022766.1|  Ca(2)-dependent phospholipid-binding protein...    185   1e-52   
ref|XP_008797050.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    185   1e-52   
dbj|BAJ90588.1|  predicted protein                                      185   1e-52   
ref|XP_002444822.1|  hypothetical protein SORBIDRAFT_07g028640          185   1e-52   
gb|KJB81449.1|  hypothetical protein B456_013G146400                    182   1e-52   
gb|KEH19335.1|  calcium-dependent phospholipid-binding copine fam...    182   2e-52   
gb|KEH38212.1|  E3 ubiquitin-protein ligase RGLG2-like protein          184   2e-52   
ref|XP_007022765.1|  Ca(2)-dependent phospholipid-binding protein...    185   2e-52   
ref|XP_007211456.1|  hypothetical protein PRUPE_ppa007341mg             184   2e-52   
ref|XP_010528712.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    184   2e-52   
gb|KJB48931.1|  hypothetical protein B456_008G094400                    184   2e-52   
ref|XP_010528713.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   2e-52   
gb|KJB48932.1|  hypothetical protein B456_008G094400                    184   2e-52   
ref|XP_009607653.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       183   3e-52   
emb|CDP11374.1|  unnamed protein product                                186   3e-52   
emb|CAN77261.1|  hypothetical protein VITISV_024760                     186   3e-52   
ref|XP_010270329.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       184   3e-52   
gb|KJB48935.1|  hypothetical protein B456_008G094400                    184   4e-52   
ref|XP_006585725.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   4e-52   
ref|XP_006598024.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    184   5e-52   
gb|KJB48934.1|  hypothetical protein B456_008G094400                    184   5e-52   
ref|XP_009340139.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   5e-52   
ref|XP_008797041.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    184   5e-52   
ref|XP_010645087.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   5e-52   
ref|XP_011013356.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    181   6e-52   
ref|XP_010528715.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    182   6e-52   
ref|XP_010927544.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    184   7e-52   
ref|XP_003620808.1|  E3 ubiquitin-protein ligase RGLG2                  179   7e-52   
ref|XP_001757898.1|  predicted protein                                  184   7e-52   
ref|XP_009387980.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   8e-52   
gb|EMT09647.1|  E3 ubiquitin-protein ligase RGLG1                       184   8e-52   
ref|XP_003546661.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   8e-52   
ref|XP_008781601.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    182   8e-52   
gb|KEH38211.1|  E3 ubiquitin-protein ligase RGLG2-like protein          183   8e-52   
gb|EMS57413.1|  E3 ubiquitin-protein ligase RGLG2                       183   9e-52   
ref|XP_006365458.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    184   9e-52   
emb|CDP04648.1|  unnamed protein product                                184   1e-51   
ref|XP_008781600.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    182   1e-51   
ref|XP_006365459.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    184   1e-51   
gb|KJB81448.1|  hypothetical protein B456_013G146400                    182   1e-51   
ref|XP_011095831.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   1e-51   
gb|KCW54196.1|  hypothetical protein EUGRSUZ_I00183                     181   1e-51   
ref|XP_011095832.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   1e-51   
ref|XP_003531811.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    183   1e-51   
ref|XP_004972924.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    182   1e-51   
ref|XP_003620903.1|  E3 ubiquitin-protein ligase RGLG2                  180   1e-51   
gb|KHN46290.1|  E3 ubiquitin-protein ligase RGLG2                       184   1e-51   
gb|KJB81444.1|  hypothetical protein B456_013G146400                    182   1e-51   
ref|XP_004239841.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       183   1e-51   
ref|XP_010547672.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    181   1e-51   
ref|XP_007022767.1|  Copine I-like protein isoform 3                    180   1e-51   
gb|KJB81445.1|  hypothetical protein B456_013G146400                    182   1e-51   
ref|XP_010528709.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    181   2e-51   
ref|XP_009340558.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    181   2e-51   
gb|EPS71527.1|  hypothetical protein M569_03231                         181   2e-51   
gb|KHG01421.1|  E3 ubiquitin-protein ligase RGLG1 -like protein         182   2e-51   
ref|XP_010092471.1|  E3 ubiquitin-protein ligase RGLG2                  182   2e-51   
gb|KJB81447.1|  hypothetical protein B456_013G146400                    182   2e-51   



>ref|NP_001266128.1| E3 ubiquitin-protein ligase RGLG2-like [Solanum lycopersicum]
 ref|XP_010315864.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Solanum lycopersicum]
 gb|AGL95793.1| RING-finger protein [Solanum lycopersicum]
Length=492

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 167/219 (76%), Gaps = 23/219 (11%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswN-YEYPQTAYP----------------PQPQESYNYPV  150
            MGGKSSR+DSWRQAS + SSSWN Y+YPQTAYP                P P    NYP 
Sbjct  1    MGGKSSREDSWRQASSTRSSSWNQYDYPQTAYPQDSYSYSQQTAVPSYAPPPPSQQNYPP  60

Query  151  QHaypsyappppqeqqypppsqDFASRNHA-PPQRRLDRRYSRIADNYNSLEEVTEALAR  327
            QH +   + P      +     +  SR H   P+ RLDRRYSRIADNYNSL+EVTEALAR
Sbjct  61   QHQHNYSSQPQQNYASH-----EHESRTHTHAPRPRLDRRYSRIADNYNSLDEVTEALAR  115

Query  328  AGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNL  507
            AGLESSNLIVGIDFTKSNEWTGK+SF+ RSLH+IG  LNPYEQAISIIGKTLAAFD+DNL
Sbjct  116  AGLESSNLIVGIDFTKSNEWTGKRSFSNRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNL  175

Query  508  IPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IPCFGFGDASTHDQDVFSF+P+ERFCNGFEEVLS YREI
Sbjct  176  IPCFGFGDASTHDQDVFSFFPNERFCNGFEEVLSRYREI  214



>ref|XP_006338634.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Solanum tuberosum]
Length=485

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 170/210 (81%), Gaps = 12/210 (6%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswN-YEYPQTAYPPQPQESYNYPVQHa--ypsyappppqe  192
            MGGKSSR+DSWRQAS + SSSWN Y+YPQTAYP   Q+SY+Y  Q A    +  PP  Q 
Sbjct  1    MGGKSSREDSWRQASSTRSSSWNQYDYPQTAYP---QDSYSYSQQAAVPSYAPPPPSQQN  57

Query  193  qqypppsqDFASRNHA------PPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLI  354
               P P  ++AS  H        P+ RLDRRYSRIADNYNSL+EVTEALARAGLESSNLI
Sbjct  58   FPPPQPQHNYASHEHESLPHAHAPRPRLDRRYSRIADNYNSLDEVTEALARAGLESSNLI  117

Query  355  VGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDA  534
            VGIDFTKSNEWTGK+SF  RSLH+IG  LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDA
Sbjct  118  VGIDFTKSNEWTGKRSFGNRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDA  177

Query  535  STHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            STHDQDVF+F+PDERFCNGFEEVLS YREI
Sbjct  178  STHDQDVFNFFPDERFCNGFEEVLSRYREI  207



>ref|XP_009599491.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nicotiana tomentosiformis]
 ref|XP_009599492.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nicotiana tomentosiformis]
Length=485

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 158/203 (78%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqy  201
            MGGKSSR+DSWRQ S + SS   Y YPQT      Q+SYNYP  H   +     P   Q 
Sbjct  1    MGGKSSREDSWRQTSSTRSSWNQYNYPQTQSSYPQQDSYNYPPSHHQQAVPSYAPPPPQQ  60

Query  202  pppsqDFASRNHAP--PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  375
              P      +N+    P+ RLDRRYSRIADNY+SL+EVTEALAR GLESSNLIVGIDFTK
Sbjct  61   SYPPPPPQQQNYPSHVPKPRLDRRYSRIADNYSSLDEVTEALAREGLESSNLIVGIDFTK  120

Query  376  SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  555
            SNEWTGK+SF GRSLH+IG  LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDV
Sbjct  121  SNEWTGKRSFGGRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDV  180

Query  556  FSFYPDERFCNGFEEVLSXYREI  624
            FSF+PDERFCNGFEEVLS YREI
Sbjct  181  FSFFPDERFCNGFEEVLSRYREI  203



>gb|AAX20031.1| RING-finger protein [Capsicum annuum]
Length=484

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 161/212 (76%), Gaps = 17/212 (8%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQT--AYPPQPQESYNYPVQHaypsyappppqeq  195
            MGGKSSR+DSWRQ S + SS   YEYP T  + P  PQ+SY+Y  Q        PPP  Q
Sbjct  1    MGGKSSREDSWRQTSSTRSSWNQYEYPPTHSSSPSYPQDSYSYSSQQQAVPSYAPPPPHQ  60

Query  196  qypppsqDFASRNHAPPQR---------RLDRRYSRIADNYNSLEEVTEALARAGLESSN  348
            Q         S   APPQ+         RLDRRYSRIADNYNSL+EVTEALARAGLESSN
Sbjct  61   QA------VPSYAPAPPQQNYASHASRPRLDRRYSRIADNYNSLDEVTEALARAGLESSN  114

Query  349  LIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFG  528
            LIVGIDFTKSNEWTGK+SF  RSLH+IG  LNPYEQAISIIGKTLAAFD+DNLIPCFGFG
Sbjct  115  LIVGIDFTKSNEWTGKRSFGNRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNLIPCFGFG  174

Query  529  DASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            DASTHDQDVFSF+PDERFCNGFEEVL  YREI
Sbjct  175  DASTHDQDVFSFFPDERFCNGFEEVLFRYREI  206



>ref|XP_011101822.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
 ref|XP_011101823.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
 ref|XP_011101824.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
Length=464

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 153/191 (80%), Gaps = 16/191 (8%)
 Frame = +1

Query  91   YEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsq-DFASRNHAP--------  243
            ++Y Q++Y    Q + NYP QH YP+ A  PPQ +    P      S+ HAP        
Sbjct  28   HQYAQSSYS---QYAQNYPAQHPYPAPAGYPPQNEYCASPQNYGTQSQAHAPSQNNGPQF  84

Query  244  ----PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
                PQ++LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK+S+NG
Sbjct  85   QLHAPQKQLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKRSYNG  144

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            RSLH+IG GLNPYEQAISI+GKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG
Sbjct  145  RSLHHIGSGLNPYEQAISIVGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  204

Query  592  FEEVLSXYREI  624
            FEEVLS YREI
Sbjct  205  FEEVLSRYREI  215



>gb|EPS58379.1| hypothetical protein M569_16435, partial [Genlisea aurea]
Length=251

 Score =   248 bits (634),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQR+LDRRYSRIADNY SLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS+NGRSLH
Sbjct  84   PQRKLDRRYSRIADNYRSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSYNGRSLH  143

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            NIG GLNPYEQAISIIGKTLAAFDDDNLIPC+GFGDASTHDQDVFSF PD+RFC GFEEV
Sbjct  144  NIGSGLNPYEQAISIIGKTLAAFDDDNLIPCYGFGDASTHDQDVFSFNPDDRFCVGFEEV  203

Query  604  LSXYREI  624
            LS YREI
Sbjct  204  LSRYREI  210



>ref|XP_009778227.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 ref|XP_009778228.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 gb|AGL95792.1| RING-finger protein [Nicotiana tabacum]
Length=486

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsy----appppq  189
            MGGKSSR+DSWRQ S + SS   Y YPQT      Q+SYNYP  H +       APPPPQ
Sbjct  1    MGGKSSREDSWRQTSSTRSSWNQYNYPQTQSSYPQQDSYNYPPSHHHQQAVPSYAPPPPQ  60

Query  190  eqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDF  369
            +   PPP Q     +H P + RLDRRYSRIADNY+SL+EVTEALAR GLESSNLIVGIDF
Sbjct  61   QNYPPPPPQQQNYPSHVP-KPRLDRRYSRIADNYSSLDEVTEALAREGLESSNLIVGIDF  119

Query  370  TKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQ  549
            TKSNEWTGK+SF  RSLH+IG  LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQ
Sbjct  120  TKSNEWTGKRSFGSRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQ  179

Query  550  DVFSFYPDERFCNGFEEVLSXYREI  624
            DVFSF+PDERFC GFEEVLS YREI
Sbjct  180  DVFSFFPDERFCYGFEEVLSRYREI  204



>ref|XP_011097361.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
 ref|XP_011097362.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
 ref|XP_011097363.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
Length=474

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQ++LDRRYSRIADNY SLEEVTEALARAGLESSNLI+GIDFTKSNEWTGK+S+NGRSLH
Sbjct  97   PQKKLDRRYSRIADNYRSLEEVTEALARAGLESSNLIIGIDFTKSNEWTGKRSYNGRSLH  156

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG GLNPYEQAI+IIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV
Sbjct  157  HIGSGLNPYEQAITIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  216

Query  604  LSXYREI  624
            LS YRE+
Sbjct  217  LSRYREL  223



>gb|KJB33860.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
Length=459

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            N    +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  67   NRGSDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  126

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            +SLH+IG+ LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPD+RFCNG
Sbjct  127  KSLHHIGNSLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDDRFCNG  186

Query  592  FEEVLSXYREI  624
            FEEVLS YREI
Sbjct  187  FEEVLSRYREI  197



>gb|EYU44849.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
 gb|EYU44850.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
Length=460

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 136/171 (80%), Gaps = 19/171 (11%)
 Frame = +1

Query  112  YPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNY  291
            YPPQ  E+ ++P Q+  P                   +S+ H P +++LDRRYSRIADNY
Sbjct  67   YPPQSYETPSHPPQNTGP-------------------SSQQHVPQKKKLDRRYSRIADNY  107

Query  292  NSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISII  471
            NSL EVTEAL  AGLESSNLIVGIDFTKSNEWTGK+S+NGRSLH+IG+GLNPYEQAISII
Sbjct  108  NSLHEVTEALKHAGLESSNLIVGIDFTKSNEWTGKRSYNGRSLHHIGNGLNPYEQAISII  167

Query  472  GKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            GKTLAAFDDDNLIPCFGFGDASTHDQ+VFSF  D+RF NGFEEVLS YREI
Sbjct  168  GKTLAAFDDDNLIPCFGFGDASTHDQNVFSFNSDDRFSNGFEEVLSQYREI  218



>gb|EYU44848.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
Length=486

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 136/171 (80%), Gaps = 19/171 (11%)
 Frame = +1

Query  112  YPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNY  291
            YPPQ  E+ ++P Q+  P                   +S+ H P +++LDRRYSRIADNY
Sbjct  67   YPPQSYETPSHPPQNTGP-------------------SSQQHVPQKKKLDRRYSRIADNY  107

Query  292  NSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISII  471
            NSL EVTEAL  AGLESSNLIVGIDFTKSNEWTGK+S+NGRSLH+IG+GLNPYEQAISII
Sbjct  108  NSLHEVTEALKHAGLESSNLIVGIDFTKSNEWTGKRSYNGRSLHHIGNGLNPYEQAISII  167

Query  472  GKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            GKTLAAFDDDNLIPCFGFGDASTHDQ+VFSF  D+RF NGFEEVLS YREI
Sbjct  168  GKTLAAFDDDNLIPCFGFGDASTHDQNVFSFNSDDRFSNGFEEVLSQYREI  218



>gb|KJB33861.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33862.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33863.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33864.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33865.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
Length=466

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            N    +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  67   NRGSDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  126

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            +SLH+IG+ LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPD+RFCNG
Sbjct  127  KSLHHIGNSLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDDRFCNG  186

Query  592  FEEVLSXYREI  624
            FEEVLS YREI
Sbjct  187  FEEVLSRYREI  197



>gb|KHG01454.1| E3 ubiquitin-protein ligase RGLG2 -like protein [Gossypium arboreum]
Length=476

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+
Sbjct  82   KRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHH  141

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+ LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPD+RFCNGFEEVL
Sbjct  142  IGNSLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDDRFCNGFEEVL  201

Query  607  SXYREI  624
            S YREI
Sbjct  202  SRYREI  207



>ref|XP_007031645.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007031646.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007031648.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02571.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02572.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02574.1| RING domain ligase2 isoform 1 [Theobroma cacao]
Length=485

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            +++H   +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SF
Sbjct  83   TQDHDRDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSF  142

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH+IG GLNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ERFC
Sbjct  143  NRKSLHHIGDGLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPNERFC  202

Query  586  NGFEEVLSXYREI  624
            NGFE+VLS YREI
Sbjct  203  NGFEDVLSRYREI  215



>ref|XP_007031647.1| RING domain ligase2 isoform 3 [Theobroma cacao]
 gb|EOY02573.1| RING domain ligase2 isoform 3 [Theobroma cacao]
Length=486

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            +++H   +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SF
Sbjct  83   TQDHDRDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSF  142

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH+IG GLNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ERFC
Sbjct  143  NRKSLHHIGDGLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPNERFC  202

Query  586  NGFEEVLSXYREI  624
            NGFE+VLS YREI
Sbjct  203  NGFEDVLSRYREI  215



>ref|XP_003618769.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES74987.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=486

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            QR+LDR+YSRIADNYNS++EVTEALARAGLESSNLI+GIDFTKSNEWTGK SFN +SLH+
Sbjct  94   QRKLDRKYSRIADNYNSIDEVTEALARAGLESSNLILGIDFTKSNEWTGKHSFNRKSLHH  153

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEEVL
Sbjct  154  IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERICNGFEEVL  213

Query  607  SXYREI  624
            S YREI
Sbjct  214  SRYREI  219



>emb|CDP16621.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 158/213 (74%), Gaps = 12/213 (6%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYP------QTAYPPQ-PQESYNYP----VQHayps  168
            MG  +SRD++ RQ+S S+S     +YP      Q +YP    Q+SY+YP    V    P 
Sbjct  1    MGASNSRDNNGRQSSSSSSWDQYNQYPPSVGYSQDSYPQSYQQDSYSYPSRPTVPAYGPP  60

Query  169  yappppqeqqypppsqDFASRNHAPP-QRRLDRRYSRIADNYNSLEEVTEALARAGLESS  345
                  Q       +Q +     AP  +R+LDRRYSRIADNYNSLEEVTEALARAGLESS
Sbjct  61   PPQQQQQHHYQGTSAQSYGYGGQAPAAERKLDRRYSRIADNYNSLEEVTEALARAGLESS  120

Query  346  NLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGF  525
            NLIVGIDFTKSNEWTG++SF+GRSLH+IG+ LNPYEQAISIIGKTLAAFD+DN IPC+GF
Sbjct  121  NLIVGIDFTKSNEWTGRRSFHGRSLHHIGNTLNPYEQAISIIGKTLAAFDEDNQIPCYGF  180

Query  526  GDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            GDASTHDQDVFSFYPD+  CNGFEEVLS YREI
Sbjct  181  GDASTHDQDVFSFYPDDEVCNGFEEVLSRYREI  213



>ref|XP_006579983.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X3 [Glycine 
max]
Length=484

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RLDR+YSRIADNYNS++EVTEALA AGLESSNLI+GIDFTKSNEWTGK SFN +SLH+
Sbjct  87   EKRLDRKYSRIADNYNSIDEVTEALAHAGLESSNLILGIDFTKSNEWTGKHSFNRKSLHH  146

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  147  IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  206

Query  607  SXYREI  624
            S YREI
Sbjct  207  SQYREI  212



>ref|XP_002526974.1| copine, putative [Ricinus communis]
 gb|EEF35461.1| copine, putative [Ricinus communis]
Length=461

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +1

Query  142  YPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEAL  321
            YP QH Y S                  +S+N    +R+LDRRYSRIAD+Y SL++VTEAL
Sbjct  50   YPTQHTYGSEQQYQDYSGGDIRQQYHSSSQNFGGQRRQLDRRYSRIADDYKSLDQVTEAL  109

Query  322  ARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDD  501
            A+AGLESSNLIVGIDFTKSNEWTG +S+N RSLH+IG GLNPYEQAISIIGKTLAAFD+D
Sbjct  110  AQAGLESSNLIVGIDFTKSNEWTGARSYNRRSLHHIGDGLNPYEQAISIIGKTLAAFDED  169

Query  502  NLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            NLIPCFGFGDASTHDQDVF FYPDERFCNGFEEVLS YREI
Sbjct  170  NLIPCFGFGDASTHDQDVFCFYPDERFCNGFEEVLSRYREI  210



>ref|XP_003524729.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Glycine 
max]
 ref|XP_006579982.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Glycine 
max]
 gb|KHN42754.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=491

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RLDR+YSRIADNYNS++EVTEALA AGLESSNLI+GIDFTKSNEWTGK SFN +SLH+
Sbjct  87   EKRLDRKYSRIADNYNSIDEVTEALAHAGLESSNLILGIDFTKSNEWTGKHSFNRKSLHH  146

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  147  IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  206

Query  607  SXYREI  624
            S YREI
Sbjct  207  SQYREI  212



>ref|XP_004489546.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Cicer arietinum]
 ref|XP_004489547.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=460

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +R+L+R+YSRIADNYNS++EVTEALARAGLESSNLI+GIDFTKSNEWTGK+SFN +SLH+
Sbjct  85   RRKLERKYSRIADNYNSIDEVTEALARAGLESSNLILGIDFTKSNEWTGKRSFNRQSLHH  144

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSF+PDERFCNGFEEVL
Sbjct  145  IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFFPDERFCNGFEEVL  204

Query  607  SXYREI  624
            S YREI
Sbjct  205  SRYREI  210



>gb|KHG01849.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=503

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 162/216 (75%), Gaps = 15/216 (7%)
 Frame = +1

Query  13   IELMGGKSSRDDswrqasrstssswNYE----YPQTAYPPQPQESYNYPVQHaypsyapp  180
            + LMGG SS++ SWRQ S   S+  +++    YPQT+Y    QE++++P Q++Y      
Sbjct  21   VWLMGGSSSKEGSWRQGSSYHSNPPSWDSHQGYPQTSYG---QENHSFPPQYSYAEPQYY  77

Query  181  ppqeqqypppsqDFAS--RNHAPPQ------RRLDRRYSRIADNYNSLEEVTEALARAGL  336
            P  + +            + H  PQ      ++L R+YS+IADNYNSL++VTEALA AGL
Sbjct  78   PYSQPEPQQHYPPLQPEPQYHPSPQDRVGDKKKLQRKYSKIADNYNSLDQVTEALAIAGL  137

