BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050M11

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073284.1|  PREDICTED: succinate dehydrogenase assembly ...    258   8e-84   Sesamum indicum [beniseed]
ref|XP_004235854.1|  PREDICTED: uncharacterized protein LOC101244854    244   3e-78   Solanum lycopersicum
gb|EYU21765.1|  hypothetical protein MIMGU_mgv1a014754mg                241   5e-77   Erythranthe guttata [common monkey flower]
emb|CDO98294.1|  unnamed protein product                                238   8e-76   Coffea canephora [robusta coffee]
ref|XP_006341465.1|  PREDICTED: uncharacterized protein LOC102604677    237   2e-75   Solanum tuberosum [potatoes]
ref|XP_011082843.1|  PREDICTED: succinate dehydrogenase assembly ...    235   7e-75   Sesamum indicum [beniseed]
ref|XP_007038172.1|  Uncharacterized protein TCM_014776                 228   8e-72   
ref|XP_006281168.1|  hypothetical protein CARUB_v10027202mg             221   3e-69   Capsella rubella
ref|XP_004300377.1|  PREDICTED: succinate dehydrogenase assembly ...    221   4e-69   Fragaria vesca subsp. vesca
ref|XP_009786126.1|  PREDICTED: uncharacterized protein LOC104234290    221   6e-69   Nicotiana sylvestris
emb|CBI35625.3|  unnamed protein product                                219   1e-68   Vitis vinifera
ref|XP_009373661.1|  PREDICTED: uncharacterized protein LOC103962643    219   3e-68   Pyrus x bretschneideri [bai li]
gb|KHG15768.1|  Succinate dehydrogenase assembly factor 2, mitoch...    219   4e-68   Gossypium arboreum [tree cotton]
ref|XP_010555590.1|  PREDICTED: uncharacterized protein LOC104825042    218   4e-68   Tarenaya hassleriana [spider flower]
gb|KFK36749.1|  hypothetical protein AALP_AA4G165000                    218   5e-68   Arabis alpina [alpine rockcress]
ref|XP_008392686.1|  PREDICTED: uncharacterized protein LOC103454872    218   5e-68   
gb|KJB07930.1|  hypothetical protein B456_001G053700                    218   6e-68   Gossypium raimondii
gb|KDO57641.1|  hypothetical protein CISIN_1g039261mg                   217   9e-68   Citrus sinensis [apfelsine]
ref|XP_006436982.1|  hypothetical protein CICLE_v10032866mg             217   9e-68   Citrus clementina [clementine]
ref|XP_007209673.1|  hypothetical protein PRUPE_ppa012247mg             217   2e-67   Prunus persica
ref|XP_002322310.1|  hypothetical protein POPTR_0015s11970g             217   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010646726.1|  PREDICTED: succinate dehydrogenase assembly ...    217   2e-67   Vitis vinifera
ref|XP_003602736.1|  Succinate dehydrogenase assembly factor            216   3e-67   Medicago truncatula
ref|XP_008441916.1|  PREDICTED: uncharacterized protein LOC103485912    216   7e-67   
ref|NP_199917.1|  succinate dehydrogenase assembly factor 2             215   1e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64715.1|  unknown                                                 215   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482431.1|  PREDICTED: uncharacterized protein LOC104761094    214   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004152841.1|  PREDICTED: uncharacterized protein LOC101212517    215   2e-66   Cucumis sativus [cucumbers]
ref|XP_002511076.1|  conserved hypothetical protein                     214   2e-66   Ricinus communis
dbj|BAJ53118.1|  JHL07K02.8                                             214   2e-66   Jatropha curcas
gb|KHG14755.1|  Succinate dehydrogenase assembly factor 2, mitoch...    214   3e-66   Gossypium arboreum [tree cotton]
emb|CDY16340.1|  BnaA02g11440D                                          213   5e-66   Brassica napus [oilseed rape]
ref|XP_002864092.1|  hypothetical protein ARALYDRAFT_495170             213   5e-66   Arabidopsis lyrata subsp. lyrata
gb|AFK43220.1|  unknown                                                 213   5e-66   Medicago truncatula
ref|XP_009339020.1|  PREDICTED: uncharacterized protein LOC103931...    213   8e-66   Pyrus x bretschneideri [bai li]
ref|XP_009339021.1|  PREDICTED: uncharacterized protein LOC103931...    212   8e-66   Pyrus x bretschneideri [bai li]
gb|KGN61232.1|  hypothetical protein Csa_2G072460                       215   9e-66   Cucumis sativus [cucumbers]
ref|XP_009127327.1|  PREDICTED: succinate dehydrogenase assembly ...    212   1e-65   Brassica rapa
ref|XP_009140882.1|  PREDICTED: uncharacterized protein LOC103864866    211   4e-65   Brassica rapa
gb|EPS59121.1|  hypothetical protein M569_15690                         209   5e-65   Genlisea aurea
ref|XP_006402032.1|  hypothetical protein EUTSA_v10014773mg             210   9e-65   Eutrema salsugineum [saltwater cress]
emb|CDY05831.1|  BnaA10g05890D                                          210   9e-65   
ref|XP_010070209.1|  PREDICTED: uncharacterized protein LOC104456996    208   5e-64   Eucalyptus grandis [rose gum]
ref|XP_007137824.1|  hypothetical protein PHAVU_009G158800g             207   6e-64   Phaseolus vulgaris [French bean]
ref|NP_001236603.1|  uncharacterized protein LOC100527478               207   6e-64   Glycine max [soybeans]
ref|NP_001190509.1|  succinate dehydrogenase assembly factor 2          207   1e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91564.1|  BnaC02g15960D                                          207   1e-63   
ref|XP_010250490.1|  PREDICTED: uncharacterized protein LOC104592726    206   3e-63   Nelumbo nucifera [Indian lotus]
gb|KHN31242.1|  Succinate dehydrogenase assembly factor 2, mitoch...    205   4e-63   Glycine soja [wild soybean]
ref|XP_010667021.1|  PREDICTED: succinate dehydrogenase assembly ...    205   7e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK44704.1|  unknown                                                 204   1e-62   Lotus japonicus
ref|XP_008385758.1|  PREDICTED: uncharacterized protein LOC103448287    204   2e-62   Malus domestica [apple tree]
gb|KJB07931.1|  hypothetical protein B456_001G053700                    203   2e-62   Gossypium raimondii
gb|KCW58840.1|  hypothetical protein EUGRSUZ_H01475                     204   3e-62   Eucalyptus grandis [rose gum]
gb|AFJ66165.1|  hypothetical protein 11M19.9                            201   1e-61   Arabidopsis halleri
ref|NP_001032052.1|  succinate dehydrogenase assembly factor 2          201   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004979384.1|  PREDICTED: uncharacterized protein LOC101756720    199   8e-61   Setaria italica
ref|NP_001235179.1|  uncharacterized protein LOC100500495               198   3e-60   Glycine max [soybeans]
gb|KHN09698.1|  Succinate dehydrogenase assembly factor 2, mitoch...    198   4e-60   Glycine soja [wild soybean]
ref|XP_008797117.1|  PREDICTED: succinate dehydrogenase assembly ...    197   6e-60   Phoenix dactylifera
ref|XP_010929714.1|  PREDICTED: uncharacterized protein LOC105051113    195   3e-59   Elaeis guineensis
ref|NP_001288385.1|  uncharacterized LOC103654411                       195   6e-59   Zea mays [maize]
ref|XP_006662965.1|  PREDICTED: uncharacterized protein LOC102700188    194   7e-59   Oryza brachyantha
gb|ACG25754.1|  TPR repeat region family protein                        194   1e-58   Zea mays [maize]
ref|XP_008670754.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    193   2e-58   Zea mays [maize]
gb|AFK36017.1|  unknown                                                 192   5e-58   Medicago truncatula
ref|XP_002449598.1|  hypothetical protein SORBIDRAFT_05g019780          192   6e-58   Sorghum bicolor [broomcorn]
ref|XP_009413497.1|  PREDICTED: uncharacterized protein LOC103994785    190   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004503818.1|  PREDICTED: uncharacterized protein LOC101502675    190   1e-56   Cicer arietinum [garbanzo]
ref|NP_001068002.1|  Os11g0528300                                       188   3e-56   
ref|XP_003577516.1|  PREDICTED: succinate dehydrogenase assembly ...    187   4e-56   Brachypodium distachyon [annual false brome]
dbj|BAJ88942.1|  predicted protein                                      187   6e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90590.1|  predicted protein                                      187   6e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY81147.1|  hypothetical protein OsI_36329                          187   1e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001235051.1|  uncharacterized protein LOC100527878               186   1e-55   Glycine max [soybeans]
gb|ABK26064.1|  unknown                                                 186   3e-55   Picea sitchensis
gb|AFJ66194.1|  hypothetical protein 7G9.12                             186   5e-55   Boechera stricta
ref|XP_006844641.1|  hypothetical protein AMTR_s00016p00232260          183   2e-54   Amborella trichopoda
emb|CDX71677.1|  BnaC09g27180D                                          174   7e-52   
gb|KHN16894.1|  (+)-neomenthol dehydrogenase                            183   3e-51   Glycine soja [wild soybean]
gb|KHG13984.1|  Carbonyl reductase [NADPH] 1                            183   4e-51   Gossypium arboreum [tree cotton]
gb|KHG13985.1|  Carbonyl reductase [NADPH] 1                            182   4e-51   Gossypium arboreum [tree cotton]
gb|AFJ66223.1|  hypothetical protein 34G24.28                           173   9e-51   Capsella rubella
gb|EMT20783.1|  hypothetical protein F775_28401                         162   5e-47   
ref|XP_011082852.1|  PREDICTED: succinate dehydrogenase assembly ...    162   7e-47   
gb|EMS54449.1|  hypothetical protein TRIUR3_02167                       160   4e-46   Triticum urartu
ref|XP_011040389.1|  PREDICTED: uncharacterized protein LOC105136661    163   4e-46   Populus euphratica
ref|XP_010112900.1|  hypothetical protein L484_017736                   160   2e-45   
ref|XP_002973356.1|  hypothetical protein SELMODRAFT_98920              156   2e-44   
gb|KCW58842.1|  hypothetical protein EUGRSUZ_H01475                     137   1e-36   Eucalyptus grandis [rose gum]
ref|XP_001752564.1|  predicted protein                                  135   2e-36   
ref|XP_001694005.1|  predicted protein                                  132   2e-34   Chlamydomonas reinhardtii
ref|XP_009604827.1|  PREDICTED: uncharacterized protein LOC104099523    126   7e-33   Nicotiana tomentosiformis
ref|XP_009770861.1|  PREDICTED: uncharacterized protein LOC104221491    124   9e-33   Nicotiana sylvestris
ref|XP_009622307.1|  PREDICTED: uncharacterized protein LOC104113746    124   1e-32   
ref|XP_009768410.1|  PREDICTED: uncharacterized protein LOC104219416    125   7e-32   Nicotiana sylvestris
ref|XP_005644390.1|  hypothetical protein COCSUDRAFT_67604              119   3e-30   Coccomyxa subellipsoidea C-169
ref|XP_002956425.1|  hypothetical protein VOLCADRAFT_66963              113   4e-28   Volvox carteri f. nagariensis
ref|XP_008239648.1|  PREDICTED: uncharacterized protein LOC103338241    111   9e-28   
ref|XP_003056014.1|  predicted protein                                  113   1e-27   Micromonas pusilla CCMP1545
ref|XP_007515400.1|  predicted protein                                  108   4e-25   Bathycoccus prasinos
tpg|DAA42045.1|  TPA: hypothetical protein ZEAMMB73_302044              103   9e-25   
ref|XP_005845121.1|  hypothetical protein CHLNCDRAFT_137510             101   2e-23   Chlorella variabilis
gb|KIZ01550.1|  hypothetical protein MNEG_6410                          102   4e-23   Monoraphidium neglectum
ref|XP_003074399.1|  unnamed protein product                            100   5e-23   Ostreococcus tauri
ref|XP_002507517.1|  hypothetical protein MICPUN_113604               96.7    2e-21   Micromonas commoda
gb|KHN23465.1|  hypothetical protein glysoja_045738                   72.4    4e-13   Glycine soja [wild soybean]
gb|KJB40073.1|  hypothetical protein B456_007G045300                  71.2    1e-12   Gossypium raimondii
ref|XP_001415883.1|  predicted protein                                70.9    2e-12   Ostreococcus lucimarinus CCE9901
ref|WP_010703780.1|  hypothetical protein                             64.7    2e-10   Bartonella schoenbuchensis
ref|WP_008039513.1|  hypothetical protein                             63.9    5e-10   Bartonella tamiae
ref|WP_013545055.1|  hypothetical protein                             63.5    7e-10   Bartonella clarridgeiae
emb|CCA27700.1|  conserved hypothetical protein                       65.1    7e-10   Albugo laibachii Nc14
ref|WP_012169751.1|  hypothetical protein                             63.5    7e-10   Azorhizobium caulinodans
ref|WP_007477238.1|  hypothetical protein                             63.2    1e-09   Bartonella melophagi
ref|WP_029005817.1|  hypothetical protein                             62.8    2e-09   Azorhizobium doebereinerae
ref|WP_010701226.1|  hypothetical protein                             62.4    2e-09   Bartonella bovis
ref|WP_024707839.1|  hypothetical protein                             62.4    2e-09   Martelella sp. AD-3
ref|XP_005781647.1|  hypothetical protein EMIHUDRAFT_434617           63.2    2e-09   Emiliania huxleyi CCMP1516
ref|WP_036260985.1|  hypothetical protein                             62.0    2e-09   Methylocapsa aurea
emb|CCC90966.1|  unnamed protein product                              62.8    3e-09   Trypanosoma congolense IL3000
emb|CBI79302.1|  conserved hypothetical protein                       61.6    3e-09   Bartonella sp. AR 15-3
ref|WP_004597938.1|  hypothetical protein                             61.2    3e-09   Rickettsia prowazekii
emb|CCI50500.1|  unnamed protein product                              62.8    3e-09   Albugo candida
ref|WP_015452777.1|  hypothetical protein                             61.6    3e-09   Candidatus Liberibacter asiaticus
ref|WP_018391021.1|  hypothetical protein                             61.6    4e-09   Ancylobacter sp. FA202
ref|WP_022712338.1|  hypothetical protein                             60.5    1e-08   Pseudochrobactrum sp. AO18b
ref|WP_036553171.1|  hypothetical protein                             60.1    1e-08   Nisaea denitrificans
ref|XP_005836517.1|  hypothetical protein GUITHDRAFT_151400           60.5    1e-08   Guillardia theta CCMP2712
ref|WP_035376784.1|  hypothetical protein                             60.1    1e-08   
ref|XP_009833593.1|  hypothetical protein H257_09161                  61.2    2e-08   Aphanomyces astaci
emb|CBH11749.1|  hypothetical protein, conserved                      60.5    2e-08   Trypanosoma brucei gambiense DAL972
ref|XP_845372.1|  hypothetical protein                                60.5    2e-08   Trypanosoma brucei brucei TREU927
ref|WP_025047688.1|  hypothetical protein                             59.3    2e-08   Sulfitobacter mediterraneus
ref|WP_037909588.1|  hypothetical protein                             59.3    2e-08   Sulfitobacter
gb|AFK53465.1|  Succinate dehydrogenase assembly factor               59.7    2e-08   Tistrella mobilis KA081020-065
ref|XP_004347184.1|  TPR repeat region protein                        60.5    2e-08   Acanthamoeba castellanii str. Neff
ref|WP_027486486.1|  hypothetical protein                             59.3    2e-08   Rhizobium undicola
ref|WP_018687838.1|  MULTISPECIES: hypothetical protein               58.9    2e-08   Ahrensia
ref|WP_011191033.1|  hypothetical protein                             58.9    3e-08   Rickettsia typhi
ref|WP_027673296.1|  hypothetical protein                             59.3    3e-08   Agrobacterium larrymoorei
ref|WP_019404098.1|  hypothetical protein                             58.9    3e-08   
ref|XP_002903388.1|  conserved hypothetical protein                   60.1    3e-08   Phytophthora infestans T30-4
ref|WP_016830859.1|  hypothetical protein                             58.2    4e-08   Rickettsia conorii
ref|WP_018063308.1|  hypothetical protein                             58.5    5e-08   Martelella mediterranea
ref|WP_007798034.1|  hypothetical protein                             57.8    6e-08   Salipiger bermudensis
gb|ESR26581.1|  hypothetical protein N177_0800                        58.2    6e-08   Lutibaculum baratangense AMV1
ref|XP_007313875.1|  hypothetical protein SERLADRAFT_342967           58.2    7e-08   Serpula lacrymans var. lacrymans S7.9
ref|WP_040485112.1|  hypothetical protein                             57.8    8e-08   
ref|WP_004997963.1|  MULTISPECIES: hypothetical protein               57.4    9e-08   spotted fever group
ref|WP_014130575.1|  hypothetical protein                             57.4    9e-08   Pelagibacterium