Query  337  ESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPC  516
            ESSNLIVGIDFTKSNEWTGK+SFN RSLH+IG G NPYEQAISIIGKTLAAFD+DNLIPC
Sbjct  138  ESSNLIVGIDFTKSNEWTGKRSFNRRSLHHIGDGSNPYEQAISIIGKTLAAFDEDNLIPC  197

Query  517  FGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            FGFGDASTHDQDVFSFYPDERFCNGFEEVLS YRE+
Sbjct  198  FGFGDASTHDQDVFSFYPDERFCNGFEEVLSRYREL  233



>ref|XP_011005559.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005560.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005561.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005562.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005563.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
Length=443

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +RRL+R+YSRIAD+Y SL +VTEALARAGLESSNLIVGIDFTKSNEWTG +S+N R LH+
Sbjct  67   RRRLERKYSRIADDYKSLHQVTEALARAGLESSNLIVGIDFTKSNEWTGARSYNRRCLHH  126

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG GLNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  127  IGDGLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  186

Query  607  SXYREI  624
            S YREI
Sbjct  187  SRYREI  192



>gb|KJB75966.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
 gb|KJB75967.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
 gb|KJB75968.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
Length=480

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 157/210 (75%), Gaps = 9/210 (4%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYE----YPQTAYPPQ-----PQESYNYPVQHaypsya  174
            MGG SS++ SWRQ S   S+  +++    YPQT+Y  +     PQ SY  P  + Y    
Sbjct  1    MGGSSSKEGSWRQGSSYHSNPPSWDSHQGYPQTSYGQENHSYPPQYSYAEPQYYPYSQPE  60

Query  175  ppppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLI  354
            P        P P    + ++    +++L R+YS+IADNYNSL++VTEALA AGLESSNLI
Sbjct  61   PQQHYPPPQPEPQYHPSPQDRVGDKKKLQRKYSKIADNYNSLDQVTEALANAGLESSNLI  120

Query  355  VGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDA  534
            VGIDFTKSNEWTGK+SFN RSLH+IG G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDA
Sbjct  121  VGIDFTKSNEWTGKRSFNRRSLHHIGDGSNPYEQAISIIGKTLAAFDEDNLIPCFGFGDA  180

Query  535  STHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            STHDQDVFSFYPDERFCNGFEEVLS YRE+
Sbjct  181  STHDQDVFSFYPDERFCNGFEEVLSRYREL  210



>gb|KHG01848.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=480

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 160/213 (75%), Gaps = 15/213 (7%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYE----YPQTAYPPQPQESYNYPVQHaypsyappppq  189
            MGG SS++ SWRQ S   S+  +++    YPQT+Y    QE++++P Q++Y      P  
Sbjct  1    MGGSSSKEGSWRQGSSYHSNPPSWDSHQGYPQTSYG---QENHSFPPQYSYAEPQYYPYS  57

Query  190  eqqypppsqDFAS--RNHAPPQ------RRLDRRYSRIADNYNSLEEVTEALARAGLESS  345
            + +            + H  PQ      ++L R+YS+IADNYNSL++VTEALA AGLESS
Sbjct  58   QPEPQQHYPPLQPEPQYHPSPQDRVGDKKKLQRKYSKIADNYNSLDQVTEALAIAGLESS  117

Query  346  NLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGF  525
            NLIVGIDFTKSNEWTGK+SFN RSLH+IG G NPYEQAISIIGKTLAAFD+DNLIPCFGF
Sbjct  118  NLIVGIDFTKSNEWTGKRSFNRRSLHHIGDGSNPYEQAISIIGKTLAAFDEDNLIPCFGF  177

Query  526  GDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            GDASTHDQDVFSFYPDERFCNGFEEVLS YRE+
Sbjct  178  GDASTHDQDVFSFYPDERFCNGFEEVLSRYREL  210



>gb|KHG01850.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=469

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++L R+YS+IADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SFN RSLH+
Sbjct  74   KKKLQRKYSKIADNYNSLDQVTEALAIAGLESSNLIVGIDFTKSNEWTGKRSFNRRSLHH  133

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  134  IGDGSNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  193

Query  607  SXYREI  624
            S YRE+
Sbjct  194  SRYREL  199



>ref|XP_003553280.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006603981.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006603982.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
Length=496

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RLDR+YSRI DNYNS++EVTEALARAGLESSNLI+GIDFTKSNEWTGK SFN +SLH+
Sbjct  87   EKRLDRKYSRITDNYNSIDEVTEALARAGLESSNLILGIDFTKSNEWTGKHSFNRKSLHH  146

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEEVL
Sbjct  147  IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERICNGFEEVL  206

Query  607  SXYREI  624
            S YREI
Sbjct  207  SRYREI  212



>ref|XP_004304674.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468321.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +R+LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK SFN RSLH+
Sbjct  85   KRKLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKNSFNRRSLHH  144

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG G NPYE AI+IIGKTLAAFD+DN+IPC+GFGDA+THDQDVFSFYPD+R CNGFEEVL
Sbjct  145  IGGGQNPYEHAITIIGKTLAAFDEDNIIPCYGFGDATTHDQDVFSFYPDDRHCNGFEEVL  204

Query  607  SXYREI  624
            + YREI
Sbjct  205  TRYREI  210



>gb|KDO82164.1| hypothetical protein CISIN_1g0427521mg, partial [Citrus sinensis]
Length=336

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQRRLDR+YSRI DNY SL++VT ALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  65   PQRRLDRKYSRIDDNYKSLDQVTGALAHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  124

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IGHG NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD+  CNGFEEV
Sbjct  125  HIGHGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDDICCNGFEEV  184

Query  604  LSXYREI  624
            L+ YREI
Sbjct  185  LTQYREI  191



>ref|XP_006438209.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51449.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
Length=336

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQRRLDR+YSRI DNY SL++VT ALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  65   PQRRLDRKYSRIDDNYKSLDQVTGALAHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  124

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IGHG NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD+  CNGFEEV
Sbjct  125  HIGHGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDDICCNGFEEV  184

Query  604  LSXYREI  624
            L+ YREI
Sbjct  185  LTRYREI  191



>gb|KDP46390.1| hypothetical protein JCGZ_10230 [Jatropha curcas]
Length=464

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 157/211 (74%), Gaps = 13/211 (6%)
 Frame = +1

Query  22   MGGKSSRD-----DswrqasrstssswNYEYPQTAYPPQPQESYNY---PVQHaypsyap  177
            MGGK+SR+     +S  ++S S+S   ++ YPQT+Y    QESY Y   P Q        
Sbjct  1    MGGKNSREGSWRSNSSIRSSSSSSYGSHHGYPQTSYG---QESYGYNQAPQQSYSQESYS  57

Query  178  pppqeqqypppsqDFASRNHAPPQRR--LDRRYSRIADNYNSLEEVTEALARAGLESSNL  351
                 QQ     Q ++S++++    R  L+R+YSRIAD+Y SL++VT ALARAGLESSNL
Sbjct  58   YNYPSQQSYGSQQHYSSQDYSTSNNRKHLERKYSRIADDYKSLDQVTAALARAGLESSNL  117

Query  352  IVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGD  531
            IVGIDFTKSNEWTG KSFN RSLH+IG GLNPYEQAISIIGKTLAAFD+DNLIPCFGFGD
Sbjct  118  IVGIDFTKSNEWTGAKSFNRRSLHHIGDGLNPYEQAISIIGKTLAAFDEDNLIPCFGFGD  177

Query  532  ASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            ASTHDQDVF F PD+RFCNGFEEVLS YREI
Sbjct  178  ASTHDQDVFCFNPDDRFCNGFEEVLSRYREI  208



>ref|XP_003531323.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
Length=459

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 152/209 (73%), Gaps = 27/209 (13%)
 Frame = +1

Query  19   LMGGKSSRDDswrqasrstsssw-----NYEYPQT--AYPPQPQESYNYPVQHaypsyap  177
            +MGGKSS+    R  S   S+       +YEYPQ+  AYP Q    Y+ P+ H  P+   
Sbjct  25   IMGGKSSKGSERRHVSSYGSAGSSSSWDDYEYPQSPNAYPQQ--NPYHTPLHHRAPAPF-  81

Query  178  pppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  357
                              +++ P+R+LDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIV
Sbjct  82   -----------------HDYSQPKRKLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIV  124

Query  358  GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  537
            GIDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAS
Sbjct  125  GIDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAS  184

Query  538  THDQDVFSFYPDERFCNGFEEVLSXYREI  624
            THDQDVFSF+ DERFCNGFEEVLS YR+I
Sbjct  185  THDQDVFSFHSDERFCNGFEEVLSRYRDI  213



>ref|XP_006585247.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006585248.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
Length=460

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 152/209 (73%), Gaps = 27/209 (13%)
 Frame = +1

Query  19   LMGGKSSRDDswrqasrstsssw-----NYEYPQT--AYPPQPQESYNYPVQHaypsyap  177
            +MGGKSS+    R  S   S+       +YEYPQ+  AYP Q    Y+ P+ H  P+   
Sbjct  25   IMGGKSSKGSERRHVSSYGSAGSSSSWDDYEYPQSPNAYPQQ--NPYHTPLHHRAPAPF-  81

Query  178  pppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  357
                              +++ P+R+LDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIV
Sbjct  82   -----------------HDYSQPKRKLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIV  124

Query  358  GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  537
            GIDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAS
Sbjct  125  GIDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAS  184

Query  538  THDQDVFSFYPDERFCNGFEEVLSXYREI  624
            THDQDVFSF+ DERFCNGFEEVLS YR+I
Sbjct  185  THDQDVFSFHSDERFCNGFEEVLSRYRDI  213



>gb|KHN06536.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=435

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 153/208 (74%), Gaps = 27/208 (13%)
 Frame = +1

Query  22   MGGKSS-----RDDswrqasrstssswNYEYPQT--AYPPQPQESYNYPVQHaypsyapp  180
            MGGKSS     R  S   ++ S+SS  +Y YPQ+  AYP Q    YN P+ H  P+    
Sbjct  1    MGGKSSKRSERRHVSSYGSAGSSSSRDSYGYPQSPNAYPQQ--NPYNTPLHHRAPAPF--  56

Query  181  ppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  360
                             +++ P+RRLDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIVG
Sbjct  57   ----------------HDYSRPKRRLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIVG  100

Query  361  IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  540
            IDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAST
Sbjct  101  IDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAST  160

Query  541  HDQDVFSFYPDERFCNGFEEVLSXYREI  624
            HDQDVFSF+ DERFCNGFEEVLS YR+I
Sbjct  161  HDQDVFSFHSDERFCNGFEEVLSRYRDI  188



>ref|XP_010248698.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
 ref|XP_010248699.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
 ref|XP_010248701.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
Length=445

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P+R+L+RRYSRIADNYNSLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  66   PRRKLERRYSRIADNYNSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLH  125

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            ++G   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEE 
Sbjct  126  HLGDTQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERLCNGFEEA  185

Query  604  LSXYREI  624
            L+ YREI
Sbjct  186  LTQYREI  192



>ref|XP_008458835.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458837.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458838.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458839.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
Length=447

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            RRLDR+YSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  63   RRLDRKYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  122

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYP-DERFCNGFEEVL  606
            G   NPY+QAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSF+P +ERFCNGFEEVL
Sbjct  123  GDQPNPYQQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFFPEEERFCNGFEEVL  182

Query  607  SXYREI  624
            S Y+EI
Sbjct  183  SRYQEI  188



>gb|AFN89139.1| RING-type ubiquitin ligase [Mesembryanthemum crystallinum]
Length=472

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P++RLDRRYSRIAD+Y+SL++VTEALA AGLESSNLIVGIDFTKSNEWTG KSFN +SLH
Sbjct  77   PKKRLDRRYSRIADDYSSLDQVTEALAHAGLESSNLIVGIDFTKSNEWTGAKSFNRKSLH  136

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE-RFCNGFEE  600
            +IG GLNPY+QAI+IIGKTLAAFDDDNLIPC+GFGDASTHDQDVFSFYPDE R+CNGFEE
Sbjct  137  HIGDGLNPYQQAIAIIGKTLAAFDDDNLIPCYGFGDASTHDQDVFSFYPDEGRYCNGFEE  196

Query  601  VLSXYREI  624
            VLS YREI
Sbjct  197  VLSRYREI  204



>ref|XP_004142779.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 gb|KGN51346.1| hypothetical protein Csa_5G522920 [Cucumis sativus]
Length=447

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  63   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  122

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYP-DERFCNGFEEVL  606
            G   NPY+QAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSF+P +ERFCNGFEEVL
Sbjct  123  GDQPNPYQQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFFPEEERFCNGFEEVL  182

Query  607  SXYREI  624
            + Y+EI
Sbjct  183  NRYQEI  188



>gb|KEH20743.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=475

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 136/180 (76%), Gaps = 18/180 (10%)
 Frame = +1

Query  88   NYEYPQTAYPPQPQES-YNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDR  264
            NY YPQ+ YP  PQ++ Y  P                          S +++ P R+LDR
Sbjct  62   NYGYPQSTYPYPPQQNPYQRPNHRPPTQA-----------------PSHDYSRPNRKLDR  104

Query  265  RYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLN  444
            RYSRIAD+Y+SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+IG+G N
Sbjct  105  RYSRIADDYHSLDEVTAALSHAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHIGNGQN  164

Query  445  PYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            PYEQAI+IIGKTL AFD+DNLIPCFGFGDASTHDQDVFSF+ DER CNGFEEVLS YREI
Sbjct  165  PYEQAIAIIGKTLTAFDEDNLIPCFGFGDASTHDQDVFSFHSDERCCNGFEEVLSKYREI  224



>ref|XP_007151612.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 ref|XP_007151613.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 gb|ESW23606.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 gb|ESW23607.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
Length=506

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++LDR+YSRIADNYNS++EVTEALARAGLESSNLI+GID TKSNEWTGK SFN +SLH+
Sbjct  85   EKQLDRKYSRIADNYNSIDEVTEALARAGLESSNLIMGIDCTKSNEWTGKHSFNRKSLHH  144

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  145  IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  204

Query  607  SXYREI  624
              YREI
Sbjct  205  GRYREI  210



>gb|EPS60918.1| hypothetical protein M569_13882, partial [Genlisea aurea]
Length=368

 Score =   229 bits (583),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            +RN   P ++ DRRYSRIADNYNSL++V+EALARAGLESSNLI+GIDFTKSNEWTGK S+
Sbjct  68   ARNLQAPNKKFDRRYSRIADNYNSLDQVSEALARAGLESSNLIIGIDFTKSNEWTGKNSY  127

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            NG SLH+ G GLNPYEQAI+IIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSF  D R C
Sbjct  128  NGLSLHHTGTGLNPYEQAITIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFCSDGRSC  187

Query  586  NGFEEVLSXYREI  624
            NGFEEVLS YRE+
Sbjct  188  NGFEEVLSRYREL  200



>gb|EYU34755.1| hypothetical protein MIMGU_mgv1a006209mg [Erythranthe guttata]
Length=452

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = +1

Query  235  HAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  414
            HAP Q++ DRRYSRIADNYNSLEEVTEAL RAGLESSNLI+GIDFTKSNEWTGK+S+NG+
Sbjct  80   HAP-QKKFDRRYSRIADNYNSLEEVTEALGRAGLESSNLIIGIDFTKSNEWTGKRSYNGK  138

Query  415  SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  594
            SLH IG+  NPYEQAISIIGKTLA FD+DNLIPCFGFGDA THDQDVFSFYPDER  NGF
Sbjct  139  SLHYIGNEQNPYEQAISIIGKTLAVFDEDNLIPCFGFGDAYTHDQDVFSFYPDERVSNGF  198

Query  595  EEVLSXYREI  624
            EEVLS YRE+
Sbjct  199  EEVLSRYREL  208



>gb|KDO49015.1| hypothetical protein CISIN_1g015418mg [Citrus sinensis]
 gb|KDO49016.1| hypothetical protein CISIN_1g015418mg [Citrus sinensis]
 gb|KDO49017.1| hypothetical protein CISIN_1g015418mg [Citrus sinensis]
Length=405

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 152/203 (75%), Gaps = 11/203 (5%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  195
            MGG+SSR+ SWRQ S   S+S +++ PQT Y   P  QES NYP Q   P       Q  
Sbjct  1    MGGRSSREASWRQDSSFRSTSSSWD-PQTGYLQSPYGQESQNYPPQTYPPPQTYSTQQYY  59

Query  196  qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  375
                     +S  H+   R+LDRRYSRIAD+Y SL++VTEALARAGLESSNLIVGIDFTK
Sbjct  60   P--------SSEEHSGNTRKLDRRYSRIADDYKSLDQVTEALARAGLESSNLIVGIDFTK  111

Query  376  SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  555
            SNEWTGK+SFN RSLH IG GLNPYEQAISIIGKTLA FD+DNLIPC+GFGDASTHDQDV
Sbjct  112  SNEWTGKRSFNRRSLHYIGDGLNPYEQAISIIGKTLAVFDEDNLIPCYGFGDASTHDQDV  171

Query  556  FSFYPDERFCNGFEEVLSXYREI  624
            FSFY   RFC GFEEVLS YREI
Sbjct  172  FSFYSGGRFCYGFEEVLSRYREI  194



>ref|XP_002271885.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Vitis 
vinifera]
 emb|CBI34842.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 134/189 (71%), Gaps = 37/189 (20%)
 Frame = +1

Query  97   YPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQ---------  249
            YP  A P QP  SY  P Q+                        ++H PPQ         
Sbjct  44   YPSYAPPQQPYPSYAPPQQY------------------------QSHEPPQQNYSSSQGN  79

Query  250  ----RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRS  417
                RRL+R YSRIAD+Y SL+EVT ALARAGLESSNLIVGIDFTKSNEWTG +SFN +S
Sbjct  80   GDNRRRLERMYSRIADDYRSLDEVTAALARAGLESSNLIVGIDFTKSNEWTGARSFNRQS  139

Query  418  LHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFE  597
            LH++G GLNPY+QAISIIGKTLAAFD+DN+IPCFGFGDASTHDQDVFSFY DERFCNGFE
Sbjct  140  LHHVGDGLNPYQQAISIIGKTLAAFDEDNMIPCFGFGDASTHDQDVFSFYEDERFCNGFE  199

Query  598  EVLSXYREI  624
            EVLS YREI
Sbjct  200  EVLSRYREI  208



>gb|KDO49018.1| hypothetical protein CISIN_1g015418mg [Citrus sinensis]
Length=407

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 152/203 (75%), Gaps = 11/203 (5%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  195
            MGG+SSR+ SWRQ S   S+S +++ PQT Y   P  QES NYP Q   P       Q  
Sbjct  1    MGGRSSREASWRQDSSFRSTSSSWD-PQTGYLQSPYGQESQNYPPQTYPPPQTYSTQQYY  59

Query  196  qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  375
                     +S  H+   R+LDRRYSRIAD+Y SL++VTEALARAGLESSNLIVGIDFTK
Sbjct  60   P--------SSEEHSGNTRKLDRRYSRIADDYKSLDQVTEALARAGLESSNLIVGIDFTK  111

Query  376  SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  555
            SNEWTGK+SFN RSLH IG GLNPYEQAISIIGKTLA FD+DNLIPC+GFGDASTHDQDV
Sbjct  112  SNEWTGKRSFNRRSLHYIGDGLNPYEQAISIIGKTLAVFDEDNLIPCYGFGDASTHDQDV  171

Query  556  FSFYPDERFCNGFEEVLSXYREI  624
            FSFY   RFC GFEEVLS YREI
Sbjct  172  FSFYSGGRFCYGFEEVLSRYREI  194



>ref|XP_003524251.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006580246.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=460

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 154/209 (74%), Gaps = 27/209 (13%)
 Frame = +1

Query  19   LMGGKSS-----RDDswrqasrstssswNYEYPQT--AYPPQPQESYNYPVQHaypsyap  177
            +MGGKSS     R  S   ++ S+SS  +Y YPQ+  AYP Q    YN P+ H  P+   
Sbjct  25   IMGGKSSKRSERRHVSSYGSAGSSSSRDSYGYPQSPNAYPQQ--NPYNTPLHHRAPAPF-  81

Query  178  pppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  357
                              +++ P+RRLDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIV
Sbjct  82   -----------------HDYSRPKRRLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIV  124

Query  358  GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  537
            GIDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAS
Sbjct  125  GIDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAS  184

Query  538  THDQDVFSFYPDERFCNGFEEVLSXYREI  624
            THDQDVFSF+ DERFC+GFEEVLS YR+I
Sbjct  185  THDQDVFSFHSDERFCHGFEEVLSRYRDI  213



>ref|XP_010660842.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Vitis 
vinifera]
Length=485

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 134/189 (71%), Gaps = 37/189 (20%)
 Frame = +1

Query  97   YPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQ---------  249
            YP  A P QP  SY  P Q+                        ++H PPQ         
Sbjct  44   YPSYAPPQQPYPSYAPPQQY------------------------QSHEPPQQNYSSSQGN  79

Query  250  ----RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRS  417
                RRL+R YSRIAD+Y SL+EVT ALARAGLESSNLIVGIDFTKSNEWTG +SFN +S
Sbjct  80   GDNRRRLERMYSRIADDYRSLDEVTAALARAGLESSNLIVGIDFTKSNEWTGARSFNRQS  139

Query  418  LHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFE  597
            LH++G GLNPY+QAISIIGKTLAAFD+DN+IPCFGFGDASTHDQDVFSFY DERFCNGFE
Sbjct  140  LHHVGDGLNPYQQAISIIGKTLAAFDEDNMIPCFGFGDASTHDQDVFSFYEDERFCNGFE  199

Query  598  EVLSXYREI  624
            EVLS YREI
Sbjct  200  EVLSRYREI  208



>ref|XP_010089180.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
 gb|EXB37451.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
Length=472

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +1

Query  232  NHAPPQRR-LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  408
            +HA   RR LDRRYSRIADNYNSL+EVT ALA AGLESSNLIVGIDFTKSNEWTG KSFN
Sbjct  87   SHAADGRRGLDRRYSRIADNYNSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGAKSFN  146