ref|WP_004273267.1|  hypothetical protein                             57.4    9e-08   Nitrospirillum amazonense
ref|XP_009531410.1|  hypothetical protein PHYSODRAFT_256191           58.2    9e-08   Phytophthora sojae
ref|WP_006110548.1|  hypothetical protein                             57.4    9e-08   Brucella abortus
ref|WP_034480686.1|  hypothetical protein                             57.8    9e-08   Agrobacterium rhizogenes
ref|WP_018974713.1|  hypothetical protein                             57.0    1e-07   
ref|WP_002966054.1|  MULTISPECIES: hypothetical protein               57.4    1e-07   Brucella
ref|XP_009041798.1|  hypothetical protein AURANDRAFT_16750            57.0    1e-07   Aureococcus anophagefferens
gb|EFG36278.1|  hypothetical protein BAZG_02599                       57.8    1e-07   Brucella sp. NVSL 07-0026
gb|EEH12621.1|  Hypothetical protein, conserved                       57.8    1e-07   Brucella ceti str. Cudo
ref|WP_005865286.1|  hypothetical protein                             57.4    1e-07   Bartonella alsatica
ref|WP_028735232.1|  hypothetical protein                             57.4    1e-07   Rhizobium
ref|WP_016945838.1|  hypothetical protein                             57.0    1e-07   
ref|WP_006164638.1|  hypothetical protein                             57.0    1e-07   Brucella sp. 63/311
ref|WP_004681891.1|  MULTISPECIES: hypothetical protein               57.4    1e-07   Brucella
ref|WP_026060177.1|  hypothetical protein                             57.0    1e-07   Pseudaminobacter salicylatoxidans
emb|CBI80887.1|  conserved hypothetical protein                       57.0    1e-07   Bartonella sp. 1-1C
ref|WP_006924490.1|  hypothetical protein                             57.0    2e-07   Bartonella washoeensis
gb|EGO03769.1|  hypothetical protein SERLA73DRAFT_69598               57.8    2e-07   Serpula lacrymans var. lacrymans S7.3
ref|WP_006925324.1|  hypothetical protein                             56.6    2e-07   Bartonella washoeensis
ref|WP_035005833.1|  hypothetical protein                             56.6    2e-07   Bartonella rochalimae
ref|WP_044563814.1|  hypothetical protein                             56.6    2e-07   Azospirillum sp. B4
ref|WP_007601033.1|  hypothetical protein                             57.0    2e-07   Rhizobium sp. PDO1-076
ref|WP_010421957.1|  hypothetical protein                             56.6    2e-07   Rickettsia helvetica
ref|WP_014412533.1|  MULTISPECIES: hypothetical protein               56.6    2e-07   spotted fever group
ref|WP_025045323.1|  hypothetical protein                             56.2    2e-07   Sulfitobacter geojensis
ref|WP_015827417.1|  hypothetical protein                             56.2    2e-07   Hirschia baltica
ref|XP_008872066.1|  hypothetical protein H310_08184                  57.8    2e-07   Aphanomyces invadans
ref|WP_011646986.1|  MULTISPECIES: hypothetical protein               56.2    2e-07   Hyphomonas
ref|WP_013166504.1|  hypothetical protein                             56.6    2e-07   Starkeya novella
ref|WP_012335953.1|  hypothetical protein                             56.6    2e-07   Methylobacterium sp. 4-46
ref|WP_005767097.1|  hypothetical protein                             56.2    2e-07   Bartonella bacilliformis
ref|WP_025438573.1|  succinate dehydrogenase                          56.6    2e-07   Komagataeibacter xylinus
ref|WP_029356051.1|  hypothetical protein                             56.2    3e-07   Bosea sp. 117
ref|WP_025812949.1|  succinate dehydrogenase                          56.2    3e-07   Komagataeibacter kakiaceti
ref|WP_019995146.1|  hypothetical protein                             56.2    3e-07   Aureimonas ureilytica
ref|WP_018263478.1|  hypothetical protein                             56.2    3e-07   Methylobacterium sp. WSM2598
ref|WP_041605724.1|  hypothetical protein                             55.8    3e-07   
gb|KDO24781.1|  hypothetical protein SPRG_20818                       57.4    3e-07   Saprolegnia parasitica CBS 223.65
ref|WP_012093025.1|  hypothetical protein                             56.2    3e-07   Ochrobactrum
ref|WP_004860026.1|  hypothetical protein                             56.2    3e-07   Bartonella taylorii
ref|XP_008611228.1|  hypothetical protein SDRG_07186                  57.4    3e-07   Saprolegnia diclina VS20
ref|WP_039758625.1|  hypothetical protein                             55.8    4e-07   Bartonella queenslandensis
ref|WP_014392563.1|  hypothetical protein                             55.8    4e-07   Rickettsia amblyommatis
ref|WP_043693702.1|  hypothetical protein                             55.5    4e-07   Luteibacter sp. 9133
ref|WP_036113619.1|  MULTISPECIES: hypothetical protein               55.5    4e-07   Luteibacter
ref|WP_037923565.1|  hypothetical protein                             55.8    4e-07   Sulfitobacter pseudonitzschiae
ref|WP_010658839.1|  MULTISPECIES: hypothetical protein               55.8    4e-07   Ochrobactrum
ref|WP_019904061.1|  hypothetical protein                             55.8    4e-07   Methylobacterium sp. 77
ref|WP_011270705.1|  MULTISPECIES: hypothetical protein               55.5    4e-07   spotted fever group
ref|WP_039531503.1|  hypothetical protein                             55.5    5e-07   Ruegeria sp. ANG-S4
ref|WP_014014557.1|  hypothetical protein                             55.5    5e-07   spotted fever group
ref|WP_014409406.1|  hypothetical protein                             55.5    5e-07   Rickettsia montanensis
ref|WP_028794924.1|  hypothetical protein                             55.5    5e-07   Thalassobaculum salexigens
ref|WP_022697995.1|  hypothetical protein                             55.5    5e-07   Euryhalocaulis caribicus
ref|WP_035595905.1|  hypothetical protein                             55.5    5e-07   Hyphomonas
ref|WP_008580148.1|  MULTISPECIES: hypothetical protein               55.5    5e-07   Rickettsia
gb|KDO17362.1|  hypothetical protein SPRG_17211                       57.0    5e-07   Saprolegnia parasitica CBS 223.65
ref|WP_019221750.1|  hypothetical protein                             55.5    5e-07   Bartonella senegalensis
ref|WP_042994954.1|  hypothetical protein                             55.5    6e-07   Bartonella bacilliformis
ref|WP_028000444.1|  hypothetical protein                             55.5    6e-07   Sinorhizobium arboris
emb|CBK22104.2|  unnamed protein product                              56.6    6e-07   Blastocystis hominis
ref|WP_042619037.1|  hypothetical protein                             55.5    6e-07   Agrobacterium tumefaciens
ref|WP_025090211.1|  hypothetical protein                             55.1    6e-07   Ochrobactrum intermedium
emb|CEI84740.1|  Uncharacterized protein ehr_00106                    55.1    7e-07   Ehrlichia minasensis
ref|WP_007553351.1|  hypothetical protein                             55.1    7e-07   Bartonella sp. DB5-6
gb|ETK84784.1|  hypothetical protein L915_10288                       56.6    7e-07   Phytophthora parasitica
gb|EEQ93575.1|  Hypothetical protein, conserved                       56.6    7e-07   Ochrobactrum intermedium LMG 3301
ref|WP_010507900.1|  MULTISPECIES: hypothetical protein               55.1    7e-07   Komagataeibacter
ref|XP_008893576.1|  hypothetical protein PPTG_01936                  56.6    7e-07   Phytophthora parasitica INRA-310
ref|WP_012151075.1|  MULTISPECIES: hypothetical protein               55.1    7e-07   Rickettsia
ref|WP_010977514.1|  hypothetical protein                             55.1    7e-07   Rickettsia conorii
ref|WP_042695624.1|  hypothetical protein                             55.1    7e-07   Azospirillum sp. B506
ref|XP_002365034.1|  hypothetical protein TGME49_058100               55.8    8e-07   
ref|WP_027491861.1|  hypothetical protein                             54.7    8e-07   Rhodanobacter sp. OR444
gb|KFG33774.1|  TPR repeat region protein                             57.0    8e-07   Toxoplasma gondii GAB2-2007-GAL-DOM2
emb|CBJ33347.1|  conserved unknown protein                            57.0    8e-07   Ectocarpus siliculosus
ref|WP_040291656.1|  hypothetical protein                             55.1    8e-07   
ref|WP_034505622.1|  hypothetical protein                             55.1    9e-07   Agrobacterium rhizogenes
ref|WP_019218647.1|  hypothetical protein                             54.7    9e-07   Bartonella florencae
ref|WP_027285193.1|  hypothetical protein                             54.7    9e-07   Rubritepida flocculans
ref|WP_037202057.1|  hypothetical protein                             55.1    9e-07   Rhizobium
ref|WP_012148511.1|  hypothetical protein                             54.7    1e-06   Rickettsia canadensis
ref|WP_043598464.1|  hypothetical protein                             54.3    1e-06   Dyella ginsengisoli
ref|XP_005534895.1|  hypothetical protein, conserved                  55.8    1e-06   Cyanidioschyzon merolae strain 10D
gb|KFG29431.1|  TPR repeat region protein                             56.6    1e-06   Toxoplasma gondii p89
ref|WP_011631542.1|  hypothetical protein                             54.7    1e-06   Granulibacter bethesdensis
ref|WP_028958270.1|  hypothetical protein                             54.7    1e-06   Sulfitobacter sp. 20_GPM-1509m
gb|KFH13357.1|  TPR repeat region protein                             56.6    1e-06   Toxoplasma gondii MAS
ref|WP_006471374.1|  MULTISPECIES: hypothetical protein               54.7    1e-06   Ochrobactrum
gb|KFG65086.1|  TPR repeat region protein                             56.6    1e-06   Toxoplasma gondii RUB
ref|WP_011945193.1|  hypothetical protein                             54.3    1e-06   Orientia tsutsugamushi
ref|WP_025286345.1|  hypothetical protein                             54.7    1e-06   Granulibacter bethesdensis
ref|WP_015933487.1|  hypothetical protein                             54.7    1e-06   Methylobacterium nodulans
ref|WP_026607823.1|  hypothetical protein                             54.7    1e-06   Methylocapsa acidiphila
gb|EPR62894.1|  TPR repeat region protein                             56.6    1e-06   Toxoplasma gondii GT1
ref|WP_007557506.1|  hypothetical protein                             54.7    1e-06   
ref|WP_039682566.1|  hypothetical protein                             54.3    1e-06   Tateyamaria sp. ANG-S1
ref|WP_012231771.1|  hypothetical protein                             54.3    1e-06   Bartonella tribocorum
ref|WP_025427009.1|  hypothetical protein                             54.3    1e-06   Ensifer
ref|WP_007346641.1|  hypothetical protein                             54.3    1e-06   Bartonella rattimassiliensis
ref|WP_041247127.1|  succinate dehydrogenase                          54.3    1e-06   Komagataeibacter medellinensis
ref|WP_008853367.1|  hypothetical protein                             54.3    2e-06   
ref|WP_027990302.1|  hypothetical protein                             54.3    2e-06   Sinorhizobium meliloti
ref|WP_037127899.1|  hypothetical protein                             54.3    2e-06   Rhizobium sp. CF394
ref|WP_037101176.1|  hypothetical protein                             54.3    2e-06   Rhizobium sp. OK665
gb|EPT29316.1|  TPR repeat region protein                             56.2    2e-06   Toxoplasma gondii ME49
gb|AGB71162.1|  TPR repeat region superfamily                         54.3    2e-06   Rhizobium tropici CIAT 899
emb|CDJ85422.1|  Protein of unknown function DUF339 domain contai...  54.7    2e-06   Haemonchus contortus [red stomach worm]
ref|WP_012149828.1|  hypothetical protein                             53.9    2e-06   Rickettsia akari [rickettsialpox]
ref|WP_041677422.1|  TPR repeat region superfamily                    54.3    2e-06   Rhizobium tropici
ref|WP_010971859.1|  MULTISPECIES: hypothetical protein               54.3    2e-06   Rhizobium/Agrobacterium group
ref|WP_006727727.1|  hypothetical protein                             54.3    2e-06   Agrobacterium albertimagni
ref|WP_028011380.1|  MULTISPECIES: hypothetical protein               53.9    2e-06   Sinorhizobium/Ensifer group
ref|WP_015007549.1|  hypothetical protein                             53.9    2e-06   Sinorhizobium meliloti
ref|WP_003537695.1|  hypothetical protein                             53.9    2e-06   Rhizobiales
ref|WP_026634479.1|  hypothetical protein                             53.5    2e-06   Dyella
ref|WP_035215887.1|  TPR repeat region superfamily                    53.9    2e-06   Agrobacterium
ref|WP_034336235.1|  hypothetical protein                             53.9    2e-06   Commensalibacter sp. MX01
ref|WP_012973838.1|  hypothetical protein                             53.9    2e-06   Azospirillum lipoferum
gb|KCZ58035.1|  hypothetical protein HY36_11040                       53.5    2e-06   Hyphomonas atlantica
gb|EWM27240.1|  mitochondrial protein                                 55.5    2e-06   Nannochloropsis gaditana
ref|WP_007693532.1|  MULTISPECIES: hypothetical protein               53.9    2e-06   Rhizobium/Agrobacterium group
ref|WP_041344915.1|  hypothetical protein                             53.9    2e-06   Nitrobacter winogradskyi
ref|WP_007559114.1|  hypothetical protein                             53.9    2e-06   Methylobacterium
dbj|BAG41032.1|  hypothetical protein OTT_1574                        53.9    2e-06   Orientia tsutsugamushi str. Ikeda
ref|WP_013640192.1|  MULTISPECIES: hypothetical protein               53.9    2e-06   Acidiphilium
ref|WP_025828816.1|  hypothetical protein                             53.9    2e-06   Acetobacter persici
ref|XP_008872067.1|  hypothetical protein, variant                    54.7    2e-06   Aphanomyces invadans
ref|WP_041621685.1|  hypothetical protein                             53.5    2e-06   
ref|WP_014247785.1|  hypothetical protein                             53.9    3e-06   
ref|WP_027173438.1|  hypothetical protein                             53.5    3e-06   
ref|WP_015856368.1|  hypothetical protein                             53.5    3e-06   
ref|WP_035555371.1|  hypothetical protein                             53.5    3e-06   
ref|WP_007400566.1|  MULTISPECIES: Succinate dehydrogenase assemb...  53.5    3e-06   
dbj|BAK82964.1|  hypothetical protein GLX_05520                       53.9    3e-06   
ref|WP_003515739.1|  MULTISPECIES: hypothetical protein               53.5    3e-06   
ref|WP_011180769.1|  hypothetical protein                             53.5    3e-06   
ref|WP_029057074.1|  hypothetical protein                             53.1    3e-06   
ref|WP_008434632.1|  hypothetical protein                             53.1    3e-06   
ref|WP_025056750.1|  hypothetical protein                             53.1    3e-06   
ref|WP_036488691.1|  hypothetical protein                             53.1    3e-06   
emb|CDJ39757.1|  hypothetical protein, conserved                      54.3    3e-06   
ref|WP_038616784.1|  hypothetical protein                             52.8    4e-06   
ref|WP_023508040.1|  Flavinator of succinate dehydrogenase            53.1    4e-06   
ref|WP_028753182.1|  hypothetical protein                             53.5    4e-06   
ref|WP_018239716.1|  hypothetical protein                             53.1    4e-06   
ref|WP_019961760.1|  hypothetical protein                             53.1    4e-06   
ref|WP_034857403.1|  TPR repeat region superfamily                    53.1    4e-06   
ref|WP_034791024.1|  hypothetical protein                             53.1    4e-06   
ref|WP_019013068.1|  hypothetical protein                             53.1    4e-06   
emb|CCF19540.1|  conserved protein of unknown function                53.1    4e-06   
ref|WP_009814638.1|  hypothetical protein                             52.8    4e-06   
ref|WP_019223551.1|  hypothetical protein                             53.1    4e-06   
gb|ABA04775.1|  Protein of unknown function DUF339                    53.5    4e-06   
ref|WP_037146857.1|  hypothetical protein                             53.1    4e-06   
ref|WP_004118905.1|  hypothetical protein                             53.1    4e-06   
ref|WP_016917637.1|  hypothetical protein                             52.8    4e-06   
ref|WP_029618211.1|  MULTISPECIES: hypothetical protein               53.1    4e-06   
dbj|GAM99318.1|  ygfY                                                 52.8    4e-06   