Query  409  GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  588
             +SLH+IG   NPYEQAISIIGKTLAAFD+DNLIPC GFGDASTHDQDVFSFYPDERFCN
Sbjct  147  RKSLHHIGESRNPYEQAISIIGKTLAAFDEDNLIPCLGFGDASTHDQDVFSFYPDERFCN  206

Query  589  GFEEVLSXYREI  624
            GFE+VLS YREI
Sbjct  207  GFEDVLSRYREI  218



>ref|XP_011042369.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=460

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQ+RLDR+YSRIADNY +L++VT ALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  77   PQKRLDRKYSRIADNYKTLDQVTAALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLH  136

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG+G NPYEQAISIIGKTL+AFD+DNLIPC+GFGDASTHDQDVFSF+PDERFCNGFEEV
Sbjct  137  HIGNGQNPYEQAISIIGKTLSAFDEDNLIPCYGFGDASTHDQDVFSFFPDERFCNGFEEV  196

Query  604  LSXYREI  624
            L  Y+EI
Sbjct  197  LMQYKEI  203



>ref|XP_006374543.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
 gb|ERP52340.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
Length=432

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            + AP  RRL+R+YSRI DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SFN 
Sbjct  52   DRAPNSRRLERKYSRIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFNR  111

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF+PDERFCNG
Sbjct  112  RSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFFPDERFCNG  171

Query  592  FEEVLSXYREI  624
            F EVL+ YRE+
Sbjct  172  FAEVLTQYREL  182



>ref|XP_006446649.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 ref|XP_006446650.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 ref|XP_006446651.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59889.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59890.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59891.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
Length=445

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 152/203 (75%), Gaps = 11/203 (5%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  195
            MGG+SSR+ SWRQ S   S+S +++ PQT Y   P  QES NYP Q   P       Q  
Sbjct  1    MGGRSSREASWRQDSSFRSTSSSWD-PQTGYLQSPYGQESQNYPPQTYPPPQTYSTQQYY  59

Query  196  qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  375
                     +S  H+   R+LDRRYSRIAD+Y SL++VTEALARAGLESSNLIVGIDFTK
Sbjct  60   P--------SSEEHSGNTRKLDRRYSRIADDYKSLDQVTEALARAGLESSNLIVGIDFTK  111

Query  376  SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  555
            SNEWTGK+SFN RSLH IG GLNPYEQAISIIGKTLA FD+DNLIPC+GFGDASTHDQDV
Sbjct  112  SNEWTGKRSFNRRSLHYIGDGLNPYEQAISIIGKTLAVFDEDNLIPCYGFGDASTHDQDV  171

Query  556  FSFYPDERFCNGFEEVLSXYREI  624
            FSFY   RFC GFEEVLS YREI
Sbjct  172  FSFYSGGRFCYGFEEVLSRYREI  194



>ref|XP_010029080.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029081.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029082.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029084.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW55926.1| hypothetical protein EUGRSUZ_I01722 [Eucalyptus grandis]
Length=516

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +RRLD+RYS IAD YNS+EEVTEALARAGLESSNL+VGIDFTKSNEWTG KSFN RSLH+
Sbjct  109  RRRLDKRYSTIADGYNSVEEVTEALARAGLESSNLLVGIDFTKSNEWTGAKSFNKRSLHD  168

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            I  GLNPYEQAISII +TLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD+++CNGFEEVL
Sbjct  169  ISDGLNPYEQAISIIWRTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDDKYCNGFEEVL  228

Query  607  SXYREI  624
              YREI
Sbjct  229  HRYREI  234



>ref|XP_006438208.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 ref|XP_006438210.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 ref|XP_006438211.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51448.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51450.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51451.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
Length=453

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQRRLDR+YSRI DNY SL++VT ALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  65   PQRRLDRKYSRIDDNYKSLDQVTGALAHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  124

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IGHG NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD+  CNGFEEV
Sbjct  125  HIGHGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDDICCNGFEEV  184

Query  604  LSXYREI  624
            L+ YREI
Sbjct  185  LTRYREI  191



>ref|XP_010029085.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
 gb|KCW55925.1| hypothetical protein EUGRSUZ_I01722 [Eucalyptus grandis]
Length=515

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +RRLD+RYS IAD YNS+EEVTEALARAGLESSNL+VGIDFTKSNEWTG KSFN RSLH+
Sbjct  109  RRRLDKRYSTIADGYNSVEEVTEALARAGLESSNLLVGIDFTKSNEWTGAKSFNKRSLHD  168

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            I  GLNPYEQAISII +TLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD+++CNGFEEVL
Sbjct  169  ISDGLNPYEQAISIIWRTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDDKYCNGFEEVL  228

Query  607  SXYREI  624
              YREI
Sbjct  229  HRYREI  234



>ref|XP_006483979.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
 ref|XP_006483980.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
Length=453

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQRRLDR+YSRI DNY SL++VT ALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  65   PQRRLDRKYSRIDDNYKSLDQVTGALAHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  124

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IGHG NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD+  CNGFEEV
Sbjct  125  HIGHGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDDICCNGFEEV  184

Query  604  LSXYREI  624
            L+ YREI
Sbjct  185  LTRYREI  191



>ref|XP_003538591.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006591483.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=463

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 150/203 (74%), Gaps = 17/203 (8%)
 Frame = +1

Query  19   LMGGKSSRDDswrqasrstssswNYEYPQTAYPPQ-PQESYNYPVQHaypsyappppqeq  195
            +MGGKSS+    R    ++SSS +  Y    YPPQ P  SY  P QH   S +   P   
Sbjct  26   VMGGKSSKGSGRRYDFGASSSSRDNSY--GGYPPQSPYTSYQTP-QHPCASASASAPFY-  81

Query  196  qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  375
                        ++A P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTK
Sbjct  82   ------------DYAQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTK  129

Query  376  SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  555
            SNEWTGK+SFN +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDV
Sbjct  130  SNEWTGKRSFNRKSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDV  189

Query  556  FSFYPDERFCNGFEEVLSXYREI  624
            FSF+ +ERFCNGFEEVL+ YR+I
Sbjct  190  FSFFSEERFCNGFEEVLTRYRQI  212



>ref|XP_006591484.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 gb|KHN44377.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=437

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 149/202 (74%), Gaps = 17/202 (8%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQ-PQESYNYPVQHaypsyappppqeqq  198
            MGGKSS+    R    ++SSS +  Y    YPPQ P  SY  P QH   S +   P    
Sbjct  1    MGGKSSKGSGRRYDFGASSSSRDNSY--GGYPPQSPYTSYQTP-QHPCASASASAPFY--  55

Query  199  ypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKS  378
                       ++A P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKS
Sbjct  56   -----------DYAQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKS  104

Query  379  NEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVF  558
            NEWTGK+SFN +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVF
Sbjct  105  NEWTGKRSFNRKSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVF  164

Query  559  SFYPDERFCNGFEEVLSXYREI  624
            SF+ +ERFCNGFEEVL+ YR+I
Sbjct  165  SFFSEERFCNGFEEVLTRYRQI  186



>gb|KCW59705.1| hypothetical protein EUGRSUZ_H02465 [Eucalyptus grandis]
Length=432

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  220  FASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            + S+   P ++RLDR+YSRIADNY SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTG +
Sbjct  60   YGSQTPQPMKKRLDRKYSRIADNYRSLDEVTAALSEAGLESSNLIVGIDFTKSNEWTGAR  119

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SF+ RSLH+IG G NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVFSFYPD+R
Sbjct  120  SFHRRSLHHIGGGRNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDDR  179

Query  580  FCNGFEEVLSXYREI  624
            FCNGFEEVL+ YRE+
Sbjct  180  FCNGFEEVLARYREV  194



>ref|XP_006848963.1| hypothetical protein AMTR_s00166p00070360 [Amborella trichopoda]
 gb|ERN10544.1| hypothetical protein AMTR_s00166p00070360 [Amborella trichopoda]
Length=440

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P+R+L+RRYSRIADNY+SLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG++SFNGR LH
Sbjct  47   PRRKLERRYSRIADNYSSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGRRSFNGRCLH  106

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYPDE+ C GFEE 
Sbjct  107  HIGDTSNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPDEKLCCGFEEA  166

Query  604  LSXYREI  624
            LS YREI
Sbjct  167  LSRYREI  173



>ref|XP_010100348.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
 gb|EXB82482.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
Length=448

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQRRL+R+YSRI+D+Y SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  60   PQRRLERKYSRISDDYRSLDEVTSALSHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  119

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG+G NPYEQAISIIGKTL+ FDDDNLIPCFGFGDASTHD+DVFSFYP+ERFCNGFEEV
Sbjct  120  HIGNGQNPYEQAISIIGKTLSTFDDDNLIPCFGFGDASTHDKDVFSFYPNERFCNGFEEV  179

Query  604  LSXYREI  624
            L+ YRE+
Sbjct  180  LTRYREL  186



>ref|XP_002321646.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
 gb|EEF05773.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
Length=414

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            + AP  RRL+R+YSRI DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SFN 
Sbjct  52   DRAPNSRRLERKYSRIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFNR  111

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF+PDERFCNG
Sbjct  112  RSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFFPDERFCNG  171

Query  592  FEEVLSXYREI  624
            F EVL+ YRE+
Sbjct  172  FAEVLTQYREL  182



>ref|XP_004504141.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=470

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 132/175 (75%), Gaps = 22/175 (13%)
 Frame = +1

Query  118  PQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAP------PQRRLDRRYSRI  279
            PQPQ +Y YP Q+ Y                      R  AP      P R+LDRRYSRI
Sbjct  61   PQPQSTYPYPQQNPYQR----------------SLHPRTQAPLHDYSRPNRKLDRRYSRI  104

Query  280  ADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQA  459
            AD+Y+SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+IG G NPYEQA
Sbjct  105  ADDYHSLDEVTAALSHAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHIGIGQNPYEQA  164

Query  460  ISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            I+IIGKTL+AFD+DN+IPCFGFGDASTHDQDVFSF+ DER CNGFEEVLS YREI
Sbjct  165  IAIIGKTLSAFDEDNMIPCFGFGDASTHDQDVFSFHSDERCCNGFEEVLSTYREI  219



>ref|XP_010250995.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Nelumbo nucifera]
Length=450

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P+R+L+RRYSRIADNYNSLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  72   PRRKLERRYSRIADNYNSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLH  131

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            ++G   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEE 
Sbjct  132  HLGDSQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERDCNGFEEA  191

Query  604  LSXYREI  624
            L+ YRE+
Sbjct  192  LTRYREV  198



>ref|XP_004504140.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Cicer arietinum]
Length=492

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 132/175 (75%), Gaps = 22/175 (13%)
 Frame = +1

Query  118  PQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAP------PQRRLDRRYSRI  279
            PQPQ +Y YP Q+ Y                      R  AP      P R+LDRRYSRI
Sbjct  61   PQPQSTYPYPQQNPYQR----------------SLHPRTQAPLHDYSRPNRKLDRRYSRI  104

Query  280  ADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQA  459
            AD+Y+SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+IG G NPYEQA
Sbjct  105  ADDYHSLDEVTAALSHAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHIGIGQNPYEQA  164

Query  460  ISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            I+IIGKTL+AFD+DN+IPCFGFGDASTHDQDVFSF+ DER CNGFEEVLS YREI
Sbjct  165  IAIIGKTLSAFDEDNMIPCFGFGDASTHDQDVFSFHSDERCCNGFEEVLSTYREI  219



>ref|XP_010250991.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010250992.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010250993.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
Length=451

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P+R+L+RRYSRIADNYNSLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  72   PRRKLERRYSRIADNYNSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLH  131

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            ++G   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEE 
Sbjct  132  HLGDSQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERDCNGFEEA  191

Query  604  LSXYREI  624
            L+ YRE+
Sbjct  192  LTRYREV  198



>ref|XP_003548557.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Glycine max]
Length=426

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L+RRYSRI+D+Y+S+++VTEALARAGLESSNLIVG+DFTKSNEWTGK SFN RSLH+IG
Sbjct  61   KLERRYSRISDHYSSIDQVTEALARAGLESSNLIVGVDFTKSNEWTGKNSFNRRSLHHIG  120

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
             GLNPYEQAISIIGK+LAAFD+DNLIPCFGFGDASTHDQDVFSFYP ERFC+GFE+VLS 
Sbjct  121  SGLNPYEQAISIIGKSLAAFDEDNLIPCFGFGDASTHDQDVFSFYPSERFCDGFEDVLSR  180

Query  613  YREI  624
            YREI
Sbjct  181  YREI  184



>ref|XP_007222138.1| hypothetical protein PRUPE_ppa005724mg [Prunus persica]
 gb|EMJ23337.1| hypothetical protein PRUPE_ppa005724mg [Prunus persica]
Length=446

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 150/213 (70%), Gaps = 32/213 (15%)
 Frame = +1

Query  22   MGGKSSRDDswrq-----asrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyapppp  186
            MGGKSS+D S R      ++ S+SS   Y YPQ + PPQ    Y  P  H  PS      
Sbjct  1    MGGKSSKDSSPRLFSHGGSTASSSSWDQYGYPQPSRPPQ--NPYCTPQHHYAPS------  52

Query  187  qeqqypppsqDFASRNHAP-------PQRRLDRRYSRIADNYNSLEEVTEALARAGLESS  345
                         S NH         P+RRLDR+YS+IADNY+SL+EVT ALA+AGLESS
Sbjct  53   ------------PSFNHVSRPVTVPNPRRRLDRKYSKIADNYSSLDEVTSALAQAGLESS  100

Query  346  NLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGF  525
            NLIVGIDFTKSNEWTG +SFN +SLH+IG+  NPYEQAISIIGKTL+ FD+DNLIPCFGF
Sbjct  101  NLIVGIDFTKSNEWTGSRSFNRKSLHHIGNVQNPYEQAISIIGKTLSVFDEDNLIPCFGF  160

Query  526  GDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            GDASTHDQDVFSFY DE +CNGFEEVL+ YREI
Sbjct  161  GDASTHDQDVFSFYQDEHYCNGFEEVLARYREI  193



>gb|KHN43980.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=433

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            ++A P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  52   DYAQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  111

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFY +ERFCNG
Sbjct  112  KSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYSEERFCNG  171

Query  592  FEEVLSXYREI  624
            FEEVL+ YR+I
Sbjct  172  FEEVLTRYRQI  182



>gb|KJB11578.1| hypothetical protein B456_001G266800 [Gossypium raimondii]
 gb|KJB11579.1| hypothetical protein B456_001G266800 [Gossypium raimondii]
Length=448

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            +R+H   +  L RRYS IAD+YNSL++VTEALA AGLESSNLIVGIDFTKSN WTGK+SF
Sbjct  64   TRDHGNDKTMLQRRYSSIADSYNSLDQVTEALANAGLESSNLIVGIDFTKSNMWTGKRSF  123

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            NG+SLH+IG+ LNPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFYPD RFC
Sbjct  124  NGKSLHHIGNYLNPYEQAISIIGKTLSVFDEDNLIPCFGFGDASTHDQDVFSFYPDNRFC  183

Query  586  NGFEEVLSXYREI  624
            NGFEEVLS YRE+
Sbjct  184  NGFEEVLSRYREL  196



>gb|KCW59704.1| hypothetical protein EUGRSUZ_H02465 [Eucalyptus grandis]
Length=456

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  220  FASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            + S+   P ++RLDR+YSRIADNY SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTG +
Sbjct  60   YGSQTPQPMKKRLDRKYSRIADNYRSLDEVTAALSEAGLESSNLIVGIDFTKSNEWTGAR  119

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SF+ RSLH+IG G NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVFSFYPD+R
Sbjct  120  SFHRRSLHHIGGGRNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDDR  179

Query  580  FCNGFEEVLSXYREI  624
            FCNGFEEVL+ YRE+
Sbjct  180  FCNGFEEVLARYREV  194



>ref|XP_004141118.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis sativus]
Length=444

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 146/215 (68%), Gaps = 34/215 (16%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  195
            MG  +SR++    +S + +   +  Y Q AY P P  Q S +Y  Q              
Sbjct  1    MGAANSREEPSVSSSWNGAYGQSPPYAQEAYAPSPYGQASQSYVPQQ-------------  47

Query  196  qypppsqDFASRNHAPPQ------------RRLDRRYSRIADNYNSLEEVTEALARAGLE  339
                    F+S  + PP+            ++ DRRYSRIADNY SLEEVTEALARAGLE
Sbjct  48   -------SFSSPQYHPPENYHGGAAAADNRKKFDRRYSRIADNYKSLEEVTEALARAGLE  100

Query  340  SSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCF  519
            SSNLI+GIDFTKSNEWTG +SFN RSLH+I +G NPYEQAISI+GKTL+AFDDDNLIPCF
Sbjct  101  SSNLIIGIDFTKSNEWTGARSFNKRSLHDIRNGPNPYEQAISIVGKTLSAFDDDNLIPCF  160

Query  520  GFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            GFGDASTHDQDVF FYP+ RFC+GFE+VL+ YREI
Sbjct  161  GFGDASTHDQDVFGFYPEGRFCDGFEDVLNRYREI  195



>ref|XP_006470207.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
 ref|XP_006470208.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
Length=445

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 152/203 (75%), Gaps = 11/203 (5%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  195
            MGG+SSR+ SWRQ S   S+S +++ PQT Y   P  QES NYP Q   P       Q  
Sbjct  1    MGGRSSREASWRQDSSFRSTSSSWD-PQTGYLQSPYGQESQNYPPQTYPPPQTYSTQQYY  59

Query  196  qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  375
                     +S  H+   R+LDRRYSRIAD+Y SL++VTEALARAGLESSNLIVGIDFTK
Sbjct  60   P--------SSEEHSGNTRKLDRRYSRIADDYKSLDQVTEALARAGLESSNLIVGIDFTK  111

Query  376  SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  555
            SNEWTGK+SFN +SLH IG GLNPYEQAISIIGKTLA FD+DNLIPC+GFGDASTHDQDV
Sbjct  112  SNEWTGKRSFNRQSLHYIGDGLNPYEQAISIIGKTLAVFDEDNLIPCYGFGDASTHDQDV  171

Query  556  FSFYPDERFCNGFEEVLSXYREI  624
            FSFY   RFC GFEEVLS YREI
Sbjct  172  FSFYSGGRFCYGFEEVLSRYREI  194



>ref|XP_004158327.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis sativus]
 gb|KGN59719.1| hypothetical protein Csa_3G840450 [Cucumis sativus]
Length=456

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 146/215 (68%), Gaps = 34/215 (16%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  195
            MG  +SR++    +S + +   +  Y Q AY P P  Q S +Y  Q              
Sbjct  1    MGAANSREEPSVSSSWNGAYGQSPPYAQEAYAPSPYGQASQSYVPQQ-------------  47

Query  196  qypppsqDFASRNHAPPQ------------RRLDRRYSRIADNYNSLEEVTEALARAGLE  339
                    F+S  + PP+            ++ DRRYSRIADNY SLEEVTEALARAGLE
Sbjct  48   -------SFSSPQYHPPENYHGGAAAADNRKKFDRRYSRIADNYKSLEEVTEALARAGLE  100

Query  340  SSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCF  519
            SSNLI+GIDFTKSNEWTG +SFN RSLH+I +G NPYEQAISI+GKTL+AFDDDNLIPCF
Sbjct  101  SSNLIIGIDFTKSNEWTGARSFNKRSLHDIRNGPNPYEQAISIVGKTLSAFDDDNLIPCF  160

Query  520  GFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            GFGDASTHDQDVF FYP+ RFC+GFE+VL+ YREI
Sbjct  161  GFGDASTHDQDVFGFYPEGRFCDGFEDVLNRYREI  195



>gb|KDP31007.1| hypothetical protein JCGZ_11383 [Jatropha curcas]
Length=429

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            RRL+R+YS+I DNYNSLE+VT+ALAR+GLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  56   RRLERKYSKIDDNYNSLEQVTDALARSGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  115

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G  LNPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFCNGFEEVLS
Sbjct  116  GDDLNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCNGFEEVLS  175

Query  610  XYREI  624
             Y+E+
Sbjct  176  RYKEL  180



>ref|XP_010102934.1| hypothetical protein L484_018953 [Morus notabilis]
 gb|EXB94452.1| hypothetical protein L484_018953 [Morus notabilis]
Length=247

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P+RRL+R+YS+I D+Y SL++VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH
Sbjct  61   PKRRLERKYSKIGDDYKSLDQVTQALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLH  120

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG   NPYEQAISIIGKTL++FD+DN+IPCFGFGDASTHDQ+VFSF+PDERFCNGFEEV
Sbjct  121  HIGEEQNPYEQAISIIGKTLSSFDEDNMIPCFGFGDASTHDQEVFSFHPDERFCNGFEEV  180

Query  604  LSXYREI  624
            L+ YRE+
Sbjct  181  LTRYREL  187



>ref|XP_007159686.1| hypothetical protein PHAVU_002G258600g [Phaseolus vulgaris]
 gb|ESW31680.1| hypothetical protein PHAVU_002G258600g [Phaseolus vulgaris]
Length=462

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 138/181 (76%), Gaps = 22/181 (12%)
 Frame = +1

Query  88   NYEYPQT--AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLD  261
            NY YPQT  AYP Q    Y+ P+ +  P+                     +++ P+RRLD
Sbjct  53   NYGYPQTPNAYPQQ--NIYHTPIHNRVPAPF------------------HDYSQPKRRLD  92

Query  262  RRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGL  441
            RR+SRIAD+YNSL+EVT AL+ AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+IG   
Sbjct  93   RRFSRIADDYNSLDEVTSALSHAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHIGSDH  152

Query  442  NPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYRE  621
            NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSF+ DE FCNGFEEVLS YR+
Sbjct  153  NPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFHSDESFCNGFEEVLSRYRD  212

Query  622  I  624
            I
Sbjct  213  I  213



>ref|XP_010682022.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Beta vulgaris 
subsp. vulgaris]
Length=471

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++R  R YSRIAD Y SL++VT+ALARAGLESSNLIVGIDFTKSNEWTG KSFN RSLH+
Sbjct  78   KKRFQRMYSRIADEYTSLDQVTQALARAGLESSNLIVGIDFTKSNEWTGAKSFNKRSLHH  137

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG GLNPYEQAISIIGKTLAAFDDDNLIPC+GFGDASTHDQDVFSFYPDE  CNGFEEVL
Sbjct  138  IGDGLNPYEQAISIIGKTLAAFDDDNLIPCYGFGDASTHDQDVFSFYPDESVCNGFEEVL  197

Query  607  SXYREI  624
              YREI
Sbjct  198  YKYREI  203



>ref|XP_011005612.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=452

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            + AP  RRL+R+YSRI DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SFN 
Sbjct  52   DRAPNSRRLERKYSRIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFNR  111

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF+PDERFCNG
Sbjct  112  RSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFFPDERFCNG  171

Query  592  FEEVLSXYREI  624
            F EVL+ YRE+
Sbjct  172  FAEVLTRYREL  182



>ref|XP_002312658.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
 gb|EEE90025.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
Length=434

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 150/209 (72%), Gaps = 20/209 (10%)
 Frame = +1

Query  22   MGGKSS-----RDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyapppp  186
            MGGKSS     RD S   ++ S+SS   Y YP  +  P PQ    +  QH +     P  
Sbjct  1    MGGKSSKGSRGRDYSSYGSANSSSSWNQYGYPPASSYPSPQHDPYWTQQHHHAPAPNP--  58

Query  187  qeqqypppsqDFASRNHAPPQ---RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  357
                       +   +  PPQ   +RLDR+YSRIADNY +L++VT ALA+AGLESSNLIV
Sbjct  59   ----------SYPYESQMPPQQPHKRLDRKYSRIADNYQTLDQVTAALAQAGLESSNLIV  108

Query  358  GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  537
            GIDFTKSNEWTG +SFN RSLH+I +G NPYEQAISIIG+T++AFD+DNLIPCFGFGDAS
Sbjct  109  GIDFTKSNEWTGARSFNRRSLHDIRNGQNPYEQAISIIGRTMSAFDEDNLIPCFGFGDAS  168

Query  538  THDQDVFSFYPDERFCNGFEEVLSXYREI  624
            THDQDVFSF+P+ERFCNGFEEVL+ Y+EI
Sbjct  169  THDQDVFSFFPEERFCNGFEEVLTRYKEI  197



>ref|XP_004502384.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=470

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 132/177 (75%), Gaps = 25/177 (14%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRN-----HAPPQRRLDRRYS  273
             YPP PQ+S +Y   H                     FAS +     ++ P+++LDRRYS
Sbjct  63   GYPPHPQQS-SYQTPHH-------------------QFASASAPLYEYSQPKKKLDRRYS  102

Query  274  RIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYE  453
            RIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+ G G NPYE
Sbjct  103  RIADNYRSLDEVTTALANAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHTGSGQNPYE  162

Query  454  QAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            QAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL+ YREI
Sbjct  163  QAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREI  219



>ref|XP_010524290.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Tarenaya hassleriana]
 ref|XP_010524291.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Tarenaya hassleriana]
Length=375

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S++H   +++L+R+YSRIAD+Y+SLE+VTEALA AGLESSNLIVG+DFTKSNEWTG KSF
Sbjct  45   SQSHGNGRKKLERKYSRIADDYSSLEQVTEALALAGLESSNLIVGVDFTKSNEWTGAKSF  104

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH  G  LNPYEQAI+IIGKTLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFC
Sbjct  105  NKKSLHFTGISLNPYEQAITIIGKTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFC  164

Query  586  NGFEEVLSXYREI  624
            NGFEEVL+ YREI
Sbjct  165  NGFEEVLARYREI  177



>ref|XP_006379955.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
 gb|ERP57752.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
Length=473

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 150/209 (72%), Gaps = 20/209 (10%)
 Frame = +1

Query  22   MGGKSS-----RDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyapppp  186
            MGGKSS     RD S   ++ S+SS   Y YP  +  P PQ    +  QH +     P  
Sbjct  1    MGGKSSKGSRGRDYSSYGSANSSSSWNQYGYPPASSYPSPQHDPYWTQQHHHAPAPNP--  58

Query  187  qeqqypppsqDFASRNHAPPQ---RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  357
                       +   +  PPQ   +RLDR+YSRIADNY +L++VT ALA+AGLESSNLIV
Sbjct  59   ----------SYPYESQMPPQQPHKRLDRKYSRIADNYQTLDQVTAALAQAGLESSNLIV  108

Query  358  GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  537
            GIDFTKSNEWTG +SFN RSLH+I +G NPYEQAISIIG+T++AFD+DNLIPCFGFGDAS
Sbjct  109  GIDFTKSNEWTGARSFNRRSLHDIRNGQNPYEQAISIIGRTMSAFDEDNLIPCFGFGDAS  168

Query  538  THDQDVFSFYPDERFCNGFEEVLSXYREI  624
            THDQDVFSF+P+ERFCNGFEEVL+ Y+EI
Sbjct  169  THDQDVFSFFPEERFCNGFEEVLTRYKEI  197



>ref|XP_003601891.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES72142.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=467

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 15/172 (9%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
             YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  58   GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  102

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  103  YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  162

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL+ YREI
Sbjct  163  IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREI  214



>gb|AES72143.2| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=470

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 15/172 (9%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
             YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  61   GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  105

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  106  YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  165

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL+ YREI
Sbjct  166  IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREI  217



>gb|AFK35251.1| unknown [Medicago truncatula]
Length=470

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 15/172 (9%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
             YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  61   GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  105

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  106  YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  165

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL+ YREI
Sbjct  166  IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREI  217



>gb|AES72144.2| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=470

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 15/172 (9%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
             YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  61   GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  105

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  106  YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  165

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL+ YREI
Sbjct  166  IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREI  217



>ref|XP_006601923.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 ref|XP_006601924.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Glycine max]
Length=434

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            ++  P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  52   DYGQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  111

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFY +ERFCNG
Sbjct  112  KSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYSEERFCNG  171

Query  592  FEEVLSXYREI  624
            FEEVL+ YR+I
Sbjct  172  FEEVLTRYRQI  182



>ref|XP_011034033.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Populus euphratica]
Length=472

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 152/211 (72%), Gaps = 24/211 (11%)
 Frame = +1

Query  22   MGGKSS-----RDDswrqasrstssswNYEYP-QTAYP-PQPQESYNYPVQHaypsyapp  180
            MGGKSS     RD S   ++ S+SS   Y YP  ++YP PQP   +     HA       
Sbjct  1    MGGKSSKGLRGRDYSSYGSANSSSSWNQYGYPPASSYPSPQPDPYWTQQRHHAPAPNP--  58

Query  181  ppqeqqypppsqDFASRNHAPPQ---RRLDRRYSRIADNYNSLEEVTEALARAGLESSNL  351
                         +   +H PPQ   +RLDR+YSRIADNY +L++VT ALA+AGLESSNL
Sbjct  59   ------------SYPYESHMPPQQPHKRLDRKYSRIADNYQTLDQVTAALAQAGLESSNL  106

Query  352  IVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGD  531
            IVGIDFTKSNEWTG +SFN RSLH+IG+  NPYEQAISIIG+T++AFD+DNLIPCFGFGD
Sbjct  107  IVGIDFTKSNEWTGARSFNRRSLHDIGNVQNPYEQAISIIGRTMSAFDEDNLIPCFGFGD  166

Query  532  ASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            ASTHDQDVFSF+P+ERFCNGFEEVL+ Y+EI
Sbjct  167  ASTHDQDVFSFFPEERFCNGFEEVLTRYKEI  197



>ref|XP_011034031.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Populus euphratica]
 ref|XP_011034032.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Populus euphratica]
Length=473

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 152/211 (72%), Gaps = 24/211 (11%)
 Frame = +1

Query  22   MGGKSS-----RDDswrqasrstssswNYEYP-QTAYP-PQPQESYNYPVQHaypsyapp  180
            MGGKSS     RD S   ++ S+SS   Y YP  ++YP PQP   +     HA       
Sbjct  1    MGGKSSKGLRGRDYSSYGSANSSSSWNQYGYPPASSYPSPQPDPYWTQQRHHAPAPNP--  58

Query  181  ppqeqqypppsqDFASRNHAPPQ---RRLDRRYSRIADNYNSLEEVTEALARAGLESSNL  351
                         +   +H PPQ   +RLDR+YSRIADNY +L++VT ALA+AGLESSNL
Sbjct  59   ------------SYPYESHMPPQQPHKRLDRKYSRIADNYQTLDQVTAALAQAGLESSNL  106

Query  352  IVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGD  531
            IVGIDFTKSNEWTG +SFN RSLH+IG+  NPYEQAISIIG+T++AFD+DNLIPCFGFGD
Sbjct  107  IVGIDFTKSNEWTGARSFNRRSLHDIGNVQNPYEQAISIIGRTMSAFDEDNLIPCFGFGD  166

Query  532  ASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            ASTHDQDVFSF+P+ERFCNGFEEVL+ Y+EI
Sbjct  167  ASTHDQDVFSFFPEERFCNGFEEVLTRYKEI  197



>ref|XP_010026602.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
Length=486

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  220  FASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            + S+   P ++RLDR+YSRIADNY SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTG +
Sbjct  60   YGSQTPQPMKKRLDRKYSRIADNYRSLDEVTAALSEAGLESSNLIVGIDFTKSNEWTGAR  119

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SF+ RSLH+IG G NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVFSFYPD+R
Sbjct  120  SFHRRSLHHIGGGRNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDDR  179

Query  580  FCNGFEEVLSXYREI  624
            FCNGFEEVL+ YRE+
Sbjct  180  FCNGFEEVLARYREV  194



>ref|XP_004135284.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 ref|XP_004159664.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 gb|KGN51730.1| hypothetical protein Csa_5G593430 [Cucumis sativus]
Length=433

 Score =   225 bits (574),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 142/201 (71%), Gaps = 19/201 (9%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqy  201
            MGGK+SR+   R+ S   S + +  + Q  YPPQ      YP                  
Sbjct  1    MGGKNSREAGRREFSSYGSGNSS-AWDQYNYPPQSPYVQQYPYTEPS-------------  46

Query  202  pppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSN  381
                 ++ S+    PQRRLDR+YSRIADNY SL+EVT AL +AGLESSNLIVGIDFTKSN
Sbjct  47   -----EYGSQTPQQPQRRLDRKYSRIADNYQSLDEVTAALIKAGLESSNLIVGIDFTKSN  101

Query  382  EWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFS  561
            EWTG +SFN RSLH+IG+  NPYEQAISIIG+TL++FDDDN+IPCFGFGDASTHDQDVFS
Sbjct  102  EWTGSRSFNRRSLHHIGNEPNPYEQAISIIGQTLSSFDDDNMIPCFGFGDASTHDQDVFS  161

Query  562  FYPDERFCNGFEEVLSXYREI  624
            FY D+R CNGFEEVL  YREI
Sbjct  162  FYHDDRICNGFEEVLHRYREI  182



>gb|KDP26671.1| hypothetical protein JCGZ_17829 [Jatropha curcas]
Length=466

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQ+RLDR+YSRIAD+Y +L++VT ALA++GLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  72   PQKRLDRKYSRIADDYKTLDQVTAALAQSGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  131

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG+G NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFY DER CNGFEEV
Sbjct  132  HIGNGQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYEDERICNGFEEV  191

Query  604  LSXYREI  624
            L+ YREI
Sbjct  192  LTRYREI  198



>ref|XP_010550166.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550167.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550168.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550169.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
Length=452

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 144/180 (80%), Gaps = 6/180 (3%)
 Frame = +1

Query  103  QTAYPPQP---QESYNYPVQHaypsy---appppqeqqypppsqDFASRNHAPPQRRLDR  264
            +  YPP     QESY+YP Q AY S       P  ++ YPP      S++H   +++L+R
Sbjct  28   EQGYPPPQYGRQESYSYPPQQAYASNYGYPQAPYSQEGYPPQPYPPPSQSHGNDRKKLER  87

Query  265  RYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLN  444
            +YSRIADNY+SL++VTEALARAGLESSNLIVG DFTKSNEWTG KSFN +SLH IG+G N
Sbjct  88   KYSRIADNYSSLDQVTEALARAGLESSNLIVGFDFTKSNEWTGAKSFNRKSLHFIGNGQN  147

Query  445  PYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            PYEQAI+IIGKTLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFCNGFEEVL+ YREI
Sbjct  148  PYEQAITIIGKTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGFEEVLARYREI  207



>gb|KHN27569.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=426

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L+RRYSRI+D+Y+S+++VTEALARAGLESSNLIVG+DFT SNEWTGK SFN RSLH+IG
Sbjct  61   KLERRYSRISDHYSSIDQVTEALARAGLESSNLIVGVDFTTSNEWTGKNSFNRRSLHHIG  120

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
             GLNPYEQAISIIGK+LAAFD+DNLIPCFGFGDASTHDQDVFSFYP ERFC+GFE+VLS 
Sbjct  121  SGLNPYEQAISIIGKSLAAFDEDNLIPCFGFGDASTHDQDVFSFYPSERFCDGFEDVLSR  180

Query  613  YREI  624
            YREI
Sbjct  181  YREI  184



>ref|XP_011071160.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Sesamum indicum]
Length=464

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 134/182 (74%), Gaps = 25/182 (14%)
 Frame = +1

Query  91   YEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAP----PQRRL  258
            Y YP  +Y   P   Y+ P+ H  P                    + N+AP    P+RR+
Sbjct  53   YSYP--SYSSTPHHPYSTPMHHHIP-------------------VAYNYAPSTPQPRRRM  91

Query  259  DRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHG  438
            DR++SRIADNY +L++VT AL+R+GLESSNLIVGIDFTKSNEWTG KSFN +SLH+IG G
Sbjct  92   DRKFSRIADNYQTLDQVTAALSRSGLESSNLIVGIDFTKSNEWTGAKSFNRKSLHHIGSG  151

Query  439  LNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYR  618
             NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD RFC GFEEVL  YR
Sbjct  152  PNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDGRFCEGFEEVLRRYR  211

Query  619  EI  624
            E+
Sbjct  212  EL  213



>ref|XP_003551971.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
Length=459

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            ++  P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  78   DYGQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  137

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFY +ERFCNG
Sbjct  138  KSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYSEERFCNG  197

Query  592  FEEVLSXYREI  624
            FEEVL+ YR+I
Sbjct  198  FEEVLTRYRQI  208



>ref|XP_006601922.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=460

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            ++  P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  78   DYGQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  137

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFY +ERFCNG
Sbjct  138  KSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYSEERFCNG  197

Query  592  FEEVLSXYREI  624
            FEEVL+ YR+I
Sbjct  198  FEEVLTRYRQI  208



>ref|XP_007163690.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
 gb|ESW35684.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
Length=438

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            ++A P+R+LDR+YSRIADNY SL+EVT  LA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  57   DNAQPKRKLDRKYSRIADNYRSLDEVTAELANAGLESSNLIVGIDFTKSNEWTGKRSFNR  116

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            +SLH+IG   NPYE AISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSF+ +ERFCNG
Sbjct  117  KSLHDIGSCQNPYEHAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFFSEERFCNG  176

Query  592  FEEVLSXYREI  624
            FEEVLS YREI
Sbjct  177  FEEVLSRYREI  187



>ref|XP_003601892.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
Length=521

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 15/172 (9%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
             YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  112  GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  156

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  157  YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  216

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL+ YREI
Sbjct  217  IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREI  268



>ref|XP_007044867.1| Copine family isoform 1 [Theobroma cacao]
 ref|XP_007044868.1| Copine family isoform 1 [Theobroma cacao]
 ref|XP_007044869.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00699.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00700.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00701.1| Copine family isoform 1 [Theobroma cacao]
Length=467

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 151/213 (71%), Gaps = 35/213 (16%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswN-----YEYPQTAYPPQ-----PQESYNYPVQHaypsy  171
            MGGKSS++ S  +   S S+  +        PQ+AYPP+     PQ  Y  P  +     
Sbjct  1    MGGKSSKESSGGRYPTSRSAGSDAWSPYVHPPQSAYPPENSYYTPQHRYGPPPSY-----  55

Query  172  appppqeqqypppsqDFASRNHAPPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESS  345
                           ++ SR    PQ  + L+R+YSRIADNY +L++VT ALA+AGLESS
Sbjct  56   ---------------NYGSRT---PQLHKSLERKYSRIADNYQTLDQVTAALAQAGLESS  97

Query  346  NLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGF  525
            NLIVGIDFTKSNEWTG +SFN RSLH+IG+G NPYEQAISIIG++L+AFD+DNLIPC+GF
Sbjct  98   NLIVGIDFTKSNEWTGARSFNRRSLHHIGNGQNPYEQAISIIGQSLSAFDEDNLIPCYGF  157

Query  526  GDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            GDASTHDQDVFSFYP+ERFCNGFEEVL+ YREI
Sbjct  158  GDASTHDQDVFSFYPEERFCNGFEEVLARYREI  190



>ref|XP_003601893.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
Length=531

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 15/172 (9%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
             YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  122  GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  166

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  167  YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  226

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL+ YREI
Sbjct  227  IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREI  278



>ref|XP_007163691.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
 gb|ESW35685.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
Length=464

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  411
            ++A P+R+LDR+YSRIADNY SL+EVT  LA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  83   DNAQPKRKLDRKYSRIADNYRSLDEVTAELANAGLESSNLIVGIDFTKSNEWTGKRSFNR  142

Query  412  RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  591
            +SLH+IG   NPYE AISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSF+ +ERFCNG
Sbjct  143  KSLHDIGSCQNPYEHAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFFSEERFCNG  202

Query  592  FEEVLSXYREI  624
            FEEVLS YREI
Sbjct  203  FEEVLSRYREI  213



>gb|KHN29015.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=826

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 154/208 (74%), Gaps = 27/208 (13%)
 Frame = +1

Query  22   MGGKSS-----RDDswrqasrstssswNYEYPQT--AYPPQPQESYNYPVQHaypsyapp  180
            MGGKSS     R  S   ++ S+SS  +YEYPQ+  AYP Q    Y+ P+ H  P+    
Sbjct  1    MGGKSSKGSERRHVSSYGSAGSSSSWDDYEYPQSPNAYPQQ--NPYHTPLHHRAPAPF--  56

Query  181  ppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  360
                             +++ P+R+LDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIVG
Sbjct  57   ----------------HDYSQPKRKLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIVG  100

Query  361  IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  540
            IDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAST
Sbjct  101  IDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAST  160

Query  541  HDQDVFSFYPDERFCNGFEEVLSXYREI  624
            HDQDVFSF+ DERFCNGFEEVLS YR+I
Sbjct  161  HDQDVFSFHSDERFCNGFEEVLSRYRDI  188



>ref|XP_002515058.1| copine, putative [Ricinus communis]
 gb|EEF47612.1| copine, putative [Ricinus communis]
Length=478

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQ+RLDR+YSRIAD+Y +L++VT ALA++GLESSNLIVGIDFTKSNEWTG +S+N RSLH
Sbjct  74   PQKRLDRKYSRIADDYKTLDQVTAALAQSGLESSNLIVGIDFTKSNEWTGARSYNRRSLH  133

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG+G NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSF+ DERFCNGFEEV
Sbjct  134  HIGNGQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFHQDERFCNGFEEV  193

Query  604  LSXYREI  624
            L+ YREI
Sbjct  194  LTRYREI  200



>emb|CDP12686.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 131/180 (73%), Gaps = 31/180 (17%)
 Frame = +1

Query  94   EYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQ---RRLDR  264
            +YPQ  Y   PQ SYNY                                PPQ   RRL+R
Sbjct  33   QYPQPGYNYAPQPSYNY----------------------------APAPPPQESRRRLER  64

Query  265  RYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLN  444
            +YSRI D+Y SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH++G G N
Sbjct  65   KYSRIDDDYTSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHHLGDGQN  124

Query  445  PYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            PYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFC+GFEEVLS YRE+
Sbjct  125  PYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCDGFEEVLSRYREL  184



>gb|KHN00030.1| E3 ubiquitin-protein ligase RGLG1 [Glycine soja]
Length=428

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L+RRYSRI+D+Y+S+++V+EALA AGLESSNLIVG+DFTKSNEWTGK SFN RSLH+IG
Sbjct  63   KLERRYSRISDHYSSIDQVSEALALAGLESSNLIVGVDFTKSNEWTGKNSFNRRSLHHIG  122

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
             GLNPYEQAISIIGK+LAAFD+DNLIPCFGFGDASTHDQDVFSFYP ERFC+GFE+VLS 
Sbjct  123  RGLNPYEQAISIIGKSLAAFDEDNLIPCFGFGDASTHDQDVFSFYPSERFCDGFEDVLSR  182

Query  613  YREI  624
            YREI
Sbjct  183  YREI  186



>ref|XP_003555130.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006604100.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006604101.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 ref|XP_006604102.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Glycine max]
 ref|XP_006604103.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X5 
[Glycine max]
 ref|XP_006604104.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X6 
[Glycine max]
Length=428

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L+RRYSRI+D+Y+S+++V+EALA AGLESSNLIVG+DFTKSNEWTGK SFN RSLH+IG
Sbjct  63   KLERRYSRISDHYSSIDQVSEALALAGLESSNLIVGVDFTKSNEWTGKNSFNRRSLHHIG  122

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
             GLNPYEQAISIIGK+LAAFD+DNLIPCFGFGDASTHDQDVFSFYP ERFC+GFE+VLS 
Sbjct  123  RGLNPYEQAISIIGKSLAAFDEDNLIPCFGFGDASTHDQDVFSFYPSERFCDGFEDVLSR  182

Query  613  YREI  624
            YREI
Sbjct  183  YREI  186



>ref|XP_006439965.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
 gb|ESR53205.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
Length=309

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63   RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123  GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  610  XYREI  624
             YRE+
Sbjct  183  RYREL  187



>ref|XP_008221938.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Prunus mume]
Length=445

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 136/178 (76%), Gaps = 13/178 (7%)
 Frame = +1

Query  91   YEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRY  270
            Y YPQ + PPQ    Y  P +H  PS +     +         F   N   P+RRLDR+Y
Sbjct  29   YGYPQPSRPPQ--NPYCTPQRHYAPSPSFNHVSQ--------PFTVPN---PRRRLDRKY  75