ref|WP_037166982.1|  MULTISPECIES: hypothetical protein               53.1    5e-06   
ref|XP_003110015.1|  hypothetical protein CRE_06477                   53.5    5e-06   
ref|WP_013301184.1|  hypothetical protein                             52.8    5e-06   
ref|XP_002186282.1|  predicted protein                                54.7    5e-06   
ref|WP_020038507.1|  hypothetical protein                             52.8    5e-06   
ref|WP_009026908.1|  hypothetical protein                             52.8    5e-06   
ref|WP_041756656.1|  hypothetical protein                             52.8    5e-06   
ref|WP_029029930.1|  hypothetical protein                             52.8    5e-06   
ref|WP_035096649.1|  hypothetical protein                             52.8    5e-06   
ref|WP_018181723.1|  hypothetical protein                             52.8    5e-06   
ref|WP_035708494.1|  hypothetical protein                             52.8    5e-06   
gb|EEA96799.1|  TPR repeat region superfamily protein                 52.8    5e-06   
gb|KJF66436.1|  hypothetical protein RS75_17820                       52.8    6e-06   
ref|WP_005773579.1|  hypothetical protein                             52.8    6e-06   
ref|WP_043620340.1|  TPR repeat region superfamily                    52.8    6e-06   
gb|KIK99193.1|  hypothetical protein PAXRUDRAFT_30676                 53.9    6e-06   
ref|WP_038603970.1|  hypothetical protein                             52.4    6e-06   
ref|WP_024513261.1|  hypothetical protein                             52.8    6e-06   
ref|WP_011975556.1|  MULTISPECIES: hypothetical protein               52.8    6e-06   
gb|KIK46153.1|  hypothetical protein CY34DRAFT_76515                  53.5    6e-06   
ref|WP_037035972.1|  hypothetical protein                             52.8    6e-06   
ref|WP_011304969.1|  hypothetical protein                             52.4    6e-06   
ref|WP_026940567.1|  hypothetical protein                             52.4    7e-06   
ref|WP_024314859.1|  MULTISPECIES: hypothetical protein               52.8    7e-06   
ref|WP_012456370.1|  hypothetical protein                             52.4    7e-06   
ref|WP_037408428.1|  hypothetical protein                             52.4    7e-06   
ref|WP_027509476.1|  hypothetical protein                             52.8    7e-06   
ref|WP_026623201.1|  hypothetical protein                             52.4    7e-06   
gb|EAQ23286.1|  TPR repeat family protein                             52.4    7e-06   
ref|XP_008883187.1|  TPR repeat region protein                        54.3    7e-06   
ref|XP_004360936.1|  DUF339 family protein                            53.1    7e-06   
ref|WP_006589677.1|  hypothetical protein                             52.4    8e-06   
ref|WP_040650603.1|  hypothetical protein                             52.0    8e-06   
ref|WP_008213922.1|  hypothetical protein                             52.0    8e-06   
ref|WP_014285836.1|  hypothetical protein                             52.4    8e-06   
gb|KIO14235.1|  hypothetical protein M404DRAFT_12100                  53.1    8e-06   
ref|WP_037087001.1|  hypothetical protein                             52.4    8e-06   
ref|WP_018855028.1|  MULTISPECIES: hypothetical protein               52.4    8e-06   
ref|WP_035674467.1|  hypothetical protein                             52.4    9e-06   
ref|WP_041849613.1|  hypothetical protein                             52.0    9e-06   
ref|WP_037121923.1|  hypothetical protein                             52.4    9e-06   
ref|WP_034459367.1|  hypothetical protein                             52.0    9e-06   
ref|WP_041414377.1|  TPR repeat region superfamily                    52.4    9e-06   
ref|WP_018043709.1|  hypothetical protein                             52.0    9e-06   
gb|KIY52830.1|  mitochondrial protein                                 53.1    9e-06   
emb|CCC98449.1|  conserved protein of unknown function                52.4    9e-06   
gb|EYR79931.1|  hypothetical protein SHLA_1c001090                    52.4    9e-06   
gb|KCZ65704.1|  hypothetical protein L53_15085                        52.0    9e-06   
gb|KIJ15934.1|  hypothetical protein PAXINDRAFT_76341                 53.1    1e-05   
ref|WP_017442407.1|  hypothetical protein                             52.0    1e-05   
ref|WP_018324790.1|  hypothetical protein                             52.0    1e-05   
gb|KJF74148.1|  hypothetical protein RP75_08865                       52.0    1e-05   
ref|WP_044426115.1|  hypothetical protein                             52.0    1e-05   
ref|WP_011451250.1|  hypothetical protein                             51.6    1e-05   
ref|WP_035381754.1|  hypothetical protein                             52.0    1e-05   
ref|WP_044152831.1|  hypothetical protein                             51.6    1e-05   
gb|EOA61435.1|  TPR repeat-containing protein                         51.6    1e-05   
ref|WP_007808043.1|  hypothetical protein                             51.6    1e-05   
ref|WP_043767714.1|  hypothetical protein                             51.6    1e-05   
ref|WP_014328337.1|  hypothetical protein                             52.0    1e-05   
ref|WP_007197392.1|  hypothetical protein                             52.0    1e-05   
ref|WP_040309696.1|  hypothetical protein                             51.6    1e-05   
ref|WP_012318628.1|  MULTISPECIES: hypothetical protein               51.6    1e-05   
ref|WP_038530795.1|  hypothetical protein                             51.6    1e-05   
ref|WP_006613981.1|  hypothetical protein                             51.6    1e-05   
ref|WP_035025608.1|  MULTISPECIES: hypothetical protein               51.6    1e-05   
ref|XP_003287746.1|  hypothetical protein DICPUDRAFT_32960            52.0    1e-05   
gb|ESA11292.1|  hypothetical protein GLOINDRAFT_347836                52.8    2e-05   
ref|WP_004863794.1|  hypothetical protein                             51.6    2e-05   
ref|WP_025825059.1|  hypothetical protein                             51.6    2e-05   
ref|WP_020093288.1|  MULTISPECIES: hypothetical protein               51.6    2e-05   
ref|WP_031552239.1|  hypothetical protein                             51.2    2e-05   
ref|WP_019934961.1|  hypothetical protein                             51.2    2e-05   
gb|EGF90582.1|  hypothetical protein ABI_36070                        51.6    2e-05   
ref|WP_042461551.1|  hypothetical protein                             51.2    2e-05   
ref|WP_007793621.1|  hypothetical protein                             51.6    2e-05   
ref|WP_037123675.1|  hypothetical protein                             51.6    2e-05   
ref|WP_043351869.1|  MULTISPECIES: hypothetical protein               51.2    2e-05   
ref|WP_029073642.1|  hypothetical protein                             51.2    2e-05   
ref|XP_002631726.1|  Hypothetical protein CBG20928                    51.6    2e-05   
gb|KEI39834.1|  hypothetical protein L969DRAFT_86420                  52.8    2e-05   
dbj|GAA99211.1|  hypothetical protein E5Q_05904                       52.8    2e-05   
ref|WP_035210749.1|  hypothetical protein                             51.2    2e-05   
ref|WP_012255294.1|  hypothetical protein                             51.2    2e-05   
ref|WP_041802573.1|  hypothetical protein                             51.2    2e-05   
gb|ABV92509.1|  protein of unknown function DUF339                    51.2    2e-05   
ref|WP_014103151.1|  hypothetical protein                             50.8    2e-05   
ref|WP_034453382.1|  hypothetical protein                             51.2    2e-05   
ref|WP_037421826.1|  TPR repeat region superfamily                    51.2    2e-05   
ref|WP_008493117.1|  MULTISPECIES: hypothetical protein               50.8    2e-05   
ref|WP_024584040.1|  MULTISPECIES: hypothetical protein               50.8    2e-05   
ref|WP_010705251.1|  hypothetical protein                             50.8    2e-05   
ref|WP_011179345.1|  hypothetical protein                             50.8    2e-05   
gb|EGT44544.1|  hypothetical protein CAEBREN_00950                    51.6    2e-05   
ref|WP_038279068.1|  hypothetical protein                             50.8    2e-05   
ref|WP_039534725.1|  hypothetical protein                             50.8    2e-05   
ref|WP_026614161.1|  hypothetical protein                             51.2    2e-05   
ref|WP_036480515.1|  hypothetical protein                             50.8    2e-05   
ref|WP_007800425.1|  hypothetical protein                             51.2    2e-05   
ref|WP_009826537.1|  hypothetical protein                             50.8    2e-05   
ref|WP_004854339.1|  hypothetical protein                             50.8    2e-05   
ref|WP_007089584.1|  MULTISPECIES: hypothetical protein               50.8    3e-05   
ref|WP_036144270.1|  hypothetical protein                             50.4    3e-05   
ref|WP_038313540.1|  hypothetical protein                             50.8    3e-05   
ref|WP_023448693.1|  hypothetical protein                             50.8    3e-05   
ref|WP_011155503.1|  hypothetical protein                             50.8    3e-05   
gb|KIR50799.1|  succinate dehydrogenase assembly factor 2, mitoch...  52.4    3e-05   
ref|WP_027300063.1|  hypothetical protein                             50.8    3e-05   
ref|WP_044194008.1|  hypothetical protein                             50.8    3e-05   
ref|WP_005852390.1|  hypothetical protein                             50.8    3e-05   
ref|WP_007811944.1|  MULTISPECIES: hypothetical protein               50.8    3e-05   
ref|WP_005640084.1|  MULTISPECIES: hypothetical protein               50.8    3e-05   
ref|WP_025053552.1|  hypothetical protein                             50.4    3e-05   
ref|XP_628896.1|  DUF339 family protein                               51.6    3e-05   
ref|WP_023848143.1|  hypothetical protein                             50.4    3e-05   
ref|WP_018697917.1|  hypothetical protein                             50.8    3e-05   
ref|WP_010686821.1|  hypothetical protein                             50.8    3e-05   
ref|WP_027261509.1|  hypothetical protein                             50.4    3e-05   
ref|WP_040958210.1|  hypothetical protein                             50.8    3e-05   
ref|WP_024923861.1|  MULTISPECIES: hypothetical protein               50.8    3e-05   
ref|WP_016553969.1|  hypothetical protein                             50.8    3e-05   
ref|WP_017483961.1|  hypothetical protein                             50.8    3e-05   
gb|KIK25938.1|  hypothetical protein PISMIDRAFT_95861                 51.6    3e-05   
ref|WP_003599091.1|  hypothetical protein                             50.8    3e-05   
ref|WP_037441279.1|  hypothetical protein                             50.4    3e-05   
ref|WP_037447211.1|  hypothetical protein                             50.8    3e-05   
ref|WP_037943808.1|  MULTISPECIES: hypothetical protein               50.4    3e-05   
ref|WP_021081317.1|  hypothetical protein                             50.4    3e-05   
ref|WP_008884608.1|  hypothetical protein                             50.4    3e-05   
gb|KFZ38323.1|  hypothetical protein HR45_07505                       50.1    3e-05   
ref|XP_009309355.1|  hypothetical protein DQ04_01731100               51.2    3e-05   
gb|AGH98344.1|  hypothetical protein A11S_1538                        50.4    4e-05   
ref|XP_006679336.1|  hypothetical protein BATDEDRAFT_6694             50.4    4e-05   
ref|WP_024846893.1|  hypothetical protein                             50.4    4e-05   
ref|WP_015952345.1|  hypothetical protein                             50.4    4e-05   
ref|WP_022556310.1|  hypothetical protein                             50.4    4e-05   
ref|WP_007425281.1|  hypothetical protein                             50.4    4e-05   
ref|WP_038034113.1|  hypothetical protein                             50.4    4e-05   
ref|WP_007508938.1|  MULTISPECIES: hypothetical protein               50.1    4e-05   
ref|WP_007772205.1|  hypothetical protein                             50.4    4e-05   
ref|WP_008123080.1|  hypothetical protein                             50.1    4e-05   
ref|WP_027837476.1|  hypothetical protein                             50.1    4e-05   
ref|WP_026784256.1|  hypothetical protein                             50.1    4e-05   
dbj|GAM28519.1|  hypothetical protein SAMD00019534_116950             50.8    5e-05   
ref|WP_035915794.1|  hypothetical protein                             50.1    5e-05   
ref|WP_005982094.1|  hypothetical protein                             50.1    5e-05   
ref|WP_034993627.1|  hypothetical protein                             50.1    5e-05   
ref|WP_007082033.1|  hypothetical protein                             50.1    5e-05   
ref|XP_002393230.1|  hypothetical protein MPER_07073                  51.2    5e-05   
ref|WP_039970973.1|  hypothetical protein                             50.1    5e-05   
gb|EWY42092.1|  hypothetical protein N825_19480                       50.1    5e-05   
gb|EKE70918.1|  hypothetical protein P24_15284                        50.1    5e-05   
ref|WP_024900256.1|  hypothetical protein                             50.1    5e-05   
ref|WP_026364147.1|  MULTISPECIES: hypothetical protein               50.1    5e-05   
gb|EJK62450.1|  hypothetical protein THAOC_16942                      52.0    6e-05   
ref|WP_044054096.1|  hypothetical protein                             50.1    6e-05   
gb|KIJ61870.1|  hypothetical protein HYDPIDRAFT_115352                49.7    6e-05   
ref|WP_003508031.1|  hypothetical protein                             50.1    6e-05   
ref|WP_029582969.1|  hypothetical protein                             49.7    6e-05   
ref|WP_028136340.1|  hypothetical protein                             49.7    6e-05   
gb|EHL98668.1|  TPR repeat region                                     49.7    7e-05   
ref|WP_011539060.1|  hypothetical protein                             49.7    7e-05   
ref|NP_496607.1|  Protein Y57A10A.29                                  50.1    7e-05   
ref|WP_028346012.1|  hypothetical protein                             49.7    7e-05   
gb|EJK52391.1|  hypothetical protein THAOC_28337                      50.8    7e-05   
ref|XP_009498085.1|  hypothetical protein H696_06043                  51.2    7e-05   
ref|XP_007006146.1|  hypothetical protein TREMEDRAFT_63772            51.2    7e-05   
ref|WP_007628923.1|  hypothetical protein                             49.7    7e-05   
ref|WP_035614011.1|  hypothetical protein                             49.7    7e-05   
gb|KDQ06887.1|  hypothetical protein BOTBODRAFT_60352                 49.7    7e-05   
gb|AAV86950.1|  hypothetical protein AM1093                           50.1    7e-05   
dbj|BAQ46773.1|  hypothetical protein Maq22A_c18415                   49.7    8e-05   
ref|WP_007532637.1|  hypothetical protein                             49.7    8e-05   
gb|EIE52121.1|  TPR repeat-containing protein                         49.7    8e-05   
gb|KIN71660.1|  Sdh5 domain containing protein                        49.7    8e-05   
ref|WP_040708009.1|  hypothetical protein                             49.3    8e-05   
ref|XP_007848704.1|  mitochondrion protein                            50.8    8e-05   
ref|WP_024072451.1|  hypothetical protein                             49.3    9e-05   
ref|WP_040325628.1|  hypothetical protein                             49.7    9e-05   
ref|WP_037092537.1|  hypothetical protein                             49.7    9e-05   
ref|WP_043949018.1|  hypothetical protein                             49.7    9e-05   
gb|EKJ95360.1|  hypothetical protein C241_13342                       49.7    9e-05   
ref|WP_015398061.1|  hypothetical protein                             49.3    9e-05   
ref|XP_002288751.1|  predicted protein                                49.3    9e-05   
gb|EKD54979.1|  hypothetical protein ACD_60C00029G0006                49.3    9e-05   
ref|XP_003191419.1|  mitochondrion protein                            50.8    1e-04   
ref|XP_002426595.1|  early meiotic induction protein 5, putative      50.1    1e-04   
ref|WP_034441510.1|  hypothetical protein                             49.3    1e-04   
ref|WP_008386379.1|  hypothetical protein                             49.3    1e-04   
ref|WP_037178303.1|  hypothetical protein                             49.3    1e-04   