Query  271  SRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPY  450
            S+IADNY SL+EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SFN +SLH+IG+  NPY
Sbjct  76   SKIADNYRSLDEVTSALAQAGLESSNLIVGIDFTKSNEWTGSRSFNRKSLHHIGNVQNPY  135

Query  451  EQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            EQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY DE++CNGFEEVL+ YREI
Sbjct  136  EQAISIIGKTLSVFDEDNLIPCFGFGDASTHDQDVFSFYQDEQYCNGFEEVLARYREI  193



>ref|XP_010524288.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Tarenaya hassleriana]
Length=431

 Score =   223 bits (567),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S++H   +++L+R+YSRIAD+Y+SLE+VTEALA AGLESSNLIVG+DFTKSNEWTG KSF
Sbjct  45   SQSHGNGRKKLERKYSRIADDYSSLEQVTEALALAGLESSNLIVGVDFTKSNEWTGAKSF  104

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH  G  LNPYEQAI+IIGKTLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFC
Sbjct  105  NKKSLHFTGISLNPYEQAITIIGKTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFC  164

Query  586  NGFEEVLSXYREI  624
            NGFEEVL+ YREI
Sbjct  165  NGFEEVLARYREI  177



>ref|XP_010524289.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Tarenaya hassleriana]
Length=430

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S++H   +++L+R+YSRIAD+Y+SLE+VTEALA AGLESSNLIVG+DFTKSNEWTG KSF
Sbjct  45   SQSHGNGRKKLERKYSRIADDYSSLEQVTEALALAGLESSNLIVGVDFTKSNEWTGAKSF  104

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH  G  LNPYEQAI+IIGKTLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFC
Sbjct  105  NKKSLHFTGISLNPYEQAITIIGKTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFC  164

Query  586  NGFEEVLSXYREI  624
            NGFEEVL+ YREI
Sbjct  165  NGFEEVLARYREI  177



>ref|XP_008446129.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008446130.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
Length=435

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +1

Query  220  FASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            + S+    P+RRLDR+YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTG +
Sbjct  50   YGSQTPQQPRRRLDRKYSRIADNYQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGSR  109

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SFN RSLH+IG+  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFY D+R
Sbjct  110  SFNRRSLHHIGNEPNPYEQAISIIGQTLSAFDEDNLIPCFGFGDASTHDQDVFSFYHDDR  169

Query  580  FCNGFEEVLSXYREI  624
             CNGFEEVL  YREI
Sbjct  170  ICNGFEEVLHRYREI  184



>ref|XP_008464939.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
 ref|XP_008464940.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
 ref|XP_008464941.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
Length=445

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            ++ DRRYSRIADNY SLEEVT ALARAGLESSNLI+GIDFTKSNEWTG +SFN RSLH+I
Sbjct  72   KKFDRRYSRIADNYKSLEEVTGALARAGLESSNLIIGIDFTKSNEWTGARSFNKRSLHDI  131

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
             +G NPYEQAISI+GKTL+AFDDDNLIPCFGFGDA THDQDVFSFYP+ RFCNGFE+VL+
Sbjct  132  RNGPNPYEQAISIVGKTLSAFDDDNLIPCFGFGDAFTHDQDVFSFYPEGRFCNGFEDVLN  191

Query  610  XYREI  624
             YREI
Sbjct  192  RYREI  196



>ref|XP_002282202.2| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650735.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650741.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650743.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650748.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650751.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650756.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 emb|CBI16816.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 148/207 (71%), Gaps = 23/207 (11%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYE-YPQT-----AYPPQPQESYNYPVQHaypsyappp  183
            MGGKSS+  S R+     SSS+N+  Y Q+     AYP QP   Y+ P  H+ P      
Sbjct  1    MGGKSSKRRSGREYPSFESSSFNHHGYSQSQPYEEAYPAQP---YHTPQHHSPPPPRYYS  57

Query  184  pqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGI  363
                         A   H  PQ  LDRRYSRIADNYNSL++VT ALA+AGLESSNLIVGI
Sbjct  58   G------------AQTPHRHPQ--LDRRYSRIADNYNSLDQVTAALAQAGLESSNLIVGI  103

Query  364  DFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTH  543
            DFTKSNEWTG +SFN +SLH+IG G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTH
Sbjct  104  DFTKSNEWTGSRSFNRKSLHHIGRGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTH  163

Query  544  DQDVFSFYPDERFCNGFEEVLSXYREI  624
            DQD+FSFY DER CNGFEEVL  YRE+
Sbjct  164  DQDIFSFYQDERPCNGFEEVLMRYREL  190



>ref|XP_008341364.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
 ref|XP_008341365.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
 ref|XP_008341366.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
Length=463

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 132/172 (77%), Gaps = 17/172 (10%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
            +YPP PQESY                Q    P  S   A R     ++  DRRYSRIADN
Sbjct  45   SYPPPPQESYQ-------------SAQPYYAPVYSAPAAPRAQ---EKTFDRRYSRIADN  88

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y+SLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH+IG+G NPYE AISI
Sbjct  89   YHSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHHIGNGPNPYEHAISI  148

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTLAAFD+DNLIPCFGFGDA+THDQDVFSFY D+R+CNGFEEVL+ Y+EI
Sbjct  149  IGKTLAAFDEDNLIPCFGFGDATTHDQDVFSFY-DDRYCNGFEEVLTRYKEI  199



>ref|XP_009371747.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Pyrus x bretschneideri]
Length=463

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 132/172 (77%), Gaps = 17/172 (10%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
            +YPP PQESY                Q    P  S   A R     ++  DRRYSRIADN
Sbjct  45   SYPPPPQESYQ-------------SAQPYYAPVYSAPAAPRAQ---EKTFDRRYSRIADN  88

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y+SLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH+IG+G NPYE AISI
Sbjct  89   YHSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHHIGNGPNPYEHAISI  148

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTLAAFD+DNLIPCFGFGDA+THDQDVFSFY D+R+CNGFEEVL+ Y+EI
Sbjct  149  IGKTLAAFDEDNLIPCFGFGDATTHDQDVFSFY-DDRYCNGFEEVLARYKEI  199



>gb|KJB51127.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=318

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62   KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122  IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  607  SXYREI  624
              YRE+
Sbjct  182  RRYREL  187



>ref|XP_002318092.2| hypothetical protein POPTR_0012s09190g [Populus trichocarpa]
 gb|EEE96312.2| hypothetical protein POPTR_0012s09190g [Populus trichocarpa]
Length=433

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  APPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRS  417
            AP  RRL+R+YS+I DNYNSL +VTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RS
Sbjct  54   APNSRRLERKYSKIDDNYNSLVQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFSHRS  113

Query  418  LHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFE  597
            LH+IG   NPYEQAI IIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFCNGFE
Sbjct  114  LHHIGDDQNPYEQAIYIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCNGFE  173

Query  598  EVLSXYREI  624
            EVL  YRE+
Sbjct  174  EVLRRYREL  182



>ref|XP_011040451.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014652.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014653.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014654.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014655.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=433

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  APPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRS  417
            AP  RRL+R+YS+I DNYNSL +VTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RS
Sbjct  54   APNSRRLERKYSKIDDNYNSLVQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFSHRS  113

Query  418  LHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFE  597
            LH+IG   NPYEQAI IIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFCNGFE
Sbjct  114  LHHIGDDQNPYEQAIYIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCNGFE  173

Query  598  EVLSXYREI  624
            EVL  YRE+
Sbjct  174  EVLRRYREL  182



>gb|KEH22094.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=404

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L R+YSRIADNYNS++EVTEAL RAGLESSNLIVG+DFTKSNEWTGK SF  +SLH+ G
Sbjct  76   KLQRKYSRIADNYNSIDEVTEALGRAGLESSNLIVGVDFTKSNEWTGKNSFRRQSLHHTG  135

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
              LNPYEQAISIIGKT+A FDDDNLIPCFGFGDASTHDQDVFSFYPD  FCNGFE+VLS 
Sbjct  136  SDLNPYEQAISIIGKTMAEFDDDNLIPCFGFGDASTHDQDVFSFYPDGSFCNGFEDVLSR  195

Query  613  YREI  624
            YREI
Sbjct  196  YREI  199



>gb|ACA04857.1| putative copine I [Picea abies]
Length=220

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            + +L RRYSRIADNYNSL+EVT ALA+AGLESSNLIVGIDFTKSNEWTG KSFN RSLH 
Sbjct  66   KNKLQRRYSRIADNYNSLDEVTAALAQAGLESSNLIVGIDFTKSNEWTGAKSFNHRSLHR  125

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGD STHDQ+ FSFYPD R CNGFEE L
Sbjct  126  IGDTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDVSTHDQNAFSFYPDNRLCNGFEEAL  185

Query  607  SXYREI  624
              YRE+
Sbjct  186  RHYREM  191



>ref|XP_010026980.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 ref|XP_010026984.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 ref|XP_010026991.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 gb|KCW83242.1| hypothetical protein EUGRSUZ_B00181 [Eucalyptus grandis]
Length=438

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +1

Query  241  PP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  414
            PP  +R+L+R++S+I D+Y SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +
Sbjct  60   PPHSERKLERKFSKINDDYTSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGGRSFNRK  119

Query  415  SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  594
            SLH+IG G NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF+PDE+FCNGF
Sbjct  120  SLHHIGDGQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFFPDEKFCNGF  179

Query  595  EEVLSXYREI  624
            EEVL+ YRE+
Sbjct  180  EEVLTRYREL  189



>ref|XP_006439964.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
 gb|ESR53204.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
Length=409

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63   RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123  GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  610  XYREI  624
             YRE+
Sbjct  183  RYREL  187



>ref|XP_009370343.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Pyrus x bretschneideri]
 ref|XP_009370344.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Pyrus x bretschneideri]
Length=463

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 131/172 (76%), Gaps = 17/172 (10%)
 Frame = +1

Query  109  AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  288
            +YPP PQESY                Q    P  S   A R     ++  DRRYSRIADN
Sbjct  45   SYPPPPQESYQ-------------SAQPYYAPVYSAPAAPRAQ---EKTFDRRYSRIADN  88

Query  289  YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  468
            Y+SLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH+IG+G NPYE AISI
Sbjct  89   YHSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHHIGNGPNPYEHAISI  148

Query  469  IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            IGKTLAAFD+DNLIPCFGFGDA+THDQDVFSFY D R+CNGFEEVL+ Y+EI
Sbjct  149  IGKTLAAFDEDNLIPCFGFGDATTHDQDVFSFYED-RYCNGFEEVLARYKEI  199



>gb|EYU22544.1| hypothetical protein MIMGU_mgv1a006738mg [Erythranthe guttata]
Length=433

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 4/137 (3%)
 Frame = +1

Query  226  SRNHAPP----QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG  393
            S  HAPP     RRLDRR+ RIADNY +L++VT AL+++GLESSNLIVGIDFTKSNEWTG
Sbjct  44   SYTHAPPAPQPNRRLDRRFIRIADNYQTLDQVTSALSKSGLESSNLIVGIDFTKSNEWTG  103

Query  394  KKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD  573
             KSFN +SLH+IG G NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHD+DVFSFYPD
Sbjct  104  AKSFNRKSLHHIGSGPNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDRDVFSFYPD  163

Query  574  ERFCNGFEEVLSXYREI  624
             RFC+GFEEVL  YR++
Sbjct  164  GRFCDGFEEVLRRYRDL  180



>gb|KHG28565.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=463

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = +1

Query  232  NHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  408
            +HAP  +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+
Sbjct  73   SHAPESKRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFH  132

Query  409  GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  588
             RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCN
Sbjct  133  RRSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCN  192

Query  589  GFEEVLSXYREI  624
            GFEEVL  YRE+
Sbjct  193  GFEEVLRRYREL  204



>gb|KHG28566.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=456

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = +1

Query  232  NHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  408
            +HAP  +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+
Sbjct  73   SHAPESKRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFH  132

Query  409  GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  588
             RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCN
Sbjct  133  RRSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCN  192

Query  589  GFEEVLSXYREI  624
            GFEEVL  YRE+
Sbjct  193  GFEEVLRRYREL  204



>gb|KHG03783.1| E3 ubiquitin-protein ligase RGLG2 -like protein [Gossypium arboreum]
Length=488

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 147/217 (68%), Gaps = 44/217 (20%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswN----YEYP-QTAYPPQPQESYNYPVQHaypsyapppp  186
            MGGKSS+D S R    S S   +    Y YP Q+ YPPQ    Y  P  H          
Sbjct  1    MGGKSSKDSSGRAYPTSRSGGSDSWSRYGYPPQSGYPPQ--TPYYTPQHH----------  48

Query  187  qeqqypppsqDFASRNHAPPQ------RRLDR-----RYSRIADNYNSLEEVTEALARAG  333
                            HAPP       + L+R     +YSRIADNY +L++VT ALA+AG
Sbjct  49   ----------------HAPPHSSNYGLQTLNRGHKIVKYSRIADNYETLDQVTAALAQAG  92

Query  334  LESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIP  513
            LESSNLIVGIDFTKSNEWTG +SFN +SLH+IG+G NPYEQAISIIG++L+AFD+DNLIP
Sbjct  93   LESSNLIVGIDFTKSNEWTGARSFNRKSLHHIGNGQNPYEQAISIIGQSLSAFDEDNLIP  152

Query  514  CFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            C+GFGDASTHDQDVFSFYP+ERFCNGFEEVL+ YREI
Sbjct  153  CYGFGDASTHDQDVFSFYPEERFCNGFEEVLARYREI  189



>ref|XP_006399953.1| hypothetical protein EUTSA_v10013466mg [Eutrema salsugineum]
 gb|ESQ41406.1| hypothetical protein EUTSA_v10013466mg [Eutrema salsugineum]
Length=465

 Score =   221 bits (563),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S+++   ++RL+R+YSRI+DNY+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG KSF
Sbjct  79   SQSYGSDKKRLERKYSRISDNYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGAKSF  138

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH IG   NPYEQAI+IIG++LAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  139  NRKSLHFIGSSPNPYEQAITIIGRSLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  198

Query  586  NGFEEVLSXYREI  624
            NGFEEVL+ Y+EI
Sbjct  199  NGFEEVLARYKEI  211



>ref|XP_006476914.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
Length=449

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 153/210 (73%), Gaps = 20/210 (10%)
 Frame = +1

Query  4    VAVIELMGGKSSRDDswrqas--rstssswNYEYPQTAYPPQPQESYNYPVQHaypsyap  177
            + VIELMGG  S+ +S RQ S   S+ S  ++ YPQ   PP  Q S  Y  Q  Y + + 
Sbjct  9    LLVIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQ--PPYGQPSQEYAPQQYYATPSQ  66

Query  178  pppqeqqypppsqDFASRNHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLI  354
                          ++ R  AP   R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLI
Sbjct  67   -------------SYSGR--APESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLI  111

Query  355  VGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDA  534
            VGIDFTKSNEWTG +SF  RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDA
Sbjct  112  VGIDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDA  171

Query  535  STHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            STHDQ+VFSFYPDE+FCNGFEEVL  YRE+
Sbjct  172  STHDQEVFSFYPDEKFCNGFEEVLRRYREL  201



>gb|KJB51128.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=413

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62   KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122  IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  607  SXYREI  624
              YRE+
Sbjct  182  RRYREL  187



>ref|XP_010912939.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
Length=472

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +LDRRYS+IADNYNSLE+VTEALA++GLESSNLIVGIDFTKSNEWTGK SFN RSLH+I 
Sbjct  98   KLDRRYSKIADNYNSLEQVTEALAQSGLESSNLIVGIDFTKSNEWTGKHSFNRRSLHSIS  157

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGF E L+ 
Sbjct  158  DTKNPYEQAISIIGQTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERPCNGFPEALAR  217

Query  613  YREI  624
            YREI
Sbjct  218  YREI  221



>gb|KJB51125.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=406

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62   KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122  IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  607  SXYREI  624
              YRE+
Sbjct  182  RRYREL  187



>gb|KDO69439.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=460

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 153/210 (73%), Gaps = 20/210 (10%)
 Frame = +1

Query  4    VAVIELMGGKSSRDDswrqas--rstssswNYEYPQTAYPPQPQESYNYPVQHaypsyap  177
            + VIELMGG  S+ +S RQ S   S+ S  ++ YPQ   PP  Q S  Y  Q  Y + + 
Sbjct  20   LLVIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQ--PPYGQPSQEYAPQQYYATPSQ  77

Query  178  pppqeqqypppsqDFASRNHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLI  354
                          ++ R  AP   R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLI
Sbjct  78   -------------SYSGR--APESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLI  122

Query  355  VGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDA  534
            VGIDFTKSNEWTG +SF  RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDA
Sbjct  123  VGIDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDA  182

Query  535  STHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            STHDQ+VFSFYPDE+FCNGFEEVL  YRE+
Sbjct  183  STHDQEVFSFYPDEKFCNGFEEVLRRYREL  212



>gb|KJB51126.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=439

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62   KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122  IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  607  SXYREI  624
              YRE+
Sbjct  182  RRYREL  187



>gb|KDO69440.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=466

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 153/210 (73%), Gaps = 20/210 (10%)
 Frame = +1

Query  4    VAVIELMGGKSSRDDswrqas--rstssswNYEYPQTAYPPQPQESYNYPVQHaypsyap  177
            + VIELMGG  S+ +S RQ S   S+ S  ++ YPQ   PP  Q S  Y  Q  Y + + 
Sbjct  26   LLVIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQ--PPYGQPSQEYAPQQYYATPSQ  83

Query  178  pppqeqqypppsqDFASRNHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLI  354
                          ++ R  AP   R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLI
Sbjct  84   -------------SYSGR--APESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLI  128

Query  355  VGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDA  534
            VGIDFTKSNEWTG +SF  RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDA
Sbjct  129  VGIDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDA  188

Query  535  STHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            STHDQ+VFSFYPDE+FCNGFEEVL  YRE+
Sbjct  189  STHDQEVFSFYPDEKFCNGFEEVLRRYREL  218



>ref|XP_007037786.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007037787.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY22287.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY22288.1| RING domain ligase2 isoform 1 [Theobroma cacao]
Length=456

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            RRL+R+YS+I DNYNSLE+VTEALARAGLESSNLIVGID+TKSNEWTG +SF+ RSLH+I
Sbjct  82   RRLERKYSKIDDNYNSLEQVTEALARAGLESSNLIVGIDYTKSNEWTGARSFHRRSLHHI  141

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL 
Sbjct  142  GDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVLR  201

Query  610  XYREI  624
             YRE+
Sbjct  202  RYREL  206



>ref|XP_010420077.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010420078.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
Length=464

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YSRI+DNY+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  88   KKRLERKYSRISDNYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  147

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFCNGFEEVL
Sbjct  148  IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFCNGFEEVL  207

Query  607  SXYREI  624
            + Y+EI
Sbjct  208  ARYKEI  213



>ref|XP_003622329.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES78547.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=445

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L R+YSRIADNYNS++EVTEAL RAGLESSNLIVG+DFTKSNEWTGK SF  +SLH+ G
Sbjct  76   KLQRKYSRIADNYNSIDEVTEALGRAGLESSNLIVGVDFTKSNEWTGKNSFRRQSLHHTG  135

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
              LNPYEQAISIIGKT+A FDDDNLIPCFGFGDASTHDQDVFSFYPD  FCNGFE+VLS 
Sbjct  136  SDLNPYEQAISIIGKTMAEFDDDNLIPCFGFGDASTHDQDVFSFYPDGSFCNGFEDVLSR  195

Query  613  YREI  624
            YREI
Sbjct  196  YREI  199



>ref|XP_010519134.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519135.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519136.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519137.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
Length=430

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++L+R+YS+I D+Y+SL++VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+
Sbjct  61   KKKLERKYSKINDDYSSLDQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHH  120

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYE+AI+I+GKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFCNGFEEVL
Sbjct  121  IGDSQNPYEEAIAIVGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCNGFEEVL  180

Query  607  SXYREI  624
            S YRE+
Sbjct  181  SRYREL  186



>ref|XP_006408532.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 ref|XP_006408533.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 ref|XP_006408534.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49985.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49986.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49987.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
Length=472

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  ASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS  402
            AS++H    ++ DRRYS+I+DNY SL++V+EAL RAGLESSNLIVGIDFTKSNEWTG  S
Sbjct  97   ASQSHGSDGKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLIVGIDFTKSNEWTGANS  156

Query  403  FNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERF  582
            FN +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RF
Sbjct  157  FNRKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRF  216

Query  583  CNGFEEVLSXYREI  624
            CNGFEEVL+ YREI
Sbjct  217  CNGFEEVLARYREI  230



>ref|XP_010927545.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Elaeis guineensis]
Length=388

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RLDRRYS+I D+Y+S+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+IG
Sbjct  79   RLDRRYSKITDDYSSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHHIG  138

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQD+FSFYPDER C+GF E L+ 
Sbjct  139  DIPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDIFSFYPDERSCDGFTEALAR  198

Query  613  YREI  624
            YRE+
Sbjct  199  YREL  202



>ref|XP_006439963.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
 gb|ESR53203.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
Length=435

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63   RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123  GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  610  XYREI  624
             YRE+
Sbjct  183  RYREL  187



>gb|KDO69441.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
 gb|KDO69442.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=435

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63   RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123  GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  610  XYREI  624
             YRE+
Sbjct  183  RYREL  187



>ref|XP_006476915.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
 ref|XP_006476916.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Citrus sinensis]
 ref|XP_006476917.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Citrus sinensis]
Length=435

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63   RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123  GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  610  XYREI  624
             YRE+
Sbjct  183  RYREL  187



>gb|ABK24359.1| unknown [Picea sitchensis]
Length=423

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++L RRYSRIADNYNSL+EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH+
Sbjct  47   KQKLQRRYSRIADNYNSLDEVTAALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHH  106

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ VFSFYPD+R CNGFEE L
Sbjct  107  IGDTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQHVFSFYPDDRLCNGFEEAL  166

Query  607  SXYREI  624
              YREI
Sbjct  167  RRYREI  172



>gb|KJB51129.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=450

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 147/216 (68%), Gaps = 32/216 (15%)
 Frame = +1

Query  4    VAVIELMGG---KSSRDDswrqasrstssswNYEYPQTAYPPQ-----PQESYNYPVQHa  159
            +++IELMGG   K S        + ++ S  ++ Y Q +Y P      P++ Y  P    
Sbjct  8    ISIIELMGGIISKRSTTSQSSSVASNSYSWDSHRYAQPSYAPSGQDYVPEQRYAPPYHSY  67

Query  160  ypsyappppqeqqypppsqDFASRNHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGL  336
                                     +AP  +RRL+R++S+I DNYNSLE+VT+ALARAGL
Sbjct  68   G-----------------------GYAPESKRRLERKFSKIDDNYNSLEQVTDALARAGL  104

Query  337  ESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPC  516
            ESSNLIVGIDFTKSNEWTG +SF+ RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPC
Sbjct  105  ESSNLIVGIDFTKSNEWTGARSFHRRSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPC  164

Query  517  FGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            FGFGDASTHDQ+VFSFYPDE FCNGFEEVL  YRE+
Sbjct  165  FGFGDASTHDQEVFSFYPDETFCNGFEEVLRRYREL  200



>gb|EPS73512.1| hypothetical protein M569_01244 [Genlisea aurea]
Length=425

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 141/207 (68%), Gaps = 32/207 (15%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqy  201
            MGGK S++    + S   S+  ++ +     PP  Q SY Y                   
Sbjct  1    MGGKGSKNAVSGRYSSYVSNQNSWNHQSYPQPPPAQPSYGY-------------------  41

Query  202  pppsqDFASRNHA----PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGI  363
                    SRN A    PPQ  RRL+R++S+I DNYNSL++VT+ALARAGLESSNLIVGI
Sbjct  42   -------GSRNPAYDAPPPQAKRRLERKFSKIDDNYNSLDQVTDALARAGLESSNLIVGI  94

Query  364  DFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTH  543
            DFTKSNEWTG +SF+ R LH+IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTH
Sbjct  95   DFTKSNEWTGARSFHRRCLHHIGDEQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTH  154

Query  544  DQDVFSFYPDERFCNGFEEVLSXYREI  624
            DQ+VF FYPDERFC GFEEVL+ YRE+
Sbjct  155  DQEVFGFYPDERFCEGFEEVLTRYREL  181



>gb|KJB51124.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51131.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51132.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51133.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=437

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62   KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122  IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  607  SXYREI  624
              YRE+
Sbjct  182  RRYREL  187



>ref|XP_010932261.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
 ref|XP_010932262.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
Length=456

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RLDRRYS+I D+YNS+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH++G
Sbjct  81   RLDRRYSKITDDYNSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHVG  140

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGF E L+ 
Sbjct  141  DIPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERPCNGFSEALAR  200

Query  613  YREI  624
            YRE+
Sbjct  201  YREL  204



>ref|XP_010927546.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Elaeis guineensis]
Length=349

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RLDRRYS+I D+Y+S+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+IG
Sbjct  79   RLDRRYSKITDDYSSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHHIG  138

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQD+FSFYPDER C+GF E L+ 
Sbjct  139  DIPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDIFSFYPDERSCDGFTEALAR  198

Query  613  YREI  624
            YRE+
Sbjct  199  YREL  202



>ref|XP_004236287.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Solanum lycopersicum]
 ref|XP_010319032.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Solanum lycopersicum]
Length=437

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  241  PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  414
            PP+  +RL+R++S+I D+YNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  51   PPESRKRLERKFSKIDDDYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRK  110

Query  415  SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  594
            SLH+IG G NPYEQAISIIG+TL+ FD+DNLIPC+GFGDASTHDQ+VFSFYPDE+FCNGF
Sbjct  111  SLHHIGDGQNPYEQAISIIGRTLSKFDEDNLIPCYGFGDASTHDQEVFSFYPDEKFCNGF  170

Query  595  EEVLSXYREI  624
            EEVL  YRE+
Sbjct  171  EEVLGRYREL  180



>ref|XP_004138080.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 ref|XP_004169870.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
Length=432

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YSRI DNYNSL++VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+
Sbjct  61   RKRLERKYSRIDDNYNSLDQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHH  120

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TL++FD+DN+IPCFGFGDASTHDQ+VFSFY DERFCNGFEEVL
Sbjct  121  IGEEQNPYEQAIAIIGQTLSSFDEDNMIPCFGFGDASTHDQEVFSFYSDERFCNGFEEVL  180

Query  607  SXYREI  624
              Y+E+
Sbjct  181  GRYKEL  186



>ref|XP_008797006.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008797015.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=454

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 131/178 (74%), Gaps = 13/178 (7%)
 Frame = +1

Query  91   YEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRY  270
            YE P     P P + Y  PVQ    +  PPP                     +RRLDRRY
Sbjct  38   YEAPGYQNYPPPSQRYGEPVQAYPQTPPPPPQTPPAGGS-------------RRRLDRRY  84

Query  271  SRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPY  450
            S+I D+YNS+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+IG   NPY
Sbjct  85   SKITDDYNSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHHIGDIPNPY  144

Query  451  EQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            EQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVFSFYPDER CNGF E L+ YRE+
Sbjct  145  EQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDERSCNGFTEALARYREL  202



>ref|XP_002298557.2| hypothetical protein POPTR_0001s35660g [Populus trichocarpa]
 gb|EEE83362.2| hypothetical protein POPTR_0001s35660g [Populus trichocarpa]
Length=447

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  277  IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  456
            IAD+Y SL +VTEALARAGLESSNLIVGIDFTKSNEWTG +S+N R LH+IG G NPYEQ
Sbjct  81   IADDYKSLHQVTEALARAGLESSNLIVGIDFTKSNEWTGARSYNRRCLHHIGDGFNPYEQ  140

Query  457  AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            AISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS YREI
Sbjct  141  AISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSRYREI  196



>ref|XP_007215340.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 ref|XP_007215341.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 gb|EMJ16539.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 gb|EMJ16540.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
Length=465

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 146/205 (71%), Gaps = 12/205 (6%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYP----PQPQESYNYPVQHaypsyappppq  189
            MGG+SS++ S+RQ S S S+S ++ YPQ   P    P  QES +YP           P  
Sbjct  1    MGGRSSKEGSFRQNSSSRSTSSSWSYPQVQSPYVQSPYAQESQSYPPPQQAYPATSQPYY  60

Query  190  eqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDF  369
                     D+       P   L+R+YS I+D+Y SLEEVTEALARAGLESSNLIVGIDF
Sbjct  61   PPSQ-----DYGGARATRP--TLERKYSIISDSYKSLEEVTEALARAGLESSNLIVGIDF  113

Query  370  TKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQ  549
            TKSNEWTG KSFN +SLH+IG G NPYE AISIIGKTLA FD+DNLIPCFGFGDASTHDQ
Sbjct  114  TKSNEWTGSKSFNRKSLHHIGSGQNPYEHAISIIGKTLAVFDEDNLIPCFGFGDASTHDQ  173

Query  550  DVFSFYPDERFCNGFEEVLSXYREI  624
            DVFSFY D R+CNGFEEVL+ YREI
Sbjct  174  DVFSFYSD-RYCNGFEEVLTRYREI  197



>ref|XP_009419388.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Musa acuminata 
subsp. malaccensis]
Length=468

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R LDRRYSRI+DNYNSL++VTEAL++AGLESSNLIVG+DFTKSNEWTGK SF GRSLH+I
Sbjct  80   RTLDRRYSRISDNYNSLDQVTEALSQAGLESSNLIVGVDFTKSNEWTGKHSFRGRSLHHI  139

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G   NPYEQA+SIIG+TL+AFD+DNLIPCFGFGDASTHDQD+FSFYPDER CNGF E L 
Sbjct  140  GDSPNPYEQAMSIIGRTLSAFDEDNLIPCFGFGDASTHDQDIFSFYPDERPCNGFSEALE  199

Query  610  XYREI  624
             Y+E+
Sbjct  200  RYKEL  204



>ref|XP_008464499.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008464500.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008464501.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
Length=430

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YSRI DNYNSL++VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+
Sbjct  59   RKRLERKYSRIDDNYNSLDQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHH  118

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TL++FD+DN+IPCFGFGDASTHDQ+VFSFY DERFCNGFEEVL
Sbjct  119  IGDEQNPYEQAIAIIGQTLSSFDEDNMIPCFGFGDASTHDQEVFSFYSDERFCNGFEEVL  178

Query  607  SXYREI  624
              Y+E+
Sbjct  179  GRYKEL  184



>ref|XP_006351421.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Solanum tuberosum]
 ref|XP_006351422.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Solanum tuberosum]
Length=439

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  241  PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  414
            PP+  +RL+R++S+I D+YNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  53   PPESRKRLERKFSKIDDDYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGTRSFHRK  112

Query  415  SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  594
            SLH+IG G NPYEQAISIIG+TL+ FD+DNLIPC+GFGDASTHDQ+VFSFYPDE+FCNGF
Sbjct  113  SLHHIGDGQNPYEQAISIIGRTLSKFDEDNLIPCYGFGDASTHDQEVFSFYPDEKFCNGF  172

Query  595  EEVLSXYREI  624
            EEVL  YRE+
Sbjct  173  EEVLGRYREL  182



>gb|KCW52958.1| hypothetical protein EUGRSUZ_J02261 [Eucalyptus grandis]
Length=431

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +1

Query  277  IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  456
            IAD+YNSL+EVTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+IG GLNPYEQ
Sbjct  70   IADDYNSLDEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHHIGDGLNPYEQ  129

Query  457  AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            AISIIGKTLA FD+DNLIPC+GFGDASTHDQDVFSFYP +RFCNGFEEVLS YREI
Sbjct  130  AISIIGKTLAVFDEDNLIPCYGFGDASTHDQDVFSFYPADRFCNGFEEVLSRYREI  185



>ref|XP_008379181.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
 ref|XP_008379182.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
Length=484

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++ DRRYSRIAD+YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH+
Sbjct  95   EKKFDRRYSRIADSYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHH  154

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            +G+  NPYE AISIIGKTLA FD+DNLIPCFGFGDASTHDQDVFSFY D+R+CNGFEEVL
Sbjct  155  VGNTPNPYEHAISIIGKTLAVFDEDNLIPCFGFGDASTHDQDVFSFY-DDRYCNGFEEVL  213

Query  607  SXYREI  624
            + YREI
Sbjct  214  TRYREI  219



>gb|KGN63523.1| hypothetical protein Csa_1G002920 [Cucumis sativus]
Length=475

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = +1

Query  232  NHAPPQR-RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  408
              AP  R RL+R+YSRI DNYNSL++VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN
Sbjct  98   TQAPETRKRLERKYSRIDDNYNSLDQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFN  157

Query  409  GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  588
             RSLH+IG   NPYEQAI+IIG+TL++FD+DN+IPCFGFGDASTHDQ+VFSFY DERFCN
Sbjct  158  RRSLHHIGEEQNPYEQAIAIIGQTLSSFDEDNMIPCFGFGDASTHDQEVFSFYSDERFCN  217

Query  589  GFEEVLSXYREI  624
            GFEEVL  Y+E+
Sbjct  218  GFEEVLGRYKEL  229



>emb|CDX70564.1| BnaC03g06480D [Brassica napus]
Length=471

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S +H   ++RL+R+YS+I+D+Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  83   SYSHGNDKKRLERKYSKISDDYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSF  142

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  143  NRKSLHYIGNNPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  202

Query  586  NGFEEVLSXYREI  624
            NGFEEVL  Y+EI
Sbjct  203  NGFEEVLGRYKEI  215



>ref|NP_001240870.1| uncharacterized protein LOC100809850 [Glycine max]
 ref|XP_006577852.1| PREDICTED: uncharacterized protein LOC100809850 isoform X1 [Glycine 
max]
 gb|ACU22839.1| unknown [Glycine max]
Length=427

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  APPQ-RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  414
            AP Q + LDR+YSRI D+Y SL++VT+ALA+AGLESSNLIVGIDFTKSNEWTG +SF  R
Sbjct  51   APEQGKSLDRKYSRIGDDYKSLDQVTDALAKAGLESSNLIVGIDFTKSNEWTGGRSFQRR  110

Query  415  SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  594
             LH+IGH  NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFC GF
Sbjct  111  CLHHIGHEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCRGF  170

Query  595  EEVLSXYREI  624
            EEVL  YRE+
Sbjct  171  EEVLERYREL  180



>gb|KJB61002.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61003.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61004.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61005.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61006.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61007.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61008.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61009.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
Length=468

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 144/216 (67%), Gaps = 42/216 (19%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQ----PQESYNYPVQHaypsyappppq  189
            MGGKSS+D S R    S S   +  + +  YPPQ    PQ  Y  P  H           
Sbjct  1    MGGKSSKDSSGRAYPTSRSGGSD-SWSRYGYPPQSGYPPQTPYYTPRHH-----------  48

Query  190  eqqypppsqDFASRNHAPPQ------RRLDR-----RYSRIADNYNSLEEVTEALARAGL  336
                           HAPP       + L R     +YSRIADNY +L++VT ALA+AGL
Sbjct  49   ---------------HAPPHSSNYGLQTLHRGHKIVKYSRIADNYETLDQVTAALAQAGL  93

Query  337  ESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPC  516
            ESSNLIVGIDFTKSNEWTG +SFN +SLH+IG+G NPYEQAISIIG++L+AFD+DN IPC
Sbjct  94   ESSNLIVGIDFTKSNEWTGARSFNRKSLHHIGNGQNPYEQAISIIGQSLSAFDEDNFIPC  153

Query  517  FGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            +GFGDASTHDQDVFSFYP+ERFCNGFEEVL+ YREI
Sbjct  154  YGFGDASTHDQDVFSFYPEERFCNGFEEVLARYREI  189



>ref|XP_011101825.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Sesamum indicum]
Length=372

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  301  EEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKT  480
            ++VTEALARAGLESSNLIVGIDFTKSNEWTGK+S+NGRSLH+IG GLNPYEQAISI+GKT
Sbjct  16   DQVTEALARAGLESSNLIVGIDFTKSNEWTGKRSYNGRSLHHIGSGLNPYEQAISIVGKT  75

Query  481  LAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            LAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS YREI
Sbjct  76   LAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSRYREI  123



>ref|XP_010927542.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010927543.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Elaeis guineensis]
Length=454

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RLDRRYS+I D+Y+S+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+IG
Sbjct  79   RLDRRYSKITDDYSSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHHIG  138

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQD+FSFYPDER C+GF E L+ 
Sbjct  139  DIPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDIFSFYPDERSCDGFTEALAR  198

Query  613  YREI  624
            YRE+
Sbjct  199  YREL  202



>gb|EEE53061.1| hypothetical protein OsJ_35797 [Oryza sativa Japonica Group]
Length=355

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK+SFNG SLH+IG
Sbjct  165  KLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKRSFNGMSLHHIG  224

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAI+IIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L+ 
Sbjct  225  DSPNPYEQAITIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  284

Query  613  YREI  624
            YREI
Sbjct  285  YREI  288



>ref|XP_009131405.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Brassica 
rapa]
Length=471

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 136/176 (77%), Gaps = 5/176 (3%)
 Frame = +1

Query  112  YPPQPQESYNYP-----VQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSR  276
            YP    ESYNYP       H  P YA PPP       P     S +H   ++RL+R++S+
Sbjct  40   YPQYGPESYNYPPTPSYAPHPPPEYAQPPPAPSYSTQPYSQPPSYSHGNDKKRLERKFSK  99

Query  277  IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  456
            I+D Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH IG+  NPYEQ
Sbjct  100  ISDEYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHYIGNNPNPYEQ  159

Query  457  AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            AI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFCNGFEEVL  Y+EI
Sbjct  160  AITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFCNGFEEVLGRYKEI  215



>ref|XP_006297977.1| hypothetical protein CARUB_v10014021mg [Capsella rubella]
 ref|XP_006297978.1| hypothetical protein CARUB_v10014021mg [Capsella rubella]
 gb|EOA30875.1| hypothetical protein CARUB_v10014021mg [Capsella rubella]
 gb|EOA30876.1| hypothetical protein CARUB_v10014021mg [Capsella rubella]
Length=364

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  PPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSL  420
            P +++ DRRYS+I+DNY+SL++V+EAL RAGLESSNLIVGIDFTKSNEWTG  SFN ++L
Sbjct  92   PDRKKFDRRYSKISDNYSSLDQVSEALGRAGLESSNLIVGIDFTKSNEWTGANSFNKKNL  151

Query  421  HNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEE  600
            H++ +  NPYEQAI+I+G+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFCNGFEE
Sbjct  152  HHLSNTPNPYEQAITIVGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGFEE  211

Query  601  VLSXYREI  624
            VL+ YREI
Sbjct  212  VLARYREI  219



>ref|XP_007137991.1| hypothetical protein PHAVU_009G171800g [Phaseolus vulgaris]
 gb|ESW09985.1| hypothetical protein PHAVU_009G171800g [Phaseolus vulgaris]
Length=428

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  APPQ-RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  414
            AP Q +R D +YSRI DNY SL++VTEALA AGLESSNLIVGIDFTKSNEWTG +SF  R
Sbjct  52   APEQGKRSDGKYSRIGDNYKSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGARSFQRR  111

Query  415  SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  594
             LH+IGH  NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFC GF
Sbjct  112  CLHHIGHEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCQGF  171

Query  595  EEVLSXYREI  624
            EEVL  YRE+
Sbjct  172  EEVLGRYREL  181



>ref|XP_010492244.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492245.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492246.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492247.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
Length=470

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YSRI+DNY+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  94   KKRLERKYSRISDNYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  153

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  154  IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  213

Query  607  SXYREI  624
            + Y+EI
Sbjct  214  ARYKEI  219



>ref|XP_009131403.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Brassica 
rapa]
Length=472

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 136/176 (77%), Gaps = 5/176 (3%)
 Frame = +1

Query  112  YPPQPQESYNYP-----VQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSR  276
            YP    ESYNYP       H  P YA PPP       P     S +H   ++RL+R++S+
Sbjct  40   YPQYGPESYNYPPTPSYAPHPPPEYAQPPPAPSYSTQPYSQPPSYSHGNDKKRLERKFSK  99

Query  277  IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  456
            I+D Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH IG+  NPYEQ
Sbjct  100  ISDEYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHYIGNNPNPYEQ  159

Query  457  AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            AI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFCNGFEEVL  Y+EI
Sbjct  160  AITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFCNGFEEVLGRYKEI  215



>ref|XP_010453560.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
 ref|XP_010453561.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
 ref|XP_010453562.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
Length=464

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YSRI+DNY+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  85   KKRLERKYSRISDNYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  144

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  145  IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  204

Query  607  SXYREI  624
            + Y+EI
Sbjct  205  ARYKEI  210



>ref|XP_002884269.1| hypothetical protein ARALYDRAFT_896079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60528.1| hypothetical protein ARALYDRAFT_896079 [Arabidopsis lyrata subsp. 
lyrata]
Length=430

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S++H   +++ DRRYS+I+DNY+SL +V+EAL RAGLESSNLIVGIDFTKSNEWTG KSF
Sbjct  56   SQSHDADRKKFDRRYSKISDNYSSLLQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSF  115

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH++ +  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDA+THDQDVFSFYP+ RFC
Sbjct  116  NRKSLHHLSNTPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDATTHDQDVFSFYPEGRFC  175

Query  586  NGFEEVLSXYREI  624
            NGFEEVL+ YREI
Sbjct  176  NGFEEVLARYREI  188



>ref|XP_006857662.1| hypothetical protein AMTR_s00061p00153710 [Amborella trichopoda]
 gb|ERN19129.1| hypothetical protein AMTR_s00061p00153710 [Amborella trichopoda]
Length=384

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            R+  RYS IADNY SL +VTEALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH+IG
Sbjct  45   RVQGRYSHIADNYQSLGQVTEALAHAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHIG  104

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
            +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDA+THDQDVFSFYPDER CNGFEE L  
Sbjct  105  NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDATTHDQDVFSFYPDERMCNGFEEALGR  164

Query  613  YREI  624
            YREI
Sbjct  165  YREI  168



>ref|XP_010531508.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RGLG2 
[Tarenaya hassleriana]
Length=449

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            SR  +  +++ +R+YSRIADNY SL+EVT AL +AGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  63   SRTQSQSRKQFERKYSRIADNYRSLDEVTVALLQAGLESSNLIVGIDFTKSNEWTGARSF  122

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH+IG   NPYEQAISIIGKTL+AFD+DNLIPC+GFGDA+THDQDVFSFYP+++FC
Sbjct  123  NRKSLHHIGSTPNPYEQAISIIGKTLSAFDEDNLIPCYGFGDATTHDQDVFSFYPEDKFC  182

Query  586  NGFEEVLSXYREI  624
            NGFEEVL  YREI
Sbjct  183  NGFEEVLVRYREI  195



>ref|XP_011071995.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
Length=431

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 135/178 (76%), Gaps = 27/178 (15%)
 Frame = +1

Query  97   YPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQ--RRLDRRY  270
            YPQ++Y    Q +++YP Q                      + +    PP+  R+L+R+Y
Sbjct  29   YPQSSYS---QPTHSYPPQ----------------------YPTYGGPPPESKRKLERKY  63

Query  271  SRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPY  450
            SRI DNY++L++VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH+IG   NPY
Sbjct  64   SRIDDNYHTLDQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHHIGDEQNPY  123

Query  451  EQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            EQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSF+PDERFC+GFEEVL+ YRE+
Sbjct  124  EQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFSFFPDERFCDGFEEVLTRYREL  181



>ref|XP_010033344.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
Length=435

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +1

Query  277  IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  456
            IAD+YNSL+EVTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+IG GLNPYEQ
Sbjct  70   IADDYNSLDEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHHIGDGLNPYEQ  129

Query  457  AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            AISIIGKTLA FD+DNLIPC+GFGDASTHDQDVFSFYP +RFCNGFEEVLS YREI
Sbjct  130  AISIIGKTLAVFDEDNLIPCYGFGDASTHDQDVFSFYPADRFCNGFEEVLSRYREI  185



>emb|CDX78576.1| BnaA03g04880D [Brassica napus]
Length=471

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S +H   ++RL+R++S+I+D Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  83   SYSHGNDKKRLERKFSKISDEYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSF  142