>ref|XP_011073284.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Sesamum indicum]
Length=179

 Score =   258 bits (660),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = +3

Query  42   MAITRRSLVSSFARILL-NPTNQTSPIPSNRPLLGSFSRLCSSN-----LGIDLSDEEAK  203
            MA  RR+L S+  RI+  N    TSP   +RP+LGSF+R  ++N     L IDLS+EE+K
Sbjct  1    MASLRRALFSTVTRIISSNRIWPTSPQSLHRPILGSFARSYTANESAQSLDIDLSNEESK  60

Query  204  RRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQ  383
            RRL NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIK+LVHVLD+ENPDLWKWLTGQ
Sbjct  61   RRLFNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKSLVHVLDLENPDLWKWLTGQ  120

Query  384  EPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            E  P+ +  NPVF SV  ++ NNLD HAAPETRAT GQSWVRGWDDFKRGRDSPIAGNQ
Sbjct  121  EQPPEAVNANPVFASVKERVTNNLDNHAAPETRATPGQSWVRGWDDFKRGRDSPIAGNQ  179



>ref|XP_004235854.1| PREDICTED: uncharacterized protein LOC101244854 [Solanum lycopersicum]
Length=184

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 143/184 (78%), Gaps = 11/184 (6%)
 Frame = +3

Query  42   MAITRRSLVSSFARIL---LNPTNQTSPIPSN---RPLLGSFSRLCSSN-----LGIDLS  188
            MA  RR+L+ +  RI+      +  TS + S+   RPL G+FSR  SSN     + IDLS
Sbjct  1    MANLRRALLFTIPRIINSSKTASVATSTLQSHNLYRPLAGTFSRFISSNETSSPMNIDLS  60

Query  189  DEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWK  368
            DEE+KRRL NRL+YRSKQRGYLELDL+LGKWVE+HI SMDE GIK+LVHVLD+ENPDLWK
Sbjct  61   DEESKRRLFNRLIYRSKQRGYLELDLVLGKWVEEHIQSMDENGIKSLVHVLDLENPDLWK  120

Query  369  WLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPI  548
            WLTGQE  PD I TNPVF++VH K+MNNL+ H +PETRA  G+ WVRGWDD KRGRD+PI
Sbjct  121  WLTGQEQPPDAISTNPVFSAVHEKVMNNLNNHTSPETRAVPGKPWVRGWDDIKRGRDAPI  180

Query  549  AGNQ  560
            AGNQ
Sbjct  181  AGNQ  184



>gb|EYU21765.1| hypothetical protein MIMGU_mgv1a014754mg [Erythranthe guttata]
Length=179

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 144/180 (80%), Gaps = 8/180 (4%)
 Frame = +3

Query  42   MAITRRSLVSSFARIL-LNPTNQTS-PIPSNRPLLGSFSRLCSSN-----LGIDLSDEEA  200
            MA  RR+L+S+  RIL  NPT+  + P   +RP+L SFSRL S+N     + IDLS EE+
Sbjct  1    MASLRRALLSTVPRILSTNPTSSAATPQSLHRPILSSFSRLYSTNQSTQSVDIDLSTEES  60

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            +RRL NRLLYRSKQRGYLELDL+LGKWVEDHI SMDE+GIK+LVHVLD+ENPDLW WLTG
Sbjct  61   RRRLHNRLLYRSKQRGYLELDLVLGKWVEDHIQSMDESGIKSLVHVLDLENPDLWNWLTG  120

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            QE  P+ +  NPVF +V  K+  NL+K +AP+TRATTGQSWVRGWDD K+GRDSPIAGNQ
Sbjct  121  QEQPPEAVNVNPVFVAVREKVAKNLEK-SAPQTRATTGQSWVRGWDDVKKGRDSPIAGNQ  179



>emb|CDO98294.1| unnamed protein product [Coffea canephora]
Length=181

 Score =   238 bits (607),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 139/182 (76%), Gaps = 10/182 (5%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-------RPLLGSFSRLCSSN--LGIDLSDE  194
            MA  RR+L+ +  RIL N +NQTS   S        RP+LGS     SSN  L IDLS+E
Sbjct  1    MANLRRALLFTIPRIL-NSSNQTSIATSTMSSHNIYRPILGSLPCFYSSNQALNIDLSNE  59

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            E+KRRL NRLLYRS+QRG+LELDLILG+WVEDHIHSMDE GIKALVHVLD+ENPDLWKWL
Sbjct  60   ESKRRLFNRLLYRSRQRGFLELDLILGRWVEDHIHSMDENGIKALVHVLDLENPDLWKWL  119

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAG  554
            TGQ   P+ +R NPVF  V  +++NNL+ HA+PETRAT GQ WVRGWDDFK+GRD P  G
Sbjct  120  TGQGQPPEAVRMNPVFADVQKRVVNNLNSHASPETRATPGQPWVRGWDDFKKGRDGPAVG  179

Query  555  NQ  560
            NQ
Sbjct  180  NQ  181



>ref|XP_006341465.1| PREDICTED: uncharacterized protein LOC102604677 [Solanum tuberosum]
Length=184

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 141/184 (77%), Gaps = 11/184 (6%)
 Frame = +3

Query  42   MAITRRSLVSSFARIL---LNPTNQTSPIPSN---RPLLGSFSRLCSSN-----LGIDLS  188
            M   RR+L+ +  RI+      +  TS + S+   RPL G+FSR  SSN     + ID S
Sbjct  1    MENLRRALLFTIPRIINSSKTASVATSTLQSHNLYRPLAGTFSRFISSNETSSPINIDFS  60

Query  189  DEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWK  368
            DEE+KRRL NRL+YRSKQRGYLELDL+LGKWVE+HI SMDE GIK+LVHVLD+ENPDLWK
Sbjct  61   DEESKRRLFNRLIYRSKQRGYLELDLVLGKWVEEHIQSMDENGIKSLVHVLDLENPDLWK  120

Query  369  WLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPI  548
            WLTGQE  PD I TNPVF++V  K+MNNL+ H++PETRA  G+ WVRGWDD K+GRD+PI
Sbjct  121  WLTGQEQPPDAISTNPVFSAVREKVMNNLNNHSSPETRAVPGKPWVRGWDDIKKGRDAPI  180

Query  549  AGNQ  560
            AGNQ
Sbjct  181  AGNQ  184



>ref|XP_011082843.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=177

 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 143/179 (80%), Gaps = 8/179 (4%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPS-NRPLLGSFSRLCSSN-----LGIDLSDEEAK  203
            MA  RR+L S+  RIL   +++TS + + +RP+LGSF R  SSN     + IDLS+EE+K
Sbjct  1    MASFRRALFSTVPRIL--SSSRTSAVAALHRPVLGSFWRFYSSNESNQSVDIDLSNEESK  58

Query  204  RRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQ  383
            RRL NRLLYRSKQRG+LELDLILGKWVEDHIHSMDE+GI++LVHVLD+ENPDLWKWLT Q
Sbjct  59   RRLFNRLLYRSKQRGFLELDLILGKWVEDHIHSMDESGIRSLVHVLDLENPDLWKWLTCQ  118

Query  384  EPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
               P+ ++ N VF ++  K+++NLD HAAPETRAT GQ WVRGWDDFK+GRD PI GNQ
Sbjct  119  GQPPEAVKKNLVFMALRAKVVSNLDNHAAPETRATPGQPWVRGWDDFKKGRDGPITGNQ  177



>ref|XP_007038172.1| Uncharacterized protein TCM_014776 [Theobroma cacao]
 gb|EOY22673.1| Uncharacterized protein TCM_014776 [Theobroma cacao]
Length=178

 Score =   228 bits (580),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 136/179 (76%), Gaps = 7/179 (4%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLCSSN------LGIDLSDEEAK  203
            MA  RR+L+++  RIL + T  +      RP  G  SR  S+N      L IDLS EE+K
Sbjct  1    MATLRRALLNAH-RILNSSTVPSRTTIVIRPQYGWVSRFSSTNISNTQPLDIDLSSEESK  59

Query  204  RRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQ  383
            RRL NRLLYRSKQRG+LELDL+LGKWVE+HI+SMDE GIKALVHVLD+ENPDLWKWLTGQ
Sbjct  60   RRLFNRLLYRSKQRGFLELDLVLGKWVEEHIYSMDENGIKALVHVLDLENPDLWKWLTGQ  119

Query  384  EPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            E  P+ +  NPVF++V  K++ NL+ H+APETRAT GQ WVRGWDD K+GRDSPI GNQ
Sbjct  120  EQPPETVSINPVFSTVQEKVLKNLNSHSAPETRATPGQPWVRGWDDIKKGRDSPITGNQ  178



>ref|XP_006281168.1| hypothetical protein CARUB_v10027202mg [Capsella rubella]
 gb|EOA14066.1| hypothetical protein CARUB_v10027202mg [Capsella rubella]
Length=185

 Score =   221 bits (564),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 135/173 (78%), Gaps = 2/173 (1%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSP-IPSNRPLLGS-FSRLCSSNLGIDLSDEEAKRRLVNR  221
            I R + V   + ++  P+NQT P I  N   LG+ F  +   N  IDLS+EE KRR +NR
Sbjct  13   IIRSTAVIGRSSVIPTPSNQTYPVIFRNGVDLGTRFFCVSPQNFDIDLSNEENKRRTINR  72

Query  222  LLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDG  401
            LLYRSKQRG+LELDL+LG WVE+++ SMDE+G+K+L+HVL++ENPDLWKWLT QE  P+ 
Sbjct  73   LLYRSKQRGFLELDLVLGNWVEENVKSMDESGVKSLIHVLNLENPDLWKWLTEQEQPPEA  132

Query  402  IRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            + +NPVF+++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  133  VSSNPVFSALHEKVMKNLNKHAAPETRAAAGQPWVKGWDDFKRGRDAPISGNQ  185



>ref|XP_004300377.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=178

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 132/180 (73%), Gaps = 9/180 (5%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-RPLLGS------FSRLCSSNLGIDLSDEEA  200
            MA  RR+L+S  A   L  +N  SP  +  RP   S      +S   SSNL IDLS+EE+
Sbjct  1    MASLRRALIS--AHRALKSSNSISPTQTLLRPQYSSGLVQRSYSTDNSSNLNIDLSNEES  58

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            KRRL NRLLYRSKQRG+LELDL+LGKWVEDHIHSMDE+GIKALV VLDVENPDLWKWL+G
Sbjct  59   KRRLCNRLLYRSKQRGFLELDLVLGKWVEDHIHSMDESGIKALVDVLDVENPDLWKWLSG  118

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            QE  P  + TNPVFT+V  K+  NLD +AAPETRAT G  WVRGWDD K+ +  PI GNQ
Sbjct  119  QEQPPQALITNPVFTAVRNKVTKNLDSYAAPETRATPGNPWVRGWDDIKKYKGGPITGNQ  178



>ref|XP_009786126.1| PREDICTED: uncharacterized protein LOC104234290 [Nicotiana sylvestris]
Length=182

 Score =   221 bits (562),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 136/182 (75%), Gaps = 9/182 (5%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPS--NRPLLGSFSRLCSSN-----LGIDLSDEEA  200
            MA  RR+L+ +  RI    +   S +PS  + PL G+FSR  +S      + IDLS+EE+
Sbjct  1    MANLRRALLFTIPRIHQRTSVANSALPSLYSPPLAGTFSRFFTSKENCGPIDIDLSNEES  60

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            KRRL NRL Y+SKQRG+LELDL+LGKWVEDHI SMDE G+K+LV+VLD+ENPDLWKWL+G
Sbjct  61   KRRLFNRLHYQSKQRGFLELDLVLGKWVEDHIRSMDEDGVKSLVNVLDLENPDLWKWLSG  120

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ--SWVRGWDDFKRGRDSPIAG  554
            QE  PD I TN VF++V  K+MNNL KHAAPETRA  G    WVRGWDDFK+ +D PIAG
Sbjct  121  QEQPPDAISTNSVFSAVREKVMNNLGKHAAPETRAAAGSLGPWVRGWDDFKKAQDGPIAG  180

Query  555  NQ  560
            NQ
Sbjct  181  NQ  182



>emb|CBI35625.3| unnamed protein product [Vitis vinifera]
Length=174

 Score =   219 bits (558),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 123/154 (80%), Gaps = 5/154 (3%)
 Frame = +3

Query  99   TNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGK  278
             + TSPIPS   L+ S       +  IDLS+EE+KRRL NRLLYRSKQRG+LELDL+LGK
Sbjct  26   VSATSPIPSETTLVPSIH-----SPEIDLSNEESKRRLFNRLLYRSKQRGFLELDLVLGK  80

Query  279  WVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLD  458
            WVE+HIHSMD  GIK+LVHVLD+ENPDLWKWLTGQE  P+ +  NPVF +V  K+MNNL+
Sbjct  81   WVEEHIHSMDHNGIKSLVHVLDLENPDLWKWLTGQEQPPEAVSINPVFCAVREKVMNNLN  140

Query  459  KHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             H+APETRA  G+ WVRGWDD K+GRDSP++GNQ
Sbjct  141  SHSAPETRAMPGKPWVRGWDDIKKGRDSPVSGNQ  174



>ref|XP_009373661.1| PREDICTED: uncharacterized protein LOC103962643 [Pyrus x bretschneideri]
Length=178

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 134/180 (74%), Gaps = 9/180 (5%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-RPLLG------SFSRLCSSNLGIDLSDEEA  200
            M   RRSL+S      L  T   SP  ++ RP  G      S+S    SNL IDLS++E+
Sbjct  1    MGSLRRSLIS--LHRALKSTASVSPAETHLRPQFGYGLVQRSYSANNGSNLDIDLSNQES  58

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            KRRL NRL+YRSKQRG+LELDL+LGKWVE+HIHSMDE GIK+LV VLD+ENPDLWKWL+G
Sbjct  59   KRRLFNRLIYRSKQRGFLELDLVLGKWVEEHIHSMDEQGIKSLVDVLDLENPDLWKWLSG  118

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            QE  P+ ++TNPVFT+V  KIMNNL+ +A+PETRAT GQ WVRGWDD K+ +  P+ GNQ
Sbjct  119  QEQPPEALQTNPVFTAVRNKIMNNLNSYASPETRATPGQPWVRGWDDIKKSQGGPLTGNQ  178



>gb|KHG15768.1| Succinate dehydrogenase assembly factor 2, mitochondrial [Gossypium 
arboreum]
Length=198

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 120/150 (80%), Gaps = 6/150 (4%)
 Frame = +3

Query  129  RPLLGSFSRLCSSN------LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVED  290
            RP  G  S   S+N      L IDLS+EE+KRRL NRLLYRSKQRG+LELDL+LGKWVE+
Sbjct  49   RPQYGWVSTYFSTNISNTQPLNIDLSNEESKRRLYNRLLYRSKQRGFLELDLVLGKWVEE  108

Query  291  HIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAA  470
            HIHSMDE GIKALV VLD+ENPDLWKWLTGQE  P+ +  NPVF++V  +++ NL+ H++
Sbjct  109  HIHSMDENGIKALVKVLDLENPDLWKWLTGQEQPPEAVTVNPVFSAVQQRVLKNLNNHSS  168

Query  471  PETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            PETRAT GQ WVRGWDD K+GRDSPI GNQ
Sbjct  169  PETRATPGQPWVRGWDDIKKGRDSPITGNQ  198



>ref|XP_010555590.1| PREDICTED: uncharacterized protein LOC104825042 [Tarenaya hassleriana]
Length=187

 Score =   218 bits (556),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  168  NLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDV  347
            N  IDLS++E++RRL NRLLYRSKQRG+LELDL+LG WVE++I SMDE G+KAL+HVLD+
Sbjct  57   NFDIDLSNDESRRRLFNRLLYRSKQRGFLELDLVLGNWVEENIGSMDENGVKALIHVLDL  116

Query  348  ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFK  527
            ENPDLWKWLT QE AP+ +RTNPVF+++H K+M NL+KHAAPETRA  GQ WV+GWDDFK
Sbjct  117  ENPDLWKWLTDQEQAPEAVRTNPVFSALHDKVMKNLNKHAAPETRAVPGQPWVKGWDDFK  176