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  143  NRKSLHYIGNNPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  202

Query  586  NGFEEVLSXYREI  624
            NGFEEVL  Y+EI
Sbjct  203  NGFEEVLGRYKEI  215



>emb|CDY37509.1| BnaA05g33740D [Brassica napus]
Length=460

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = +1

Query  226  SRNHAPP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            S+ HA P  +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLI+GIDFTKSNEWTG K
Sbjct  80   SQTHAAPSDRKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLILGIDFTKSNEWTGAK  139

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SF+ +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R
Sbjct  140  SFSKKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGR  199

Query  580  FCNGFEEVLSXYREI  624
             CNGFE+VL+ YR+I
Sbjct  200  SCNGFEQVLARYRDI  214



>ref|XP_010033343.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW52956.1| hypothetical protein EUGRSUZ_J02261 [Eucalyptus grandis]
 gb|KCW52957.1| hypothetical protein EUGRSUZ_J02261 [Eucalyptus grandis]
Length=446

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +1

Query  277  IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  456
            IAD+YNSL+EVTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+IG GLNPYEQ
Sbjct  70   IADDYNSLDEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHHIGDGLNPYEQ  129

Query  457  AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            AISIIGKTLA FD+DNLIPC+GFGDASTHDQDVFSFYP +RFCNGFEEVLS YREI
Sbjct  130  AISIIGKTLAVFDEDNLIPCYGFGDASTHDQDVFSFYPADRFCNGFEEVLSRYREI  185



>ref|XP_010485387.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
Length=462

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 120/135 (89%), Gaps = 4/135 (3%)
 Frame = +1

Query  232  NHAPPQ----RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            N+ PPQ    ++ DRRYS+I+DNY+SL++V+EAL RAGLESSNLIVGIDFTKSNEWTG  
Sbjct  91   NNPPPQSPDRKKFDRRYSKISDNYSSLDQVSEALGRAGLESSNLIVGIDFTKSNEWTGAN  150

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SFN ++LH++ +  NPYEQAI+I+G+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ R
Sbjct  151  SFNKKNLHHLSNTPNPYEQAITIVGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGR  210

Query  580  FCNGFEEVLSXYREI  624
            FCNGFEEVL+ YREI
Sbjct  211  FCNGFEEVLARYREI  225



>ref|XP_010904547.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Elaeis guineensis]
Length=468

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 116/145 (80%), Gaps = 12/145 (8%)
 Frame = +1

Query  226  SRNHAPPQ------------RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDF  369
            SR+  PPQ             +LD+RYS+I D+YNSLEEVTEALA+AGLESSNLIVGIDF
Sbjct  78   SRHPMPPQFQNPSSPAAGLHPKLDKRYSKITDHYNSLEEVTEALAKAGLESSNLIVGIDF  137

Query  370  TKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQ  549
            TKSNEWTGK SFN  SLH I    NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQ
Sbjct  138  TKSNEWTGKHSFNHHSLHYISDIQNPYEQAISIIGKTLSTFDEDNLIPCFGFGDASTHDQ  197

Query  550  DVFSFYPDERFCNGFEEVLSXYREI  624
            DVFSFYPDER CNGF E L+ YREI
Sbjct  198  DVFSFYPDERPCNGFAEALARYREI  222



>ref|XP_009147449.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X2 
[Brassica rapa]
Length=456

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = +1

Query  226  SRNHAPP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            S+ HA P  +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLI+GIDFTKSNEWTG K
Sbjct  80   SQTHAAPSDRKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLILGIDFTKSNEWTGAK  139

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SF+ +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R
Sbjct  140  SFSKKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGR  199

Query  580  FCNGFEEVLSXYREI  624
             CNGFE+VL+ YR+I
Sbjct  200  SCNGFEQVLARYRDI  214



>ref|XP_006287685.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 ref|XP_006287686.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 gb|EOA20583.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 gb|EOA20584.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
Length=357

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YSRI+D+Y+SLE+VTEALARAGLESSNLIVG+DFTKSNEWTG +SFN +SLH 
Sbjct  87   KKRLERKYSRISDDYSSLEQVTEALARAGLESSNLIVGMDFTKSNEWTGARSFNRKSLHF  146

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  147  IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  206

Query  607  SXYREI  624
            + Y+EI
Sbjct  207  ARYKEI  212



>ref|XP_006664503.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Oryza brachyantha]
Length=449

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RL+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK SFNG SLH+IG
Sbjct  68   RLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKNSFNGMSLHHIG  127

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
            +  NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L+ 
Sbjct  128  NSPNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  187

Query  613  YREI  624
            YREI
Sbjct  188  YREI  191



>ref|XP_002511290.1| copine, putative [Ricinus communis]
 gb|EEF51892.1| copine, putative [Ricinus communis]
Length=433

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            RRL+R+YS+I DNYNSLE+VT+ALAR+GLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  56   RRLERKYSKIDDNYNSLEQVTDALARSGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  115

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
            G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF  DE FCNGFEEVL 
Sbjct  116  GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFNSDESFCNGFEEVLR  175

Query  610  XYREI  624
             YRE+
Sbjct  176  RYREL  180



>emb|CDY09854.1| BnaC09g43070D [Brassica napus]
Length=466

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S++H   ++RL+R+YS+I+D Y+SLE+VTEALA AGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  81   SQSHGNNKKRLERKYSKISDEYSSLEQVTEALAGAGLESSNLIVGIDFTKSNEWTGARSF  140

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  141  NRKSLHFIGNSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  200

Query  586  NGFEEVLSXYREI  624
            NGFEEVL  Y+EI
Sbjct  201  NGFEEVLGRYKEI  213



>emb|CDY49066.1| BnaC05g48940D [Brassica napus]
Length=460

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = +1

Query  226  SRNHAPP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            S+ HA P  +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLI+GIDFTKSNEWTG K
Sbjct  80   SQTHAAPSDRKKFDRRYSKISDNYVSLDQVSEALGRAGLESSNLILGIDFTKSNEWTGAK  139

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SF+ +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R
Sbjct  140  SFSKKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGR  199

Query  580  FCNGFEEVLSXYREI  624
             CNGFE+VL+ YR+I
Sbjct  200  SCNGFEQVLARYRDI  214



>ref|XP_004309992.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Fragaria vesca 
subsp. vesca]
Length=433

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P+RRLDRR+S+IAD+Y SL+EVT ALA+AGLESSNLIVGIDFTKSN+WTG +SF  +SLH
Sbjct  55   PKRRLDRRFSQIADDYRSLDEVTNALAQAGLESSNLIVGIDFTKSNDWTGSRSFGRKSLH  114

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            ++G   NPYEQAISIIGKTL+AFD+DNLIPC+GFGDASTHDQDVFSFYPD+  C GFEEV
Sbjct  115  HMGTSQNPYEQAISIIGKTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDDCVCTGFEEV  174

Query  604  LSXYREI  624
            L+ YREI
Sbjct  175  LTRYREI  181



>emb|CDX69581.1| BnaA10g19300D [Brassica napus]
Length=466

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YS+I+D Y+SLE+VTEALA AGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  88   KKRLERKYSKISDEYSSLEQVTEALAGAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  147

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF PD+RFCNGFEEVL
Sbjct  148  IGNSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPDDRFCNGFEEVL  207

Query  607  SXYREI  624
              Y+EI
Sbjct  208  GRYKEI  213



>ref|XP_009121662.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
 ref|XP_009121663.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
 ref|XP_009121664.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
Length=466

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YS+I+D Y+SLE+VTEALA AGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  88   KKRLERKYSKISDEYSSLEQVTEALAGAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  147

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF PD+RFCNGFEEVL
Sbjct  148  IGNSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPDDRFCNGFEEVL  207

Query  607  SXYREI  624
              Y+EI
Sbjct  208  GRYKEI  213



>ref|NP_186814.1| E3 ubiquitin-protein ligase RGLG1 [Arabidopsis thaliana]
 sp|Q9SS90.1|RGLG1_ARATH RecName: Full=E3 ubiquitin-protein ligase RGLG1; AltName: Full=RING 
domain ligase 1 [Arabidopsis thaliana]
 gb|AAF01562.1|AC009325_32 unknown protein [Arabidopsis thaliana]
 gb|AEE73699.1| E3 ubiquitin-protein ligase RGLG1 [Arabidopsis thaliana]
Length=489

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  405
            S++    +++ DRRYS+I+DNY+SL +V+EAL RAGLESSNLIVGIDFTKSNEWTG KSF
Sbjct  116  SQSQVADRKKFDRRYSKISDNYSSLLQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSF  175

Query  406  NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  585
            N +SLH++ +  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFC
Sbjct  176  NRKSLHHLSNTPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFC  235

Query  586  NGFEEVLSXYREI  624
            NGFEEVL+ YREI
Sbjct  236  NGFEEVLARYREI  248



>ref|XP_008807474.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008807475.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008807476.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=468

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RLDRRYS+I D+YNS+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+ RSLH+IG
Sbjct  86   RLDRRYSKITDDYNSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHRRSLHHIG  145

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSF+PDER CNGF E L+ 
Sbjct  146  DIPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFHPDERPCNGFSEALAR  205

Query  613  YREI  624
            YRE+
Sbjct  206  YREL  209



>ref|XP_009147448.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X1 
[Brassica rapa]
Length=489

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = +1

Query  226  SRNHAPP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  399
            S+ HA P  +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLI+GIDFTKSNEWTG K
Sbjct  113  SQTHAAPSDRKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLILGIDFTKSNEWTGAK  172

Query  400  SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  579
            SF+ +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R
Sbjct  173  SFSKKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGR  232

Query  580  FCNGFEEVLSXYREI  624
             CNGFE+VL+ YR+I
Sbjct  233  SCNGFEQVLARYRDI  247



>emb|CDX91935.1| BnaC03g32370D [Brassica napus]
Length=457

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLIVGIDFTKSNEWTG KSFN +SLH+
Sbjct  88   RKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSFNKKSLHH  147

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            I +  NPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R CNGFE+VL
Sbjct  148  ISNTPNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGRSCNGFEQVL  207

Query  607  SXYREI  624
            + YREI
Sbjct  208  ARYREI  213



>gb|ACR36132.1| unknown [Zea mays]
 tpg|DAA54942.1| TPA: copine family protein [Zea mays]
Length=541

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RL+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK  FNG SLHNI 
Sbjct  160  RLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKNCFNGMSLHNIS  219

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVF+FYPDER CNGF+E L+ 
Sbjct  220  DNPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFAFYPDERPCNGFQEALAR  279

Query  613  YREI  624
            YREI
Sbjct  280  YREI  283



>ref|XP_006287684.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 gb|EOA20582.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
Length=466

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YSRI+D+Y+SLE+VTEALARAGLESSNLIVG+DFTKSNEWTG +SFN +SLH 
Sbjct  87   KKRLERKYSRISDDYSSLEQVTEALARAGLESSNLIVGMDFTKSNEWTGARSFNRKSLHF  146

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  147  IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  206

Query  607  SXYREI  624
            + Y+EI
Sbjct  207  ARYKEI  212



>ref|XP_004970988.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Setaria italica]
Length=464

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+LDRRYSRIAD+YNS+++VT+ALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+I
Sbjct  83   RQLDRRYSRIADDYNSVDQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHI  142

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
                NPYEQAISIIG+T++ FD+DNLIPCFGFGDASTHDQDVF FYPDER CNGF E L 
Sbjct  143  SSTPNPYEQAISIIGQTMSKFDEDNLIPCFGFGDASTHDQDVFCFYPDERPCNGFSEALH  202

Query  610  XYREI  624
             YREI
Sbjct  203  RYREI  207



>ref|NP_196946.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_850818.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_974779.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_974780.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 sp|Q9LY87.1|RGLG2_ARATH RecName: Full=E3 ubiquitin-protein ligase RGLG2; AltName: Full=RING 
domain ligase 2 [Arabidopsis thaliana]
 emb|CAB87781.1| putative protein [Arabidopsis thaliana]
 gb|AAM20448.1| putative protein [Arabidopsis thaliana]
 gb|AAN15568.1| putative protein [Arabidopsis thaliana]
 gb|AAZ14078.1| At5g14420 [Arabidopsis thaliana]
 gb|AED92028.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92029.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92030.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92031.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
Length=468

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YS+I+D+Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  89   KKRLERKYSKISDDYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  148

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  149  IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  208

Query  607  SXYREI  624
            S Y+EI
Sbjct  209  SRYKEI  214



>emb|CAN81848.1| hypothetical protein VITISV_036819 [Vitis vinifera]
Length=440

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 147/212 (69%), Gaps = 28/212 (13%)
 Frame = +1

Query  22   MGGKSSRDDswrqasrstssswNYE-YPQT-----AYPPQPQESYNYPVQHaypsyappp  183
            MGGKSS+  S R+     SSS+N+  Y Q+     AYP QP   Y+ P  H+ P      
Sbjct  1    MGGKSSKRRSGREYPSFESSSFNHHGYSQSQPYEEAYPAQP---YHTPQHHSPPPPRYYS  57

Query  184  pqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGI  363
                         A   H  PQ  LDRRYSRIADNYNSL++VT ALA+AGLESSNLIVGI
Sbjct  58   G------------AQTPHRHPQ--LDRRYSRIADNYNSLDQVTAALAQAGLESSNLIVGI  103

Query  364  DFTKSNEWTGK-----KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFG  528
            DFTKSNEWTG       SFN +SLH+IG G NPYEQAISIIGKTL+AFD+DNLIPCFGFG
Sbjct  104  DFTKSNEWTGLIPSAFLSFNRKSLHHIGRGQNPYEQAISIIGKTLSAFDEDNLIPCFGFG  163

Query  529  DASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            DASTHDQD+FSFY DER CNGFEEVL  YRE+
Sbjct  164  DASTHDQDIFSFYQDERPCNGFEEVLMRYREL  195



>ref|XP_010496283.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
 ref|XP_010496284.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
 ref|XP_010496285.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
Length=449

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++ DRRYS+I+DNY+SL +V+EAL RAGLESSNLIVGIDFTKSNEWTG KSFN ++LH+
Sbjct  87   RKKFDRRYSKISDNYSSLAQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSFNKKNLHH  146

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            + +  NPYEQAI+I+G+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFCNGFEEVL
Sbjct  147  LSNTPNPYEQAITIVGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGFEEVL  206

Query  607  SXYREI  624
            + YREI
Sbjct  207  ARYREI  212



>ref|XP_007209145.1| hypothetical protein PRUPE_ppa005852mg [Prunus persica]
 gb|EMJ10344.1| hypothetical protein PRUPE_ppa005852mg [Prunus persica]
Length=440

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 13/149 (9%)
 Frame = +1

Query  217  DFASRNH-APP-----------QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  360
            D+  + H APP           ++RL+R+YS+I D+YNSLE+VT+ALARAGLESSNLIVG
Sbjct  43   DYGQQQHFAPPPQSHGSAWPGSKKRLERKYSKIDDDYNSLEQVTDALARAGLESSNLIVG  102

Query  361  IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  540
            IDFTKSNEWTG +SF+ +SLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDAST
Sbjct  103  IDFTKSNEWTGARSFHRKSLHHIGEEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDAST  162

Query  541  HDQDVFSFYPDE-RFCNGFEEVLSXYREI  624
            HDQ+VFSFYPDE  FCNGFEEVL  YRE+
Sbjct  163  HDQEVFSFYPDEGSFCNGFEEVLRRYREL  191



>ref|XP_008230495.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Prunus mume]
Length=460

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGH  435
            L+R+YS I+D+Y SLEEVTEALARAGLESSNLIVGIDFTKSNEWTG KSFN +SLH+IG+
Sbjct  71   LERKYSIISDSYKSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGSKSFNRKSLHDIGN  130

Query  436  GLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXY  615
            G NPYE AISIIGKTLA FD+DNLIPCFGFGDASTHDQDVFSFY D R+CNGFEEVL+ Y
Sbjct  131  GQNPYEHAISIIGKTLAVFDEDNLIPCFGFGDASTHDQDVFSFYYD-RYCNGFEEVLTRY  189

Query  616  REI  624
            REI
Sbjct  190  REI  192



>ref|XP_009795957.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 ref|XP_009795958.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
Length=432

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  241  PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  414
            PP+  +RL+R+YS+I D+Y+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  53   PPESRKRLERKYSKIDDDYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRK  112

Query  415  SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  594
            SLH+IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VF+FYPD+++CNGF
Sbjct  113  SLHHIGDQQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFAFYPDDKYCNGF  172

Query  595  EEVLSXYREI  624
            EEVLS YRE+
Sbjct  173  EEVLSRYREL  182



>ref|XP_002873665.1| hypothetical protein ARALYDRAFT_488284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49924.1| hypothetical protein ARALYDRAFT_488284 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YS+I+D+Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  86   KKRLERKYSKISDDYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  145

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  146  IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  205

Query  607  SXYREI  624
            + Y+EI
Sbjct  206  ARYKEI  211



>ref|NP_001150002.1| copine family protein [Zea mays]
 gb|ACG37466.1| copine family protein [Zea mays]
Length=541

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RL+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK  FNG SLHNI 
Sbjct  160  RLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKNCFNGISLHNIS  219

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVF+FYPDER CNGF+E L+ 
Sbjct  220  DNPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFAFYPDERPCNGFQEALAR  279

Query  613  YREI  624
            YREI
Sbjct  280  YREI  283



>ref|XP_009125973.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009125974.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009125975.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 emb|CDX85597.1| BnaA02g02160D [Brassica napus]
Length=451

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YS+I+D+Y+SL++VT+ALA AGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  72   KKRLERKYSKISDDYSSLDQVTKALAHAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  131

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P+ERFCNGFEEVL
Sbjct  132  IGNTPNPYEQAIAIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEERFCNGFEEVL  191

Query  607  SXYREI  624
              Y+EI
Sbjct  192  GRYKEI  197



>ref|XP_008786705.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=475

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 3/132 (2%)
 Frame = +1

Query  232  NHAPPQR-RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  408
            +HA   R +LDRRYS+IADNY+SLE+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN
Sbjct  95   SHATSSRPKLDRRYSKIADNYSSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKHSFN  154

Query  409  GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  588
             RSLH+IG   NPYEQAISIIG+T++AFD+DNLIPCFGFGDASTHDQDVFSFY  ER CN
Sbjct  155  RRSLHSIGDTKNPYEQAISIIGQTMSAFDEDNLIPCFGFGDASTHDQDVFSFY--ERPCN  212

Query  589  GFEEVLSXYREI  624
            GF E L+ YREI
Sbjct  213  GFAEALTRYREI  224



>ref|XP_003526988.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Glycine max]
Length=428

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +1

Query  226  SRNHAPPQ-RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS  402
            S   AP Q + LDR+Y RI D+Y SL++VT+ALA+AGLESSNLIVG DFTKSNEWTG +S
Sbjct  48   SGGRAPEQVKSLDRKYLRIGDDYKSLKQVTDALAKAGLESSNLIVGFDFTKSNEWTGARS  107

Query  403  FNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERF  582
            F  R LH+IGH  NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VF FYPDERF
Sbjct  108  FQRRCLHHIGHEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFCFYPDERF  167

Query  583  CNGFEEVLSXYREI  624
            C+GFEEVL  YRE+
Sbjct  168  CHGFEEVLERYREL  181



>gb|KJB31093.1| hypothetical protein B456_005G175700 [Gossypium raimondii]
Length=439

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 131/175 (75%), Gaps = 14/175 (8%)
 Frame = +1

Query  100  PQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRI  279
            PQ+AYP   Q++Y Y  QH   + +P             ++  +      R ++R+YSRI
Sbjct  34   PQSAYP---QQNYYYTPQHPSYAPSPSY-----------NYVQQTPGCVHRTMERKYSRI  79

Query  280  ADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQA  459
             DNY +L++VT ALA+AGLESSNLIVGIDFTKSNEWTG  SFN RSLH+IGHG NPYEQA
Sbjct  80   DDNYQTLDQVTAALAQAGLESSNLIVGIDFTKSNEWTGAMSFNHRSLHHIGHGQNPYEQA  139

Query  460  ISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSXYREI  624
            I+II ++L+A D+DNLIPC+GFGDASTHDQDVFSFYP+E FC GFEEVL+ YREI
Sbjct  140  ITIIERSLSALDEDNLIPCYGFGDASTHDQDVFSFYPEEIFCEGFEEVLARYREI  194



>ref|XP_009403629.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            Q + + +YSRIAD+Y+SLE+VTEAL+RAGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+
Sbjct  86   QPKAEAKYSRIADDYSSLEQVTEALSRAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHS  145

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIG+TL+AFD+DN+IPCFGFGDA+THD DVFSFYP ER CNGFEE L
Sbjct  146  IGAATNPYEQAISIIGRTLSAFDEDNMIPCFGFGDATTHDGDVFSFYPGERPCNGFEEAL  205

Query  607  SXYREI  624
              YREI
Sbjct  206  ERYREI  211



>emb|CDX74310.1| BnaA03g27370D [Brassica napus]
Length=458

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++ DRRYS+I+DNY SL++V+EALARAGLESSNLI+GIDFTKSNEWTG KSFN +SLH+
Sbjct  89   RKKFDRRYSKISDNYASLDQVSEALARAGLESSNLILGIDFTKSNEWTGAKSFNKKSLHH  148

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            I +  NPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R CNGFE+VL
Sbjct  149  ISNTPNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGRSCNGFEQVL  208

Query  607  SXYREI  624
            + YR+I
Sbjct  209  ARYRDI  214



>emb|CDX91062.1| BnaC02g05350D [Brassica napus]
Length=452

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YS+I+D+Y+SL++VTEALA AGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  73   KKRLERKYSKISDDYSSLDQVTEALAHAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  132

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFCNGFEEVL
Sbjct  133  IGNTSNPYEQAIAIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFCNGFEEVL  192

Query  607  SXYREI  624
              Y+EI
Sbjct  193  GRYKEI  198



>ref|XP_009134597.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Brassica rapa]
 ref|XP_009134598.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Brassica rapa]
Length=458