Query  528  RGRDSPIAGNQ  560
            +GRD+PIAGNQ
Sbjct  177  KGRDAPIAGNQ  187



>gb|KFK36749.1| hypothetical protein AALP_AA4G165000 [Arabis alpina]
Length=187

 Score =   218 bits (556),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 4/175 (2%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSF----SRLCSSNLGIDLSDEEAKRRLV  215
            I R + V   + +  + + + SPI  NR  LG+     + L   N  IDLS+EE KR  +
Sbjct  13   IIRSAAVVGRSSVTPSVSTRASPISRNRVDLGARFFCGNTLTPQNFDIDLSNEENKRITI  72

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
            NRLLYRSKQRG+LELDL+LG WVE++++SMDET +K+L+HVLD+ENPDLWKWLT QE  P
Sbjct  73   NRLLYRSKQRGFLELDLVLGNWVEENVNSMDETTVKSLIHVLDLENPDLWKWLTDQEQPP  132

Query  396  DGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            + + +NPVF+++H K+M NL+KHAAPETRA  GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  133  EAVSSNPVFSALHEKVMKNLNKHAAPETRAAAGQPWVRGWDDFKRGRDAPISGNQ  187



>ref|XP_008392686.1| PREDICTED: uncharacterized protein LOC103454872 [Malus domestica]
Length=178

 Score =   218 bits (555),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 134/180 (74%), Gaps = 9/180 (5%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-RPLLG------SFSRLCSSNLGIDLSDEEA  200
            M   RRSL+S      L  T   SP  ++ RP  G      S+S    SNL IDLS++E+
Sbjct  1    MGSLRRSLISLHR--ALKSTASISPAETHLRPQFGYGLVQRSYSANNGSNLDIDLSNQES  58

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            KRRLVNRL+YRSKQRG+LELDL+LGKWVE+HIHSMDE GIK+LV VLD+ENPDLWKWL+G
Sbjct  59   KRRLVNRLIYRSKQRGFLELDLVLGKWVEEHIHSMDERGIKSLVDVLDLENPDLWKWLSG  118

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            QE  P+ ++TNPVFT+V  KI NNL+ +AAPETRAT GQ WVRGWDD K+ +  P+ GNQ
Sbjct  119  QEQPPEALQTNPVFTAVRNKIXNNLNSYAAPETRATPGQPWVRGWDDIKKSQGGPLTGNQ  178



>gb|KJB07930.1| hypothetical protein B456_001G053700 [Gossypium raimondii]
Length=178

 Score =   218 bits (554),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 121/150 (81%), Gaps = 6/150 (4%)
 Frame = +3

Query  129  RPLLGSFSRLCSSN------LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVED  290
            RP  G  S   S+N      L IDLS+EE+KRRL NRLLYRSKQRG+LELDL+LGKWVE+
Sbjct  29   RPQYGWVSTYFSTNISNTQPLNIDLSNEESKRRLYNRLLYRSKQRGFLELDLVLGKWVEE  88

Query  291  HIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAA  470
            HIHSMDE GIKALV+VLD+ENPDLWKWLTGQE  P+ +  NPVF++V  K++ NL+ H++
Sbjct  89   HIHSMDENGIKALVNVLDLENPDLWKWLTGQEQPPEAVTINPVFSAVQQKVLKNLNNHSS  148

Query  471  PETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            PETRAT G+ WVRGWDD K+GRDSPI GNQ
Sbjct  149  PETRATRGRPWVRGWDDIKKGRDSPITGNQ  178



>gb|KDO57641.1| hypothetical protein CISIN_1g039261mg [Citrus sinensis]
Length=182

 Score =   217 bits (553),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
             + +L IDLS++E K+RL NRLLYRSKQRG+LELDL+LGKWVE+HIHSMDE GIKALV V
Sbjct  49   TTQSLDIDLSNDEKKKRLFNRLLYRSKQRGFLELDLVLGKWVEEHIHSMDENGIKALVDV  108

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            L++ENPDLWKWLTGQE  P+ ++TNPVF+++H K+MNNL+ +A+PETR+  GQ WVRGWD
Sbjct  109  LNLENPDLWKWLTGQEQPPEAVKTNPVFSALHNKVMNNLNSYASPETRSEPGQPWVRGWD  168

Query  519  DFKRGRDSPIAGNQ  560
            DFK+GRDSP++GNQ
Sbjct  169  DFKKGRDSPLSGNQ  182



>ref|XP_006436982.1| hypothetical protein CICLE_v10032866mg [Citrus clementina]
 ref|XP_006485065.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
[Citrus sinensis]
 gb|ESR50222.1| hypothetical protein CICLE_v10032866mg [Citrus clementina]
Length=182

 Score =   217 bits (553),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
             + +L IDLS+EE K+RL NRLLYRSKQRG+LELDL+LGKWVE+HIHSMD+ GIKALV V
Sbjct  49   TTQSLDIDLSNEEKKKRLFNRLLYRSKQRGFLELDLVLGKWVEEHIHSMDKNGIKALVDV  108

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            L++ENPDLWKWLTGQE  P+ ++TNPVF+++H K+MNNL+ +A+PETR+  GQ WVRGWD
Sbjct  109  LNLENPDLWKWLTGQEQPPEAVKTNPVFSALHNKVMNNLNSYASPETRSEPGQPWVRGWD  168

Query  519  DFKRGRDSPIAGNQ  560
            DFK+GRDSP++GNQ
Sbjct  169  DFKKGRDSPLSGNQ  182



>ref|XP_007209673.1| hypothetical protein PRUPE_ppa012247mg [Prunus persica]
 gb|EMJ10872.1| hypothetical protein PRUPE_ppa012247mg [Prunus persica]
Length=178

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 133/180 (74%), Gaps = 9/180 (5%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-RPLLG------SFSRLCSSNLGIDLSDEEA  200
            M   RRSL+S      L   N  SP  +  RP  G      S+S   +SNL IDLS++E+
Sbjct  1    MGSLRRSLISLHR--ALKSGNSISPTETLLRPQYGYGLVQRSYSIGTTSNLDIDLSNQES  58

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            KRRL NRL+YRSKQRG+LELDL+LGKWVE+HIHSMDE GIK+LV VLD+ENP LWKWL G
Sbjct  59   KRRLFNRLIYRSKQRGFLELDLVLGKWVEEHIHSMDENGIKSLVDVLDLENPYLWKWLIG  118

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            QE  P+ ++TNPVFT+V  K++NNL+ +AAPETRAT GQ WVRGWDD K+G+  PI GNQ
Sbjct  119  QEQPPEALKTNPVFTAVRNKVLNNLNSYAAPETRATPGQPWVRGWDDIKKGQGGPITGNQ  178



>ref|XP_002322310.1| hypothetical protein POPTR_0015s11970g [Populus trichocarpa]
 gb|EEF06437.1| hypothetical protein POPTR_0015s11970g [Populus trichocarpa]
Length=186

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 132/184 (72%), Gaps = 13/184 (7%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSNRPL---LGSFSRLCSSN--------LGIDLS  188
            MA  RR+LV+     +LN T  T+ I    PL    G FSR  + N        L  +LS
Sbjct  5    MASLRRALVT--VHRILNSTTTTNHISVTSPLRSQYGLFSRYSTLNKNDNKKPSLDFELS  62

Query  189  DEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWK  368
            +EE+KRRL NRLLYRS+QRG+LELDL+LGKWVE+HI+SMDE G+KAL+ VLD+ENPDLWK
Sbjct  63   NEESKRRLCNRLLYRSRQRGFLELDLVLGKWVEEHIYSMDENGVKALIDVLDLENPDLWK  122

Query  369  WLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPI  548
            WLTGQE  P+ +  NPVF++V  KIMNNL  HAAPETRA  GQ WVRGWDD K+   SP+
Sbjct  123  WLTGQEQPPEAVSINPVFSAVRDKIMNNLSSHAAPETRAIPGQPWVRGWDDIKKSAGSPV  182

Query  549  AGNQ  560
            AGNQ
Sbjct  183  AGNQ  186



>ref|XP_010646726.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Vitis vinifera]
Length=187

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 126/162 (78%), Gaps = 8/162 (5%)
 Frame = +3

Query  99   TNQTSPIPSNRPLLGS--FSRLCS------SNLGIDLSDEEAKRRLVNRLLYRSKQRGYL  254
             + TSPIPS   L+    F+ +C        +  IDLS+EE+KRRL NRLLYRSKQRG+L
Sbjct  26   VSATSPIPSETTLVPRPRFNWICGFSSDSIHSPEIDLSNEESKRRLFNRLLYRSKQRGFL  85

Query  255  ELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVH  434
            ELDL+LGKWVE+HIHSMD  GIK+LVHVLD+ENPDLWKWLTGQE  P+ +  NPVF +V 
Sbjct  86   ELDLVLGKWVEEHIHSMDHNGIKSLVHVLDLENPDLWKWLTGQEQPPEAVSINPVFCAVR  145

Query  435  TKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             K+MNNL+ H+APETRA  G+ WVRGWDD K+GRDSP++GNQ
Sbjct  146  EKVMNNLNSHSAPETRAMPGKPWVRGWDDIKKGRDSPVSGNQ  187



>ref|XP_003602736.1| Succinate dehydrogenase assembly factor [Medicago truncatula]
 gb|AES72987.1| flavinator of succinate dehydrogenase [Medicago truncatula]
Length=176

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNP---TNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDEEAKRRL  212
            MA  R+++++    I  N    T+ T P    RP    F+    S + I+LS+EE+KRRL
Sbjct  1    MATIRKAVINVHRLINSNKSIITSSTKPFLHFRPPFAPFTSQSQSPVVINLSNEESKRRL  60

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
             NRLLYRSKQRG+LELDL+LGKWVED+IH +DE  IKAL+HVLD+ENPDLWKW++GQE  
Sbjct  61   FNRLLYRSKQRGFLELDLVLGKWVEDNIHKLDENRIKALIHVLDLENPDLWKWISGQEQP  120

Query  393  PDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            P+ +  NPVF ++  K+M NLD H+APETRAT GQ WVRGWDD K+GRD+P +GNQ
Sbjct  121  PESVDVNPVFAALRGKVMKNLDSHSAPETRATLGQPWVRGWDDIKKGRDAPASGNQ  176



>ref|XP_008441916.1| PREDICTED: uncharacterized protein LOC103485912 [Cucumis melo]
 ref|XP_008441917.1| PREDICTED: uncharacterized protein LOC103485912 [Cucumis melo]
Length=200

 Score =   216 bits (549),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
             S+N  IDLS+E++KR+L NRLLYRSKQRG+LELDLILGKWVEDHIHS+D  GI+ L++V
Sbjct  67   TSTNPDIDLSNEDSKRQLFNRLLYRSKQRGFLELDLILGKWVEDHIHSLDADGIRDLINV  126

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            LD+ENPDLWKWLTGQE  P+ ++TNPVFT V  K+MNNL+KHA+PETR   GQ WVRGWD
Sbjct  127  LDLENPDLWKWLTGQEQPPEALKTNPVFTGVKEKVMNNLNKHASPETRTPPGQQWVRGWD  186

Query  519  DFKRGRDSPIAGNQ  560
            DFK+GRD PI GNQ
Sbjct  187  DFKKGRDGPITGNQ  200



>ref|NP_199917.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
 sp|Q9FI44.1|SDAF2_ARATH RecName: Full=Succinate dehydrogenase assembly factor 2, mitochondrial; 
Short=SDH assembly factor 2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08750.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABF58960.1| At5g51040 [Arabidopsis thaliana]
 dbj|BAF01071.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96024.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
Length=188

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 5/176 (3%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLC-----SSNLGIDLSDEEAKRRL  212
            I R + V   + I+    N++ PI     +       C     + N  IDLS+EE KRR 
Sbjct  13   IIRSTAVVGRSSIIPAAANRSYPIIFRNGVDLGARFFCENTASAQNFDIDLSNEENKRRT  72

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            +NRLLYRSKQRG+LELDL+LG WVE++++SMDE G+K+L+HVL++ENPDLWKWLT QE  
Sbjct  73   INRLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKWLTEQEQP  132

Query  393  PDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            P+ + +NPVF+++H K+M NL+KHAAPETRA  GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  133  PEAVSSNPVFSALHEKVMKNLNKHAAPETRAAAGQPWVRGWDDFKRGRDAPISGNQ  188



>gb|AAM64715.1| unknown [Arabidopsis thaliana]
Length=188

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 5/176 (3%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLC-----SSNLGIDLSDEEAKRRL  212
            I R + V   + I+    N++ PI     +       C     + N  IDLS+EE KRR 
Sbjct  13   IIRSTAVVGRSSIIPAAANRSYPIIFRNGVDLGARFFCENTASAQNFDIDLSNEENKRRT  72

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            +NRLLYRSKQRG+LELDL+LG WVE++++SMDE G+K+L+HVL++ENPDLWKWLT QE  
Sbjct  73   INRLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKWLTEQEQP  132

Query  393  PDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            P+ + +NPVF+++H K+M NL+KHAAPETRA  GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  133  PEAVSSNPVFSALHEKVMKNLNKHAAPETRAAAGQPWVRGWDDFKRGRDTPISGNQ  188



>ref|XP_010482431.1| PREDICTED: uncharacterized protein LOC104761094 [Camelina sativa]
Length=185

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 133/173 (77%), Gaps = 2/173 (1%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSPIP-SNRPLLGS-FSRLCSSNLGIDLSDEEAKRRLVNR  221
            I R + V   + ++   TN+T P+   N   LG+ F  +   N  IDLS+EE KRR +NR
Sbjct  13   IIRSTAVVGRSSVIPTATNRTYPVHFRNGVDLGTRFFCVSPQNFDIDLSNEENKRRTINR  72

Query  222  LLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDG  401
            LLYRSKQRG+LELDL+LG WVE+++ SMDE+G+++L+HVL++ENPDLW WLT QE  P+ 
Sbjct  73   LLYRSKQRGFLELDLVLGNWVEENVKSMDESGVQSLIHVLNLENPDLWNWLTEQEQPPEA  132

Query  402  IRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            + +NPVF+++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  133  VSSNPVFSALHEKVMKNLNKHAAPETRAAAGQPWVKGWDDFKRGRDAPISGNQ  185



>ref|XP_004152841.1| PREDICTED: uncharacterized protein LOC101212517 [Cucumis sativus]
 ref|XP_004170864.1| PREDICTED: uncharacterized LOC101212517 [Cucumis sativus]
Length=198

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 120/144 (83%), Gaps = 4/144 (3%)
 Frame = +3

Query  141  GSFSRL----CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMD  308
            G FS +     S+N  IDLS+E++KR+L NRLLYRSKQRG+LELDLILGKWVEDHIHS+D
Sbjct  55   GCFSSVHFSSTSTNPDIDLSNEDSKRQLFNRLLYRSKQRGFLELDLILGKWVEDHIHSLD  114

Query  309  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  488
              GI+AL++VLD+ENPDLWKWLTGQE  P+ ++TNPVFT V  K+++NL+KHA+PETR  
Sbjct  115  ADGIRALINVLDLENPDLWKWLTGQEQPPEALKTNPVFTGVKEKVIDNLNKHASPETRTP  174

Query  489  TGQSWVRGWDDFKRGRDSPIAGNQ  560
             GQ WVRGWDDFK+GRD PI GNQ
Sbjct  175  PGQQWVRGWDDFKKGRDGPITGNQ  198



>ref|XP_002511076.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51678.1| conserved hypothetical protein [Ricinus communis]
Length=188

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 132/187 (71%), Gaps = 14/187 (7%)
 Frame = +3

Query  33   RKTMAITRRSLVSSF-----ARILLNPTNQTSPIPSNRPLLGSFSRLCSSN------LGI  179
            R+ +   RR L SS      + + L+ T   SP    R   G F+R  + N      L I
Sbjct  5    RRAVINARRVLNSSATPNGSSIVSLSSTRIKSPF---RSRYGWFARYSTVNDNDARALDI  61

Query  180  DLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPD  359
            DLS++E+KRRL NRLLYRS+QRG+LELDL+LGKWVE HIHSMDE GIKALVHVLD+ENPD
Sbjct  62   DLSNDESKRRLFNRLLYRSRQRGFLELDLVLGKWVEGHIHSMDENGIKALVHVLDLENPD  121

Query  360  LWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRD  539
            LWKWLTGQE  P+ +  NPVF++V  KIMNNLD HA+PETRA  GQ WVRGWDD K+   
Sbjct  122  LWKWLTGQEQPPEAVNINPVFSAVRDKIMNNLDSHASPETRAIPGQPWVRGWDDIKKNPG  181

Query  540  SPIAGNQ  560
            SP+ GNQ
Sbjct  182  SPVGGNQ  188



>dbj|BAJ53118.1| JHL07K02.8 [Jatropha curcas]
 gb|KDP22524.1| hypothetical protein JCGZ_26355 [Jatropha curcas]
Length=188

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 134/189 (71%), Gaps = 17/189 (9%)
 Frame = +3

Query  42   MAITRRSLVSSFARIL-------------LNPTNQTSPIPSNRPLLGSFSRLCSS---NL  173
            MA  R++LVS+  R+L             L P    +P  S    L  +S +  S   +L
Sbjct  1    MASLRKALVSAH-RVLNYSATLSRSSIATLPPIGGRTPFRSQYGWLSPYSTVNDSETRSL  59

Query  174  GIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVEN  353
             IDLS EE+KRRL NRLLYRSKQRG+LELDL+LGKWVE+HI SMDE GIKALVH+LD+EN
Sbjct  60   DIDLSSEESKRRLFNRLLYRSKQRGFLELDLVLGKWVEEHISSMDENGIKALVHLLDLEN  119

Query  354  PDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRG  533
            PDLWKWLT QE  P+ + TNPVF++V  K+MNNL++HAAPETRA  GQ WVRGWDD K+ 
Sbjct  120  PDLWKWLTCQEQPPEAVSTNPVFSAVRDKVMNNLNRHAAPETRAIPGQPWVRGWDDIKKS  179

Query  534  RDSPIAGNQ  560
              SP+AGNQ
Sbjct  180  PGSPVAGNQ  188



>gb|KHG14755.1| Succinate dehydrogenase assembly factor 2, mitochondrial [Gossypium 
arboreum]
Length=178

 Score =   214 bits (544),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 120/150 (80%), Gaps = 6/150 (4%)
 Frame = +3

Query  129  RPLLGSFSRLCSSN------LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVED  290
            RP  G  S   S+N      L IDLS+EE+KRRL NRLLYRSKQRG+LELDL+LGKWVE+
Sbjct  29   RPQYGWVSTYFSTNISNTQPLNIDLSNEESKRRLYNRLLYRSKQRGFLELDLVLGKWVEE  88

Query  291  HIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAA  470
            HIHSMDE GIKALV+VLD+ENPDLWKWLTGQE  P+ +  NPVF++V  K++ NL+ H++
Sbjct  89   HIHSMDENGIKALVNVLDLENPDLWKWLTGQEQPPEAVTLNPVFSAVQQKVLKNLNNHSS  148

Query  471  PETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             ETRAT G+ WVRGWDD K+GRDSPI GNQ
Sbjct  149  LETRATPGRPWVRGWDDIKKGRDSPITGNQ  178



>emb|CDY16340.1| BnaA02g11440D [Brassica napus]
Length=181

 Score =   213 bits (542),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 130/178 (73%), Gaps = 13/178 (7%)
 Frame = +3

Query  33   RKTMAITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLCSS--NLGIDLSDEEAKR  206
            R T  + R S+  S A           PI  N   LG+    CSS  N  IDLS+EE KR
Sbjct  15   RSTAVVRRCSVTPSVA----------PPIFQNGVDLGA-RFFCSSPQNFDIDLSNEEKKR  63

Query  207  RLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQE  386
              +NRLLYRSKQRG+LELDL+LG WVE++++SMDET +K+L+HVLD+ENPDLWKWLT QE
Sbjct  64   ITINRLLYRSKQRGFLELDLVLGNWVEENVNSMDETAVKSLIHVLDLENPDLWKWLTAQE  123

Query  387  PAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
              P+ + +NPVF ++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  124  QPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAAAGQPWVKGWDDFKRGRDAPISGNQ  181



>ref|XP_002864092.1| hypothetical protein ARALYDRAFT_495170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40351.1| hypothetical protein ARALYDRAFT_495170 [Arabidopsis lyrata subsp. 
lyrata]
Length=185

 Score =   213 bits (542),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 7/177 (4%)
 Frame = +3

Query  33   RKTMAITRRSLVSSFA-RILLNPTNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDEEAKRR  209
            R T  + RRS++ + A RI+     +       R   G+ +   + N  IDLS+EE KRR
Sbjct  15   RSTAVVGRRSVIPAAANRIIF----RNGVDSGTRFFCGNTA--SAQNFDIDLSNEENKRR  68

Query  210  LVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEP  389
             +NRLLYRSKQRG+LELDL+LG WVE+++ SMDE G+K+L+HVL++ENPDLWKWLT QE 
Sbjct  69   TINRLLYRSKQRGFLELDLVLGNWVEENVDSMDENGVKSLIHVLNLENPDLWKWLTEQEQ  128

Query  390  APDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             P+ + +NPVF+++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  129  PPEEVSSNPVFSALHEKVMKNLNKHAAPETRAAAGQPWVKGWDDFKRGRDAPISGNQ  185



>gb|AFK43220.1| unknown [Medicago truncatula]
Length=176

 Score =   213 bits (541),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNP---TNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDEEAKRRL  212
            MA  R+++++    I  N    T+ T P    RP    F+    S + I+LS+EE+KRRL
Sbjct  1    MATIRKAVINVHRLINSNKSIITSSTKPFLHFRPPFAPFTSQSQSPVVINLSNEESKRRL  60

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
             NRLLYRSKQRG+LELDL+LGKWVED+IH +DE  IKAL+HVLD+ENPDLWKW++GQE  
Sbjct  61   FNRLLYRSKQRGFLELDLVLGKWVEDNIHKLDENRIKALIHVLDLENPDLWKWISGQEQP  120

Query  393  PDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             + +  NPVF ++  K+M NLD H+APETRAT GQ WVRGWDD K+GRD+P +GNQ
Sbjct  121  SESVDVNPVFAALRGKVMKNLDSHSAPETRATLGQPWVRGWDDIKKGRDAPASGNQ  176



>ref|XP_009339020.1| PREDICTED: uncharacterized protein LOC103931302 isoform X1 [Pyrus 
x bretschneideri]
Length=185

 Score =   213 bits (541),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 130/185 (70%), Gaps = 12/185 (6%)
 Frame = +3

Query  42   MAITRRSLVS------SFARILLNPTNQTSPIPSNRPLLG------SFSRLCSSNLGIDL  185
            M   RRSL+S      S A I    T+    I  +RP  G      S S    SNL IDL
Sbjct  1    MGSLRRSLISLHRALKSTASISPAETHLRGVISFSRPQFGYGLVQRSHSTNNGSNLDIDL  60

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            S +E+KRRL NRL+YRSKQRG+LELDL+LGKWVE+HIH MDE GIK+LV VLD+ENPDLW
Sbjct  61   STQESKRRLFNRLIYRSKQRGFLELDLVLGKWVEEHIHYMDEQGIKSLVDVLDLENPDLW  120

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSP  545
            KWL GQE  P+ ++TNPVFT+V  KI NNL+ +AAPETRAT GQ WVRGWDD K+ +  P
Sbjct  121  KWLIGQEQPPEALQTNPVFTAVRNKITNNLNSYAAPETRATPGQPWVRGWDDIKKSQGGP  180

Query  546  IAGNQ  560
            I GNQ
Sbjct  181  ITGNQ  185



>ref|XP_009339021.1| PREDICTED: uncharacterized protein LOC103931302 isoform X2 [Pyrus 
x bretschneideri]
Length=178

 Score =   212 bits (540),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 129/180 (72%), Gaps = 9/180 (5%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-RPLLG------SFSRLCSSNLGIDLSDEEA  200
            M   RRSL+S      L  T   SP  ++ RP  G      S S    SNL IDLS +E+
Sbjct  1    MGSLRRSLIS--LHRALKSTASISPAETHLRPQFGYGLVQRSHSTNNGSNLDIDLSTQES  58

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            KRRL NRL+YRSKQRG+LELDL+LGKWVE+HIH MDE GIK+LV VLD+ENPDLWKWL G
Sbjct  59   KRRLFNRLIYRSKQRGFLELDLVLGKWVEEHIHYMDEQGIKSLVDVLDLENPDLWKWLIG  118

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            QE  P+ ++TNPVFT+V  KI NNL+ +AAPETRAT GQ WVRGWDD K+ +  PI GNQ
Sbjct  119  QEQPPEALQTNPVFTAVRNKITNNLNSYAAPETRATPGQPWVRGWDDIKKSQGGPITGNQ  178



>gb|KGN61232.1| hypothetical protein Csa_2G072460 [Cucumis sativus]
Length=265

 Score =   215 bits (548),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 120/144 (83%), Gaps = 4/144 (3%)
 Frame = +3

Query  141  GSFSRL----CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMD  308
            G FS +     S+N  IDLS+E++KR+L NRLLYRSKQRG+LELDLILGKWVEDHIHS+D
Sbjct  122  GCFSSVHFSSTSTNPDIDLSNEDSKRQLFNRLLYRSKQRGFLELDLILGKWVEDHIHSLD  181

Query  309  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  488
              GI+AL++VLD+ENPDLWKWLTGQE  P+ ++TNPVFT V  K+++NL+KHA+PETR  
Sbjct  182  ADGIRALINVLDLENPDLWKWLTGQEQPPEALKTNPVFTGVKEKVIDNLNKHASPETRTP  241

Query  489  TGQSWVRGWDDFKRGRDSPIAGNQ  560
             GQ WVRGWDDFK+GRD PI GNQ
Sbjct  242  PGQQWVRGWDDFKKGRDGPITGNQ  265



>ref|XP_009127327.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
[Brassica rapa]
Length=181

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 12/177 (7%)
 Frame = +3

Query  36   KTMAITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLCSS--NLGIDLSDEEAKRR  209
            ++ A+ R+S V+  A           PI  N   LG+    CSS  +  IDLS+EE KR 
Sbjct  15   RSTAVVRQSSVTPSA---------APPIFQNGVDLGA-RFFCSSPQSFDIDLSNEEKKRI  64

Query  210  LVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEP  389
             +NRLLYRSKQRG+LELDL+LG WVE++++SMDET +K+L+HVLD+ENPDLWKWLT QE 
Sbjct  65   TINRLLYRSKQRGFLELDLVLGNWVEENVNSMDETAVKSLIHVLDLENPDLWKWLTAQEQ  124

Query  390  APDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             P+ + +NPVF ++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  125  PPEIVSSNPVFLALHKKVMTNLNKHAAPETRAAAGQPWVKGWDDFKRGRDAPISGNQ  181



>ref|XP_009140882.1| PREDICTED: uncharacterized protein LOC103864866 [Brassica rapa]
Length=187

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 132/182 (73%), Gaps = 15/182 (8%)
 Frame = +3

Query  33   RKTMAITRRSLVSSFARILLNPTNQTSPIPSN------RPLLGSFSRLCSSNLGIDLSDE  194
            R T  + RRS++ + A        ++ PI  N      R   G+ S   + N  IDLS E
Sbjct  15   RSTAVVNRRSVIPAAAA-------RSHPIFRNGVDFAPRFFCGNTS--SAQNFDIDLSSE  65

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            E KR  +NRLLYRSKQRG+LELDL+LG WVE++++SMDE  +K+L+HVLD+ENPDLWKWL
Sbjct  66   EKKRITINRLLYRSKQRGFLELDLVLGNWVEENVNSMDENTVKSLIHVLDLENPDLWKWL  125

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAG  554
            TGQE  P+ + +NPVF ++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+PI+G
Sbjct  126  TGQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAEAGQPWVKGWDDFKRGRDAPISG  185

Query  555  NQ  560
            NQ
Sbjct  186  NQ  187



>gb|EPS59121.1| hypothetical protein M569_15690 [Genlisea aurea]
Length=153

 Score =   209 bits (533),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 115/148 (78%), Gaps = 5/148 (3%)
 Frame = +3

Query  132  PLLGSFSRLCSSNL-----GIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHI  296
            P L    R  SSN       IDLSDEE KRRL NRLLYRSKQRGYLELDLILGKWVED+I
Sbjct  6    PRLSEVCRFYSSNGTPGSDDIDLSDEETKRRLFNRLLYRSKQRGYLELDLILGKWVEDNI  65

Query  297  HSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPE  476
            HSMDE+GIK+L  VLD+ENPDLW WL+GQ+  P+ + TNPVF +V  K+  NLD +AAPE
Sbjct  66   HSMDESGIKSLARVLDLENPDLWAWLSGQDTPPEVVSTNPVFLAVREKVSKNLDSYAAPE  125

Query  477  TRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            TRA  GQ WVRGWDD+K+GRD PI+GNQ
Sbjct  126  TRAVPGQPWVRGWDDYKKGRDGPISGNQ  153



>ref|XP_006402032.1| hypothetical protein EUTSA_v10014773mg [Eutrema salsugineum]
 gb|ESQ43485.1| hypothetical protein EUTSA_v10014773mg [Eutrema salsugineum]
Length=187

 Score =   210 bits (534),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSPIPSNRPLLGS--FSRLCSS--NLGIDLSDEEAKRRLV  215
            I R + V+S   +      +T PI  NR  LG   FS   +S  N  IDLS+EE KR  +
Sbjct  13   IIRSTAVTSRNSVTPAAATRTHPIFRNRVDLGMRFFSGNTASPQNFHIDLSNEENKRITI  72

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
            NRLLYRSKQRG+LELDL+LG WVE++++SMDE  +K+L+ VL +ENPDLWKWLTGQE  P
Sbjct  73   NRLLYRSKQRGFLELDLVLGNWVEENVNSMDENAVKSLIDVLGLENPDLWKWLTGQEQPP  132

Query  396  DGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            + + +NPVF ++H K+M NL+KHAAPETRA  G+ WVRGWDDFK+GRD+PI+GNQ
Sbjct  133  EAVSSNPVFMALHEKVMKNLNKHAAPETRAAAGEPWVRGWDDFKKGRDAPISGNQ  187



>emb|CDY05831.1| BnaA10g05890D [Brassica napus]
Length=187

 Score =   210 bits (534),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 131/182 (72%), Gaps = 15/182 (8%)
 Frame = +3

Query  33   RKTMAITRRSLVSSFARILLNPTNQTSPIPSN------RPLLGSFSRLCSSNLGIDLSDE  194
            R T  + RRS++ + A        ++ PI  N      R   G+ S     N  IDLS E
Sbjct  15   RSTAVVNRRSVIPAAAA-------RSHPIFRNGVDFAPRFFCGNTS--SPQNFDIDLSSE  65

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            E KR  +NRLLYRSKQRG+LELDL+LG WVE++++SMDE  +K+L+HVLD+ENPDLWKWL
Sbjct  66   EKKRITINRLLYRSKQRGFLELDLVLGNWVEENVNSMDENTVKSLIHVLDLENPDLWKWL  125

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAG  554
            TGQE  P+ + +NPVF ++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+PI+G
Sbjct  126  TGQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAEAGQPWVKGWDDFKRGRDAPISG  185

Query  555  NQ  560
            NQ
Sbjct  186  NQ  187



>ref|XP_010070209.1| PREDICTED: uncharacterized protein LOC104456996 [Eucalyptus grandis]
 gb|KCW58841.1| hypothetical protein EUGRSUZ_H01475 [Eucalyptus grandis]
Length=192

 Score =   208 bits (530),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = +3

Query  129  RPLLGSFSRLCSSN-----LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDH  293
            RP  G  SR  S       LG+D SDEE+KRRL NRLLYRS+QRGYLELDL+LG+WVED+
Sbjct  44   RPQNGWVSRFSSGGDGDRFLGVDFSDEESKRRLCNRLLYRSRQRGYLELDLVLGQWVEDN  103

Query  294  IHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAP  473
            I+SMD  GIKALV  LD ENPDLWKWLT QE  P+ ++ NPVF++V  K+MNNL+ H+AP
Sbjct  104  IYSMDVDGIKALVDFLDWENPDLWKWLTNQEQPPEAVKMNPVFSAVQKKVMNNLNSHSAP  163

Query  474  ETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            ETRA  GQ WVRGWDD K+GRD PI GNQ
Sbjct  164  ETRALPGQPWVRGWDDIKKGRDGPITGNQ  192



>ref|XP_007137824.1| hypothetical protein PHAVU_009G158800g [Phaseolus vulgaris]
 gb|ESW09818.1| hypothetical protein PHAVU_009G158800g [Phaseolus vulgaris]
Length=182