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            +++ DRRYS+I+DNY SL++V+EALARAGLESSNLI+GIDFTKSNEWTG KSFN +SLH+
Sbjct  89   RKKFDRRYSKISDNYASLDQVSEALARAGLESSNLILGIDFTKSNEWTGAKSFNKKSLHH  148

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            I +  NPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R CNGFE+VL
Sbjct  149  ISNTPNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGRSCNGFEQVL  208

Query  607  SXYREI  624
            + YR+I
Sbjct  209  ARYRDI  214



>gb|AFW76346.1| hypothetical protein ZEAMMB73_695996, partial [Zea mays]
Length=339

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +1

Query  223  ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  396
            +S N   P+   RL R+YS+I D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK
Sbjct  45   SSENSVQPETHARLQRKYSKIGDDYRSLSQVTEALAQAGLESSNLIVGIDFTKSNEWTGK  104

Query  397  KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  576
             SFN R LH+IG+  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  105  ISFNRRCLHDIGNTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPEN  164

Query  577  RFCNGFEEVLSXYREI  624
            R CNGFEE L  YREI
Sbjct  165  RPCNGFEEALDRYREI  180



>ref|XP_006646587.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Oryza brachyantha]
Length=397

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RLDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH I 
Sbjct  20   RLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHYIS  79

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
            +  NPYEQAISIIG+TL+ FD+DN+IPCFGFGDASTHDQDVF FYPDER CNGF E L  
Sbjct  80   NVPNPYEQAISIIGQTLSKFDEDNMIPCFGFGDASTHDQDVFCFYPDERPCNGFSEALDQ  139

Query  613  YREI  624
            YRE+
Sbjct  140  YREL  143



>ref|XP_010044533.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 ref|XP_010044535.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 ref|XP_010044536.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 gb|KCW86618.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
 gb|KCW86619.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
 gb|KCW86620.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
Length=439

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 114/128 (89%), Gaps = 2/128 (2%)
 Frame = +1

Query  247  QRR--LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSL  420
            QRR  ++ +YSRIADNY+SL EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SF+ +SL
Sbjct  67   QRRKIVNTKYSRIADNYHSLHEVTSALAQAGLESSNLIVGIDFTKSNEWTGARSFHRQSL  126

Query  421  HNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEE  600
            H+I HG NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY D RFCNGFEE
Sbjct  127  HDIDHGQNPYEQAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYQDNRFCNGFEE  186

Query  601  VLSXYREI  624
            VL  Y+E+
Sbjct  187  VLMRYKEV  194



>ref|XP_010435648.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
 ref|XP_010435649.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
 ref|XP_010435650.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
Length=450

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 119/137 (87%), Gaps = 6/137 (4%)
 Frame = +1

Query  232  NHAPPQ------RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG  393
            ++ PPQ      ++ DRRYS+I+DNY+SL +V+EAL RAGLESSNLIVGIDFTKSNEWTG
Sbjct  77   SNPPPQSADSDRKKFDRRYSKISDNYSSLAQVSEALGRAGLESSNLIVGIDFTKSNEWTG  136

Query  394  KKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD  573
              SFN ++LH++ +  NPYEQAI+I+G+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+
Sbjct  137  ANSFNKKNLHHLSNTPNPYEQAITIVGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPE  196

Query  574  ERFCNGFEEVLSXYREI  624
             RFCNGFEEVL+ YREI
Sbjct  197  GRFCNGFEEVLARYREI  213



>ref|XP_004962600.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Setaria italica]
Length=540

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RL+R+YS+I D Y+S +EV EALA+AGLESSNLI+GIDFTKSNEWTGK SFNG SLH+IG
Sbjct  159  RLERKYSKIVDQYHSFDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKNSFNGMSLHHIG  218

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L+ 
Sbjct  219  ETPNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  278

Query  613  YREI  624
            YREI
Sbjct  279  YREI  282



>ref|XP_008239359.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Prunus mume]
Length=440

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 13/149 (9%)
 Frame = +1

Query  217  DFASRNH-APP-----------QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  360
            D+  + H APP           ++RL+R+YS+I D+YNSLE+VT+ALARAGLESSNLIVG
Sbjct  43   DYGQQQHFAPPPQSHGSAWPGSKKRLERKYSKIDDDYNSLEQVTDALARAGLESSNLIVG  102

Query  361  IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  540
            IDFTKSNEWTG +SF+ +SLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDAST
Sbjct  103  IDFTKSNEWTGARSFHRKSLHHIGEEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDAST  162

Query  541  HDQDVFSFYPDE-RFCNGFEEVLSXYREI  624
            HDQ+VFSFYP+E  FCNGFEEVL  YRE+
Sbjct  163  HDQEVFSFYPEEGSFCNGFEEVLRRYREL  191



>ref|XP_010044532.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
Length=463

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 114/128 (89%), Gaps = 2/128 (2%)
 Frame = +1

Query  247  QRR--LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSL  420
            QRR  ++ +YSRIADNY+SL EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SF+ +SL
Sbjct  91   QRRKIVNTKYSRIADNYHSLHEVTSALAQAGLESSNLIVGIDFTKSNEWTGARSFHRQSL  150

Query  421  HNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEE  600
            H+I HG NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY D RFCNGFEE
Sbjct  151  HDIDHGQNPYEQAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYQDNRFCNGFEE  210

Query  601  VLSXYREI  624
            VL  Y+E+
Sbjct  211  VLMRYKEV  218



>ref|XP_010044531.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
Length=465

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 114/128 (89%), Gaps = 2/128 (2%)
 Frame = +1

Query  247  QRR--LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSL  420
            QRR  ++ +YSRIADNY+SL EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SF+ +SL
Sbjct  93   QRRKIVNTKYSRIADNYHSLHEVTSALAQAGLESSNLIVGIDFTKSNEWTGARSFHRQSL  152

Query  421  HNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEE  600
            H+I HG NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY D RFCNGFEE
Sbjct  153  HDIDHGQNPYEQAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYQDNRFCNGFEE  212

Query  601  VLSXYREI  624
            VL  Y+E+
Sbjct  213  VLMRYKEV  220



>dbj|BAD35623.1| unknown protein [Oryza sativa Japonica Group]
Length=415

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RL R+YSRI D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN R LH+IG
Sbjct  59   RLQRKYSRIGDDYRSLNQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFNRRCLHDIG  118

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
            +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ R CNGFEE L  
Sbjct  119  NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPENRPCNGFEEALER  178

Query  613  YREI  624
            YREI
Sbjct  179  YREI  182



>ref|NP_001146212.1| uncharacterized protein LOC100279782 [Zea mays]
 gb|ACL53475.1| unknown [Zea mays]
 gb|ACL54587.1| unknown [Zea mays]
Length=460

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+LDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVG+DFTKSNEWTGK SF+GRSLH+I
Sbjct  80   RQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGVDFTKSNEWTGKFSFHGRSLHHI  139

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
             +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDER CNGFEE L 
Sbjct  140  SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDERPCNGFEEALD  199

Query  610  XYREI  624
             YRE+
Sbjct  200  RYREL  204



>tpg|DAA56240.1| TPA: hypothetical protein ZEAMMB73_877987 [Zea mays]
Length=460

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+LDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVG+DFTKSNEWTGK SF+GRSLH+I
Sbjct  80   RQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGVDFTKSNEWTGKFSFHGRSLHHI  139

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
             +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDER CNGFEE L 
Sbjct  140  SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDERPCNGFEEALD  199

Query  610  XYREI  624
             YRE+
Sbjct  200  RYREL  204



>tpg|DAA56239.1| TPA: hypothetical protein ZEAMMB73_877987 [Zea mays]
Length=461

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+LDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVG+DFTKSNEWTGK SF+GRSLH+I
Sbjct  80   RQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGVDFTKSNEWTGKFSFHGRSLHHI  139

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
             +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDER CNGFEE L 
Sbjct  140  SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDERPCNGFEEALD  199

Query  610  XYREI  624
             YRE+
Sbjct  200  RYREL  204



>ref|XP_009608151.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
tomentosiformis]
 ref|XP_009608152.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
tomentosiformis]
Length=432

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  241  PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  414
            PP+  +RL+R+YS+I D+Y+S+E+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  53   PPESRKRLERKYSKIDDDYHSIEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRK  112

Query  415  SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  594
            SLH+IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VF FYPD+++CNGF
Sbjct  113  SLHHIGDQQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFGFYPDDKYCNGF  172

Query  595  EEVLSXYREI  624
            EEVLS YRE+
Sbjct  173  EEVLSRYREL  182



>ref|XP_002458953.1| hypothetical protein SORBIDRAFT_03g043290 [Sorghum bicolor]
 gb|EES04073.1| hypothetical protein SORBIDRAFT_03g043290 [Sorghum bicolor]
Length=459

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+LDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+I
Sbjct  79   RQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHI  138

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
             +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDER CNGFEE L 
Sbjct  139  SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDERPCNGFEEALD  198

Query  610  XYREI  624
             YRE+
Sbjct  199  RYREL  203



>ref|NP_001066593.1| Os12g0288400 [Oryza sativa Japonica Group]
 gb|ABA97133.2| copine, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29612.1| Os12g0288400 [Oryza sativa Japonica Group]
 dbj|BAG92271.1| unnamed protein product [Oryza sativa Japonica Group]
Length=546

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK+SFNG SLH+IG
Sbjct  165  KLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKRSFNGMSLHHIG  224

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAI+IIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L+ 
Sbjct  225  DSPNPYEQAITIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  284

Query  613  YREI  624
            YREI
Sbjct  285  YREI  288



>dbj|BAH19894.1| AT5G14420 [Arabidopsis thaliana]
Length=468

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YS+I+D+Y+S E+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  89   KKRLERKYSKISDDYSSWEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  148

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  149  IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  208

Query  607  SXYREI  624
            S Y+EI
Sbjct  209  SRYKEI  214



>ref|XP_010682339.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682340.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P++ L+R+YSRIADNY +L+EVT ALA AGLESSNLIVGIDFTKSNEWTG KSFN RSLH
Sbjct  77   PKKTLERKYSRIADNYRTLDEVTAALAHAGLESSNLIVGIDFTKSNEWTGAKSFNRRSLH  136

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG+  NPYE+AI+IIGKTL+ FD+DNLIPC+GFGDASTHDQDVFSFY D+R C GFEEV
Sbjct  137  HIGNDPNPYEEAIAIIGKTLSVFDEDNLIPCYGFGDASTHDQDVFSFYEDDRPCQGFEEV  196

Query  604  LSXYREI  624
            +S YRE+
Sbjct  197  MSRYREL  203



>gb|EEC69114.1| hypothetical protein OsI_38028 [Oryza sativa Indica Group]
Length=573

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK+SFNG SLH+IG
Sbjct  192  KLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKRSFNGMSLHHIG  251

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAI+IIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L+ 
Sbjct  252  DSPNPYEQAITIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  311

Query  613  YREI  624
            YREI
Sbjct  312  YREI  315



>ref|XP_002279018.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010663074.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010663075.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 emb|CBI14914.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 113/136 (83%), Gaps = 5/136 (4%)
 Frame = +1

Query  232  NHAPP-----QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  396
            NH PP          R+YS+I DNYNSL++VT ALA+AGLESSNLIVGIDFTKSNEWTG 
Sbjct  48   NHPPPTYGGQNPGSKRKYSKIEDNYNSLDQVTSALAQAGLESSNLIVGIDFTKSNEWTGA  107

Query  397  KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  576
            +SF  RSLH++G   NPYEQAISIIGKTL+ FDDDNLIPCFGFGDASTHD+DVFSFY DE
Sbjct  108  RSFYRRSLHHVGDDQNPYEQAISIIGKTLSKFDDDNLIPCFGFGDASTHDRDVFSFYSDE  167

Query  577  RFCNGFEEVLSXYREI  624
            RFCNGFEEVL  YRE+
Sbjct  168  RFCNGFEEVLKRYREL  183



>gb|EYU44842.1| hypothetical protein MIMGU_mgv1a024648mg, partial [Erythranthe 
guttata]
Length=376

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            PQ  LD  YSRIADNYNSL EVTEAL RAGLESSNLIVGIDFT SNEWTG  SF GRSLH
Sbjct  31   PQENLDTWYSRIADNYNSLHEVTEALKRAGLESSNLIVGIDFTASNEWTGMNSFGGRSLH  90

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            + G+G NPYEQAI I+GKTL+AFD+DNLIPCFGFGDASTHD+DVFSF PD +F NGF  V
Sbjct  91   HTGNGPNPYEQAIYIVGKTLSAFDEDNLIPCFGFGDASTHDEDVFSFSPDHKFSNGFVHV  150

Query  604  LSXYREI  624
            LS YR+I
Sbjct  151  LSQYRDI  157



>ref|NP_001058043.1| Os06g0608800 [Oryza sativa Japonica Group]
 dbj|BAD35622.1| putative copine I [Oryza sativa Japonica Group]
 dbj|BAF19957.1| Os06g0608800 [Oryza sativa Japonica Group]
 dbj|BAG90577.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94670.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RL R+YSRI D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN R LH+IG
Sbjct  59   RLQRKYSRIGDDYRSLNQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFNRRCLHDIG  118

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
            +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ R CNGFEE L  
Sbjct  119  NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPENRPCNGFEEALER  178

Query  613  YREI  624
            YREI
Sbjct  179  YREI  182



>gb|EEC80951.1| hypothetical protein OsI_23663 [Oryza sativa Indica Group]
 gb|ACN85164.1| copine-1 [Oryza nivara]
Length=447

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            RL R+YSRI D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN R LH+IG
Sbjct  59   RLQRKYSRIGDDYRSLNQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFNRRCLHDIG  118

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
            +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ R CNGFEE L  
Sbjct  119  NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPENRPCNGFEEALER  178

Query  613  YREI  624
            YREI
Sbjct  179  YREI  182



>ref|XP_004965913.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Setaria italica]
 ref|XP_004965914.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Setaria italica]
Length=445

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +1

Query  223  ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  396
            +S N+  P+   RL R+YSRI D+Y SL +VT+ALA+AGLESSNLIVGIDFTKSNEWTGK
Sbjct  42   SSENNVQPETHARLQRKYSRIGDDYRSLSQVTDALAQAGLESSNLIVGIDFTKSNEWTGK  101

Query  397  KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  576
             SFN R LH+IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  102  MSFNRRCLHDIGSTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPEN  161

Query  577  RFCNGFEEVLSXYREI  624
            R CNGFEE L  YREI
Sbjct  162  RPCNGFEEALERYREI  177



>ref|XP_010682336.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682337.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682338.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=491

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 137/187 (73%), Gaps = 17/187 (9%)
 Frame = +1

Query  88   NYEYPQTA-YPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPP------  246
            NY YP T+ YP QP  +   P +   P YAP P             +  N+APP      
Sbjct  50   NYGYPPTSPYPSQPSYAPQTPYRSHQPQYAPSPSPSP---------SPHNYAPPPPSATR  100

Query  247  -QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
             ++ L+R+YSRIADNY +L+EVT ALA AGLESSNLIVGIDFTKSNEWTG KSFN RSLH
Sbjct  101  PKKTLERKYSRIADNYRTLDEVTAALAHAGLESSNLIVGIDFTKSNEWTGAKSFNRRSLH  160

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG+  NPYE+AI+IIGKTL+ FD+DNLIPC+GFGDASTHDQDVFSFY D+R C GFEEV
Sbjct  161  HIGNDPNPYEEAIAIIGKTLSVFDEDNLIPCYGFGDASTHDQDVFSFYEDDRPCQGFEEV  220

Query  604  LSXYREI  624
            +S YRE+
Sbjct  221  MSRYREL  227



>gb|EYU22209.1| hypothetical protein MIMGU_mgv1a006782mg [Erythranthe guttata]
Length=432

 Score =   210 bits (534),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  423
            P R+ D++YSRI DNY++L++VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH
Sbjct  56   PNRKPDKKYSRIDDNYHTLDQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLH  115

Query  424  NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  603
            +IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSF+ D+RFC GFEEV
Sbjct  116  HIGDEQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFSFFSDDRFCEGFEEV  175

Query  604  LSXYREI  624
            +S YRE+
Sbjct  176  MSRYREL  182



>ref|XP_003578709.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brachypodium 
distachyon]
Length=543

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  432
            +L+R YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK+SF+G SLH+IG
Sbjct  162  KLERMYSKIVDQYRSLDEVKEALAQAGLESSNLIIGIDFTKSNEWTGKRSFDGMSLHHIG  221

Query  433  HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSX  612
               NPYEQAISIIG+TL++FD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L+ 
Sbjct  222  EAPNPYEQAISIIGETLSSFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  281

Query  613  YREI  624
            YREI
Sbjct  282  YREI  285



>ref|NP_001147447.1| copine-1 [Zea mays]
 ref|XP_008658552.1| PREDICTED: copine-1 isoform X1 [Zea mays]
 ref|XP_008658554.1| PREDICTED: copine-1 isoform X1 [Zea mays]
 gb|ACG27560.1| copine-1 [Zea mays]
 gb|AFW87255.1| copine-1 isoform 1 [Zea mays]
 gb|AFW87256.1| copine-1 isoform 2 [Zea mays]
Length=445

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +1

Query  223  ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  396
            +S N+  P+   RL R+YSRI D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK
Sbjct  44   SSENNVQPETHARLQRKYSRIGDDYRSLSQVTEALAQAGLESSNLIVGIDFTKSNEWTGK  103

Query  397  KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  576
             SFN R LH+IG+  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  104  ISFNRRCLHDIGNTPNPYEQAISIIGRTLSVFDEDNLIPCFGFGDASTHDQEVFSFYPEN  163

Query  577  RFCNGFEEVLSXYREI  624
            R CNGFEE L  YREI
Sbjct  164  RPCNGFEEALDRYREI  179



>ref|XP_008650441.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Zea mays]
Length=409

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +1

Query  223  ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  396
            +S N   P+   RL R+YS+I D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK
Sbjct  45   SSENSVQPETHARLQRKYSKIGDDYRSLSQVTEALAQAGLESSNLIVGIDFTKSNEWTGK  104

Query  397  KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  576
             SFN R LH+IG+  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  105  ISFNRRCLHDIGNTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPEN  164

Query  577  RFCNGFEEVLSXYREI  624
            R CNGFEE L  YREI
Sbjct  165  RPCNGFEEALDRYREI  180



>ref|XP_004299159.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Fragaria vesca 
subsp. vesca]
Length=448

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 118/127 (93%), Gaps = 1/127 (1%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            ++RL+R+YS+I DNYNSL++VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH+
Sbjct  67   KKRLERKYSKIDDNYNSLDQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHH  126

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE-RFCNGFEEV  603
            IG   NPYEQAI+IIGKTL++FD+DN+IPC+GFGDASTHDQ+VFSFYPDE  +CNGFEEV
Sbjct  127  IGDEQNPYEQAIAIIGKTLSSFDEDNMIPCYGFGDASTHDQEVFSFYPDEDTYCNGFEEV  186

Query  604  LSXYREI  624
            LS YRE+
Sbjct  187  LSRYREL  193



>ref|XP_009412691.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = +1

Query  226  SRNHAPPQRR----LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG  393
            S ++ PP  R    +DRRYSRI+DNY++LE+VTEALA+AGLESSNLIVGID TKSNEWTG
Sbjct  46   SESYPPPGSRPRPTIDRRYSRISDNYHTLEQVTEALAQAGLESSNLIVGIDLTKSNEWTG  105

Query  394  KKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD  573
            K SF GRSLH+IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHD+DVFSF PD
Sbjct  106  KFSFGGRSLHHIGDTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDRDVFSFCPD  165

Query  574  ERFCNGFEEVLSXYREI  624
             R CNGF++ L  YRE+
Sbjct  166  GRPCNGFQDTLVQYREL  182



>emb|CDY27584.1| BnaA09g28230D [Brassica napus]
Length=232

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  426
            Q+  D++YS I DNY S +EVT AL +AGLESSNLIVGID TKSNEWTG +SF+G+SLH+
Sbjct  22   QKNHDKKYSLIGDNYRSTDEVTAALLQAGLESSNLIVGIDVTKSNEWTGARSFDGKSLHH  81

Query  427  IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  606
            IG   NPYEQAISIIGKTL++FD+DNLIPC+GFGDA+THDQDVFSF+PD+ FCNGFE+VL
Sbjct  82   IGPAPNPYEQAISIIGKTLSSFDEDNLIPCYGFGDATTHDQDVFSFFPDDAFCNGFEQVL  141

Query  607  SXYREI  624
            + YREI
Sbjct  142  ARYREI  147



>ref|NP_001145987.1| uncharacterized protein LOC100279516 [Zea mays]
 gb|ACL52986.1| unknown [Zea mays]
Length=485

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+LDRRYSRIAD Y+S+++VT+ALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+I
Sbjct  104  RQLDRRYSRIADEYHSVDQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHI  163

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
             +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDE+ CNGFEE L 
Sbjct  164  SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDEKPCNGFEEALD  223

Query  610  XYREI  624
             YRE+
Sbjct  224  RYREL  228



>gb|AFW84239.1| hypothetical protein ZEAMMB73_082799 [Zea mays]
Length=485

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  250  RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  429
            R+LDRRYSRIAD Y+S+++VT+ALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+I
Sbjct  104  RQLDRRYSRIADEYHSVDQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHI  163

Query  430  GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  609
             +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDE+ CNGFEE L 
Sbjct  164  SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDEKPCNGFEEALD  223

Query  610  XYREI  624
             YRE+
Sbjct  224  RYREL  228



>gb|ACN85268.1| copine-1 [Oryza alta]
Length=447

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = +1

Query  223  ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  396
            ++ N+  P+   RL R+YSRI D+Y SL +VTEALA AGLESSNLIVGIDFTKSNEWTGK
Sbjct  47   STENYVQPETHARLQRKYSRIGDDYRSLNQVTEALAHAGLESSNLIVGIDFTKSNEWTGK  106

Query  397  KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  576
             SFN R LH+IG+  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  107  LSFNRRCLHDIGNTPNPYEQAISIIGRTLSVFDEDNLIPCFGFGDASTHDQEVFSFYPEN  166

Query  577  RFCNGFEEVLSXYREI  624
            R CNGFEE L  YREI
Sbjct  167  RPCNGFEEALERYREI  182



Lambda      K        H        a         alpha
   0.316    0.136    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380