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 133/183 (73%), Gaps = 11/183 (6%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTN---QTSPIPSNRPLLGSFSRLC-------SSNLGIDLSD  191
            MA  R++ ++ +  I  N       T+P  + RP  G +SR         + +L IDLS+
Sbjct  1    MASFRKAAINVYRVINSNKATIATSTNPTHTLRPFFG-YSRFTPFSSHTQTQSLEIDLSN  59

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            EE+KRRL N+LLYRSKQRG+LELDL+LGKWVE++IH++DE  IKAL+HVL++ENPDLWKW
Sbjct  60   EESKRRLFNQLLYRSKQRGFLELDLVLGKWVEENIHTLDENRIKALIHVLNLENPDLWKW  119

Query  372  LTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIA  551
            ++GQE  P+ + TNPVF +VH ++M NLD H+APE RAT GQ WV GWDD ++G+  P++
Sbjct  120  ISGQEQPPESVSTNPVFAAVHERVMKNLDSHSAPEVRATPGQPWVSGWDDIQKGQHGPVS  179

Query  552  GNQ  560
            GNQ
Sbjct  180  GNQ  182



>ref|NP_001236603.1| uncharacterized protein LOC100527478 [Glycine max]
 gb|ACU16572.1| unknown [Glycine max]
Length=177

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  150  SRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKAL  329
            S   +  L IDLS+EE+KRRL N+LLYRSKQRG+LELDL+LGKWVED+IHS+DE  IKAL
Sbjct  41   SHTQNQTLEIDLSNEESKRRLFNQLLYRSKQRGFLELDLVLGKWVEDNIHSLDEIRIKAL  100

Query  330  VHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVR  509
            +HVLD+ENPDLWKW++GQE  P+ + TNPVF +V  ++M NLD H APE RAT GQ WVR
Sbjct  101  IHVLDLENPDLWKWISGQEQPPESVSTNPVFAAVRERVMKNLDNHPAPEVRATPGQPWVR  160

Query  510  GWDDFKRGRDSPIAGNQ  560
            GWDD K+G+D P++GNQ
Sbjct  161  GWDDIKKGQDGPVSGNQ  177



>ref|NP_001190509.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
 gb|AED96026.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
Length=197

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 130/185 (70%), Gaps = 14/185 (8%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLC-----SSNLGIDLSDEEAKRRL  212
            I R + V   + I+    N++ PI     +       C     + N  IDLS+EE KRR 
Sbjct  13   IIRSTAVVGRSSIIPAAANRSYPIIFRNGVDLGARFFCENTASAQNFDIDLSNEENKRRT  72

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDV---------ENPDLW  365
            +NRLLYRSKQRG+LELDL+LG WVE++++SMDE G+K+L+HVL++         ENPDLW
Sbjct  73   INRLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLVESEATKLLENPDLW  132

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSP  545
            KWLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA  GQ WVRGWDDFKRGRD+P
Sbjct  133  KWLTEQEQPPEAVSSNPVFSALHEKVMKNLNKHAAPETRAAAGQPWVRGWDDFKRGRDAP  192

Query  546  IAGNQ  560
            I+GNQ
Sbjct  193  ISGNQ  197



>emb|CDX91564.1| BnaC02g15960D [Brassica napus]
Length=191

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 133/186 (72%), Gaps = 20/186 (11%)
 Frame = +3

Query  36   KTMAITRRSLVSSFARILLNPTNQTSPIPSNRPLLGS--FSRLCSS--NLGIDLSDEEAK  203
            ++ A+ RRS V+  A           PI  N   LG+  FS   SS  N+ IDLS EE K
Sbjct  15   RSTAVVRRSSVTPSA---------APPIFQNGVDLGARFFSGNTSSPQNIDIDLSSEEKK  65

Query  204  R-------RLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDL  362
            R         VNRLLYRSKQRG+LELDL+LG WVE++++SMDET +K+L+HVLD+ENPDL
Sbjct  66   RITINRHVLCVNRLLYRSKQRGFLELDLVLGNWVEENVNSMDETAVKSLIHVLDLENPDL  125

Query  363  WKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDS  542
            WKWLT QE  P+ + +NPVF ++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+
Sbjct  126  WKWLTSQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAAAGQPWVKGWDDFKRGRDA  185

Query  543  PIAGNQ  560
            PI+GNQ
Sbjct  186  PISGNQ  191



>ref|XP_010250490.1| PREDICTED: uncharacterized protein LOC104592726 [Nelumbo nucifera]
 ref|XP_010250491.1| PREDICTED: uncharacterized protein LOC104592726 [Nelumbo nucifera]
Length=183

 Score =   206 bits (523),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 2/148 (1%)
 Frame = +3

Query  123  SNRPLLGSFSRLCSS--NLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHI  296
            S R  +GS S   S+  +  IDLS+EE+KRR  NRLLYRS+QRG+LELDL+LG WVE+HI
Sbjct  36   SYRNHVGSISPFSSNIQSYDIDLSNEESKRRTFNRLLYRSRQRGFLELDLVLGSWVEEHI  95

Query  297  HSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPE  476
             SMDET IKAL+ VLD+ENPDLW WLTGQ+  P+ +  NPVF+S+  K+MNNL+ H+APE
Sbjct  96   SSMDETRIKALIDVLDLENPDLWNWLTGQDQPPEAVNQNPVFSSLRDKVMNNLNSHSAPE  155

Query  477  TRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            TRA  GQ WVRGWDD K+GRDSPI+GNQ
Sbjct  156  TRAIPGQPWVRGWDDIKKGRDSPISGNQ  183



>gb|KHN31242.1| Succinate dehydrogenase assembly factor 2, mitochondrial [Glycine 
soja]
Length=177

 Score =   205 bits (522),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  150  SRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKAL  329
            S   +  L IDLS+EE+KRRL N+LLYRSKQRG+LELDL+LGKWVED+IHS+DE  IKAL
Sbjct  41   SHTQNQTLEIDLSNEESKRRLFNQLLYRSKQRGFLELDLVLGKWVEDNIHSLDEIRIKAL  100

Query  330  VHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVR  509
            +HVLD+ENPDLWKW++GQE  P+ + TNPVF +V  ++M NLD H+APE RAT GQ WVR
Sbjct  101  IHVLDLENPDLWKWISGQEQPPESVSTNPVFAAVRERVMKNLDNHSAPEVRATPGQPWVR  160

Query  510  GWDDFKRGRDSPIAGNQ  560
            GWDD K+G+  P++GNQ
Sbjct  161  GWDDIKKGQGGPVSGNQ  177



>ref|XP_010667021.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010667022.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010667023.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010667024.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   205 bits (521),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 125/171 (73%), Gaps = 3/171 (2%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDEEAKRRLVNRLL  227
            I    ++SS      +PT  T  I  ++ L+    R  SS   ID +D E++RR+ NRLL
Sbjct  14   IINSKVISSNWNSFASPTVATHKITKSQ-LVPVTCRFYSSE--IDFTDVESRRRMFNRLL  70

Query  228  YRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIR  407
            YRSKQRG+LELDL+LG WVED+I SMDE GIK+L+ VLD+ENPDLW WL+GQE  P+ I 
Sbjct  71   YRSKQRGFLELDLVLGNWVEDNIQSMDENGIKSLIQVLDLENPDLWNWLSGQEQPPESIS  130

Query  408  TNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             NPVFT+V  K+ +NL+ HAAPETRAT GQ WVRGWDD KRG+DSP++GNQ
Sbjct  131  VNPVFTAVREKVASNLNNHAAPETRATPGQPWVRGWDDIKRGKDSPVSGNQ  181



>gb|AFK44704.1| unknown [Lotus japonicus]
Length=179

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 129/181 (71%), Gaps = 10/181 (6%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTN---QTSPIPSNRPLLGSFSRLCS-----SNLGIDLSDEE  197
            MA  RR+ ++    I  N  N    T+P+ S RPL G +S++        +  IDLS EE
Sbjct  1    MASLRRAAINIHRVINANKRNITASTTPLTS-RPLYG-YSKISPFTSYPQSYEIDLSTEE  58

Query  198  AKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLT  377
            +KRR +NRLLYRSKQRG+LELDL+LGKWVED+IHS+DE  IK+L+HVLD+ENPDLWKWL+
Sbjct  59   SKRRSLNRLLYRSKQRGFLELDLVLGKWVEDNIHSLDENRIKSLIHVLDLENPDLWKWLS  118

Query  378  GQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGN  557
            GQE  P+ I  NPVF ++  K+M NLD HAAPE RA  GQ WVRGWDD K+G   P+ GN
Sbjct  119  GQEQPPESISANPVFAAIKEKLMKNLDSHAAPEVRAMPGQPWVRGWDDIKKGPGGPVTGN  178

Query  558  Q  560
            Q
Sbjct  179  Q  179



>ref|XP_008385758.1| PREDICTED: uncharacterized protein LOC103448287 [Malus domestica]
Length=178

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 128/180 (71%), Gaps = 9/180 (5%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-RPLLG------SFSRLCSSNLGIDLSDEEA  200
            M   RRSL+S      L  T   SP  ++ R   G      S+S    SN  IDLS +E+
Sbjct  1    MGSLRRSLIS--LHRALKSTASISPAETHVRSQFGYGLVQRSYSTNNGSNPDIDLSTQES  58

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            KRRL NRL+YRSKQRG+LELDL+LGKWVE+HIHS+DE GIK+LV VL++ENPDLWKWL G
Sbjct  59   KRRLFNRLIYRSKQRGFLELDLVLGKWVEEHIHSLDEQGIKSLVDVLNLENPDLWKWLIG  118

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            QE  P+ ++TNPVFT+V  KI NNL+ +AA ETRAT GQ WVRGWDD K+ +  PI GNQ
Sbjct  119  QEQPPEALQTNPVFTAVRNKITNNLNSYAASETRATPGQPWVRGWDDIKKSQGCPITGNQ  178



>gb|KJB07931.1| hypothetical protein B456_001G053700 [Gossypium raimondii]
Length=171

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 116/150 (77%), Gaps = 13/150 (9%)
 Frame = +3

Query  129  RPLLGSFSRLCSSN------LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVED  290
            RP  G  S   S+N      L IDLS+EE+KRRL NRLLYRSKQRG+LELDL+LGKWVE+
Sbjct  29   RPQYGWVSTYFSTNISNTQPLNIDLSNEESKRRLYNRLLYRSKQRGFLELDLVLGKWVEE  88

Query  291  HIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAA  470
            HIHSMDE GIKALV+VLD+ENPDLWKWLTGQE  P+ +  NP       K++ NL+ H++
Sbjct  89   HIHSMDENGIKALVNVLDLENPDLWKWLTGQEQPPEAVTINP-------KVLKNLNNHSS  141

Query  471  PETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            PETRAT G+ WVRGWDD K+GRDSPI GNQ
Sbjct  142  PETRATRGRPWVRGWDDIKKGRDSPITGNQ  171



>gb|KCW58840.1| hypothetical protein EUGRSUZ_H01475 [Eucalyptus grandis]
Length=193

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 115/150 (77%), Gaps = 6/150 (4%)
 Frame = +3

Query  129  RPLLGSFSRLCSSN-----LGIDLSDEEAKRRLVN-RLLYRSKQRGYLELDLILGKWVED  290
            RP  G  SR  S       LG+D SDEE+KRRL N RLLYRS+QRGYLELDL+LG+WVED
Sbjct  44   RPQNGWVSRFSSGGDGDRFLGVDFSDEESKRRLCNSRLLYRSRQRGYLELDLVLGQWVED  103

Query  291  HIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAA  470
            +I+SMD  GIKALV  LD ENPDLWKWLT QE  P+ ++ NPVF++V  K+MNNL+ H+A
Sbjct  104  NIYSMDVDGIKALVDFLDWENPDLWKWLTNQEQPPEAVKMNPVFSAVQKKVMNNLNSHSA  163

Query  471  PETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            PETRA  GQ WVRGWDD K+GRD PI GNQ
Sbjct  164  PETRALPGQPWVRGWDDIKKGRDGPITGNQ  193



>gb|AFJ66165.1| hypothetical protein 11M19.9 [Arabidopsis halleri]
Length=145

 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 113/136 (83%), Gaps = 5/136 (4%)
 Frame = +3

Query  153  RLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALV  332
            R  + N  IDLS+EE KRR +NRLLYRSKQRG+LELDL+LG WVE++++SMDE G+K+L+
Sbjct  15   RSTAVNFDIDLSNEENKRRTINRLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLI  74

Query  333  HVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRG  512
            HVL++ENPDLWKWLT QE  P+      VF+++H K+M NL+KHAAPETRA  GQ WV+G
Sbjct  75   HVLNLENPDLWKWLTEQEQPPEA-----VFSALHEKVMKNLNKHAAPETRAAAGQPWVKG  129

Query  513  WDDFKRGRDSPIAGNQ  560
            WDDFKRGRD+PI+GNQ
Sbjct  130  WDDFKRGRDAPISGNQ  145



>ref|NP_001032052.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
 dbj|BAH19854.1| AT5G51040 [Arabidopsis thaliana]
 gb|AED96025.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
Length=184

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 126/176 (72%), Gaps = 9/176 (5%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLC-----SSNLGIDLSDEEAKRRL  212
            I R + V   + I+    N++ PI     +       C     + N  IDLS+EE KRR 
Sbjct  13   IIRSTAVVGRSSIIPAAANRSYPIIFRNGVDLGARFFCENTASAQNFDIDLSNEENKRRT  72

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            +NR    SKQRG+LELDL+LG WVE++++SMDE G+K+L+HVL++ENPDLWKWLT QE  
Sbjct  73   INR----SKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKWLTEQEQP  128

Query  393  PDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            P+ + +NPVF+++H K+M NL+KHAAPETRA  GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  129  PEAVSSNPVFSALHEKVMKNLNKHAAPETRAAAGQPWVRGWDDFKRGRDAPISGNQ  184



>ref|XP_004979384.1| PREDICTED: uncharacterized protein LOC101756720 [Setaria italica]
Length=175

 Score =   199 bits (507),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +3

Query  108  TSPIPSNRPLLGSFS-RLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWV  284
            T P  S   LL +F+    ++   +DLS +E++RRL+NRL+YRSKQRG+LELDL+LG WV
Sbjct  24   TLPAASAHRLLSAFTTSQQNAATTVDLSSDESRRRLLNRLVYRSKQRGFLELDLVLGSWV  83

Query  285  EDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKH  464
            E H+HSMDE+ I+AL+ VLD+ENPDLWKW TGQE  P+ + +NPVFT++ +K+ +NL KH
Sbjct  84   EQHVHSMDESNIRALLQVLDLENPDLWKWFTGQEQPPEDLNSNPVFTAIKSKVTDNLSKH  143

Query  465  AAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            A+PETR+T GQ WVRGWDD K+G+D P  GNQ
Sbjct  144  ASPETRSTPGQPWVRGWDDIKKGKDGPKYGNQ  175



>ref|NP_001235179.1| uncharacterized protein LOC100500495 [Glycine max]
 gb|ACU15595.1| unknown [Glycine max]
Length=182

 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 129/183 (70%), Gaps = 11/183 (6%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTN---QTSPIPSNRPLLGSFSRLC-------SSNLGIDLSD  191
            MA  R + ++ F  I  N       T+ + + RPL   +SR         + +L IDLS+
Sbjct  1    MASFRNAAINVFRAINTNKATIAASTNSLHTLRPLF-CYSRSTPFSSHTEAESLQIDLSN  59

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            EE+KR L NRLLYRSKQRG+LELDL+LGKWVE++IHS+DE  IKAL+HVLD+ENPDLWKW
Sbjct  60   EESKRCLFNRLLYRSKQRGFLELDLVLGKWVEENIHSLDENRIKALIHVLDLENPDLWKW  119

Query  372  LTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIA  551
            ++GQE  P+ +  N VF +V  ++  NLD H+APE RAT GQ WVRGWDD K+G+D P++
Sbjct  120  ISGQEQPPESVSANLVFAAVRERVKKNLDIHSAPEVRATPGQPWVRGWDDIKKGQDGPVS  179

Query  552  GNQ  560
            GNQ
Sbjct  180  GNQ  182



>gb|KHN09698.1| Succinate dehydrogenase assembly factor 2, mitochondrial [Glycine 
soja]
Length=182

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 15/185 (8%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-----RPLLGSFSRLC-------SSNLGIDL  185
            MA  R + ++ F  I  N +  T    +N     RPL   +SR         + +L IDL
Sbjct  1    MASFRNAAINVFRAI--NTSKATIAASTNSLHTLRPLF-CYSRFTPFSSHTEAESLQIDL  57

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            S+EE+KR L NRLLYRSKQRG+LELDL+LGKWVE++IHS+DE  IKAL+HVLD+ENPDLW
Sbjct  58   SNEESKRCLFNRLLYRSKQRGFLELDLVLGKWVEENIHSLDENRIKALIHVLDLENPDLW  117

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSP  545
            KW++GQE  P+ +  N VF +V  ++  NLD H+APE RAT GQ WVRGWDD K+G+D P
Sbjct  118  KWISGQEQPPESVSANLVFAAVRERVKKNLDIHSAPEVRATPGQPWVRGWDDIKKGQDGP  177

Query  546  IAGNQ  560
            ++GNQ
Sbjct  178  VSGNQ  182



>ref|XP_008797117.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Phoenix dactylifera]
Length=166

 Score =   197 bits (500),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 130/176 (74%), Gaps = 13/176 (7%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLCSS--NLGIDLSDEEAKRRLV  215
            MA  RR+L+     ++L     TSP    R  LGS SR  S+  +L +DLSDEE+KRRL 
Sbjct  1    MATLRRALLRLHQSLVL-----TSP----RYHLGSISRFSSNRGSLDVDLSDEESKRRLH  51

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
            NRLLYRS+QRG+LELDLILG WVE++I S+DE  I+AL+ VLD+ENPDLWKWLTGQE  P
Sbjct  52   NRLLYRSRQRGFLELDLILGSWVEENIRSLDELRIRALMDVLDLENPDLWKWLTGQEQPP  111

Query  396  DGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRD-SPIAGNQ  560
            + +  NPVFT+V +++M NL+ HAAPETRA  GQ WVRGWDD KRG+D  P  GNQ
Sbjct  112  EAVHNNPVFTAVQSRVMGNLNSHAAPETRANPGQPWVRGWDD-KRGQDGGPKYGNQ  166



>ref|XP_010929714.1| PREDICTED: uncharacterized protein LOC105051113 [Elaeis guineensis]
Length=173

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 128/176 (73%), Gaps = 6/176 (3%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLCS--SNLGIDLSDEEAKRRLV  215
            MA  RR+L+     + L P   +  +  +   +GS SR  S   +L +DLSDEE+KRRL 
Sbjct  1    MATLRRALLRLHQTLTLTPPRSSQSLLGSH--IGSISRFSSDRGSLDVDLSDEESKRRLH  58

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
            NRLLYRS+QRG+LELDLILG WVE++I S+DE  I+AL+ VLD+ENPDLWKWLTGQE  P
Sbjct  59   NRLLYRSRQRGFLELDLILGSWVEENIRSLDELHIRALMDVLDLENPDLWKWLTGQEQPP  118

Query  396  DGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRD-SPIAGNQ  560
            + +  NPVFT+V +++M NL+ HAAPETRA  GQ WVRGWDD KRG++  P  GNQ
Sbjct  119  EAVNDNPVFTAVQSRVMGNLNSHAAPETRANPGQPWVRGWDD-KRGQEGGPKYGNQ  173



>ref|NP_001288385.1| uncharacterized LOC103654411 [Zea mays]
 gb|ACG26201.1| TPR repeat region family protein [Zea mays]
 gb|ACN35711.1| unknown [Zea mays]
 gb|AFW64962.1| TPR repeat region family protein [Zea mays]
Length=180

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +3

Query  150  SRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKAL  329
            S+  ++   IDLS +E++RRL+NRL+YRSKQRG+LELDL+LG WVE H+H+MDE  I+AL
Sbjct  44   SQQNAATTTIDLSSDESRRRLLNRLVYRSKQRGFLELDLVLGTWVEQHVHAMDEANIRAL  103

Query  330  VHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVR  509
            + VLD+ENPDLWKWLT QE  P+ + +NPVF ++ +K+ +NL KHA+PETR+T GQ WVR
Sbjct  104  LQVLDLENPDLWKWLTSQEQPPEDLNSNPVFAAIKSKVTDNLTKHASPETRSTPGQPWVR  163

Query  510  GWDDFKRGRDSPIAGNQ  560
            GWDD K+G+D P  GNQ
Sbjct  164  GWDDIKKGKDGPKYGNQ  180



>ref|XP_006662965.1| PREDICTED: uncharacterized protein LOC102700188 [Oryza brachyantha]
Length=178

 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
             SS   IDLS +E++RRL+NRL+YRSKQRG+LELDL+LG WVE HIHSMDE  I++L+HV
Sbjct  46   SSSTTTIDLSSDESRRRLINRLVYRSKQRGFLELDLVLGSWVEQHIHSMDEANIRSLLHV  105

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            LD+ENPDLWKWLTGQE  P+ + +NPVF +V +K+ +NL KH++PETR+  GQ WVRGWD
Sbjct  106  LDLENPDLWKWLTGQEQPPEAVNSNPVFIAVKSKVTDNLSKHSSPETRSAPGQPWVRGWD  165

Query  519  DFKRGRDSPIAGNQ  560
            D KRG D P  GNQ
Sbjct  166  D-KRGIDGPKYGNQ  178



>gb|ACG25754.1| TPR repeat region family protein [Zea mays]
Length=175

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = +3

Query  90   LNPTNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLI  269
            L+P    +P P         S+  ++   IDLS +E++RRL+NRL+YRSKQRG+LELDL+
Sbjct  26   LSPAFSATPTPKT-------SQQNAAITTIDLSSDESRRRLLNRLVYRSKQRGFLELDLV  78

Query  270  LGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMN  449
            LG WVE H+H+MDE  I+AL+ VLD+ENPDLWKWLT QE  P+ + +NPVF+++ +K+ +
Sbjct  79   LGTWVEQHVHAMDEPNIRALLQVLDLENPDLWKWLTSQEQPPEDLNSNPVFSAIKSKVTD  138

Query  450  NLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            NL KHA+PETR+T GQ WVRGWDD K+G+D P  GNQ
Sbjct  139  NLIKHASPETRSTPGQPWVRGWDDIKKGKDGPSYGNQ  175



>ref|XP_008670754.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103648030 
[Zea mays]
Length=173

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = +3

Query  90   LNPTNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLI  269
            L+P    +P P         S+  ++   IDLS +E++RRL+NRL+YRSKQRG+LELDL+
Sbjct  24   LSPAFSATPTPKT-------SQQNAATTTIDLSSDESRRRLLNRLVYRSKQRGFLELDLV  76

Query  270  LGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMN  449
            LG WVE H+H+MDE  I+AL+ VLD+ENPDLWKWLT QE  P+ + +NPVF+++ +K+ +
Sbjct  77   LGTWVEQHVHAMDEPNIRALLQVLDLENPDLWKWLTSQEQPPEDLISNPVFSAIKSKVTD  136

Query  450  NLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            NL KHA+PETR+T GQ WVRGWDD K+G+D P  GNQ
Sbjct  137  NLIKHASPETRSTPGQPWVRGWDDIKKGKDGPNYGNQ  173



>gb|AFK36017.1| unknown [Medicago truncatula]
 gb|KEH20959.1| TPR repeat region family protein [Medicago truncatula]
Length=180

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 116/152 (76%), Gaps = 8/152 (5%)
 Frame = +3

Query  129  RPLLG--------SFSRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWV  284
            RP+ G        S S   +++L IDLS++E+KR L NRLLYRSKQRG+LELDL+LGKWV
Sbjct  29   RPVFGYHKISPFTSHSDSDNNSLHIDLSNQESKRTLFNRLLYRSKQRGFLELDLVLGKWV  88

Query  285  EDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKH  464
            +++IHS+DE  I++L+H+LDVENPDLWKWL+GQE  P+ I  NPVF +V   +M NLD H
Sbjct  89   QNNIHSLDENHIRSLIHLLDVENPDLWKWLSGQEQPPESISINPVFAAVQEGVMKNLDSH  148

Query  465  AAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            ++PETRAT G+ WVRGWDD ++ R  P AGNQ
Sbjct  149  SSPETRATPGKPWVRGWDDIQKFRGGPSAGNQ  180



>ref|XP_002449598.1| hypothetical protein SORBIDRAFT_05g019780 [Sorghum bicolor]
 gb|EES08586.1| hypothetical protein SORBIDRAFT_05g019780 [Sorghum bicolor]
Length=179

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            +DLS +E++RRL+NRL+YRSKQRG+LELDL+LG WVE H+H MDE  I+AL+ VLD+ENP
Sbjct  52   VDLSSDESRRRLLNRLVYRSKQRGFLELDLVLGTWVEQHVHGMDEANIRALLQVLDLENP  111

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGR  536
            DLWKWLT QE  P+ + +NPVF ++ +K+ +NL KHA+PETR+T GQ WVRGWDD K+G+
Sbjct  112  DLWKWLTSQEQPPEDLNSNPVFAAIKSKVTDNLTKHASPETRSTPGQPWVRGWDDIKKGK  171

Query  537  DSPIAGNQ  560
            D P  GNQ
Sbjct  172  DGPKYGNQ  179



>ref|XP_009413497.1| PREDICTED: uncharacterized protein LOC103994785 [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 119/156 (76%), Gaps = 3/156 (2%)
 Frame = +3

Query  99   TNQTSPIPSNRPLLGSFSRLCSSN--LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLIL  272
            ++  SP+ S R  +GS SR  S +  + +DLSDEE+KRRL NRLLYRS+QRG+LELDL+L
Sbjct  18   SDTRSPV-SLRSHVGSISRFYSGHGSVDVDLSDEESKRRLHNRLLYRSRQRGFLELDLVL  76

Query  273  GKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNN  452
            G WVE++I +MD+  I+AL+ VLD+ENPDLWKWLTGQE  P+ ++ NPVF ++ +K+M+N
Sbjct  77   GAWVEENIRAMDQLHIRALMDVLDLENPDLWKWLTGQEQPPEAVKINPVFCAIQSKVMSN  136

Query  453  LDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            L+ HAAPETRA  GQ WVRGWDD K     P  GNQ
Sbjct  137  LNSHAAPETRANPGQPWVRGWDDKKGVEGGPTYGNQ  172



>ref|XP_004503818.1| PREDICTED: uncharacterized protein LOC101502675 [Cicer arietinum]
Length=202

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 124/191 (65%), Gaps = 13/191 (7%)
 Frame = +3

Query  27   EERKTMAITRRSLVSSFARILLNPTNQTSPIPSNRPLLGSF-------------SRLCSS  167
            E+ K   I R    S F + + +    +S     RPL G +             +   S 
Sbjct  12   EKIKIYVIGRMGCSSVFMKRVFHRVFNSSANTLVRPLSGYYRISPFTSHTDNNDTVTPSD  71

Query  168  NLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDV  347
            +L IDLS++EAKRRL NRLLYRSKQRG+LELDL+LGKWVED+IHS+D   I +L+++LD+
Sbjct  72   SLQIDLSNQEAKRRLFNRLLYRSKQRGFLELDLVLGKWVEDNIHSLDHNHIPSLIYLLDL  131

Query  348  ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFK  527
            ENPDLWKWL+GQE  P+ I  NPVF +V   +M NL+ H+APETRAT GQ WVRGWDD K
Sbjct  132  ENPDLWKWLSGQEEPPESISINPVFAAVREGVMKNLNSHSAPETRATPGQPWVRGWDDNK  191

Query  528  RGRDSPIAGNQ  560
            +    P  GNQ
Sbjct  192  KFPGGPSTGNQ  202



>ref|NP_001068002.1| Os11g0528300 [Oryza sativa Japonica Group]
 gb|ABA94029.1| TPR repeat region family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28365.1| Os11g0528300 [Oryza sativa Japonica Group]
 gb|EAZ18567.1| hypothetical protein OsJ_34096 [Oryza sativa Japonica Group]
Length=186

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
             +S   IDLS +E++RRL+NRL+YRSKQRG+LELDL+LG WVE HIHSMDE  I+AL+ V
Sbjct  54   SASTTTIDLSSDESRRRLINRLVYRSKQRGFLELDLVLGTWVEQHIHSMDEANIRALLQV  113

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            LD+ENPDLWKWLT QE  P+ + +NPVF +V +K+ +NL KH++PETR+  GQ WVRGWD
Sbjct  114  LDLENPDLWKWLTSQEQPPEAVNSNPVFIAVKSKVTDNLSKHSSPETRSAPGQPWVRGWD  173

Query  519  DFKRGRDSPIAGNQ  560
            D KRG + P  GNQ
Sbjct  174  D-KRGIEGPKYGNQ  186



>ref|XP_003577516.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Brachypodium distachyon]
Length=177

 Score =   187 bits (476),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = +3

Query  114  PIPSNRPLLGSFSRLCSSNLG-----IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGK  278
            P  S R LL  F+   S+        IDLS +E++RRLVN L+YRSKQRG+LELDL+LG 
Sbjct  26   PAASQR-LLSGFTTTASTQRNTAATPIDLSSDESRRRLVNSLVYRSKQRGFLELDLVLGT  84

Query  279  WVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLD  458
            WVE HI SMDE  I++L+ VLD+ENPDLWKWLTGQE  P+ + +NPVF ++ +K+ +NL 
Sbjct  85   WVEQHIRSMDEANIRSLLQVLDLENPDLWKWLTGQEQPPEAVNSNPVFIAIKSKVTDNLS  144

Query  459  KHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            KHA+PETR+  GQ WVRGWDD KRG D P  GNQ
Sbjct  145  KHASPETRSAPGQPWVRGWDD-KRGIDGPKYGNQ  177



>dbj|BAJ88942.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=174

 Score =   187 bits (474),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 115/159 (72%), Gaps = 10/159 (6%)
 Frame = +3

Query  111  SPIPSNRPLLGSFSRLCS---------SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELD  263
            SP  S   L  S +RL S         +   IDLS++E++RRLVN L+YRSKQRG+LELD
Sbjct  17   SPASSRALLPASSTRLLSVTASTQQNTAGTAIDLSNDESRRRLVNSLMYRSKQRGFLELD  76

Query  264  LILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKI  443
            L+LG WVE H+ SMDE  I++L+ +LD+ENPDLWKWLTGQE  P+ + +NPVF ++ +K+
Sbjct  77   LVLGTWVEQHVRSMDEANIRSLLQILDLENPDLWKWLTGQEQPPETVNSNPVFAAIKSKV  136

Query  444  MNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             +NL KH++PETR+  GQ WVRGWDD KRG D P  GNQ
Sbjct  137  TDNLSKHSSPETRSAPGQPWVRGWDD-KRGLDGPKYGNQ  174



>dbj|BAJ90590.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score =   187 bits (474),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 115/159 (72%), Gaps = 10/159 (6%)
 Frame = +3

Query  111  SPIPSNRPLLGSFSRLCS---------SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELD  263
            SP  S   L  S +RL S         +   IDLS++E++RRLVN L+YRSKQRG+LELD
Sbjct  18   SPASSRALLPASSTRLLSVTASTQQNTAGTAIDLSNDESRRRLVNSLMYRSKQRGFLELD  77

Query  264  LILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKI  443
            L+LG WVE H+ SMDE  I++L+ +LD+ENPDLWKWLTGQE  P+ + +NPVF ++ +K+
Sbjct  78   LVLGTWVEQHVRSMDEANIRSLLQILDLENPDLWKWLTGQEQPPETVNSNPVFAAIKSKV  137

Query  444  MNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             +NL KH++PETR+  GQ WVRGWDD KRG D P  GNQ
Sbjct  138  TDNLSKHSSPETRSAPGQPWVRGWDD-KRGLDGPKYGNQ  175



>gb|EAY81147.1| hypothetical protein OsI_36329 [Oryza sativa Indica Group]
Length=186

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
             +S   IDLS +E++RRL+NRL+YRSKQRG+LELDL+LG WVE HIHSMDE  I+AL+ V
Sbjct  54   SASTTTIDLSSDESRRRLINRLVYRSKQRGFLELDLVLGTWVEQHIHSMDEANIRALLQV  113

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            LD+ENPDLWKWLT QE  P+ + +NPVF +V +K+  NL KH++PETR+  GQ WVRGWD
Sbjct  114  LDLENPDLWKWLTDQEQPPEAMNSNPVFIAVKSKVTENLSKHSSPETRSAPGQPWVRGWD  173

Query  519  DFKRGRDSPIAGNQ  560
            D KRG + P  GNQ
Sbjct  174  D-KRGIEGPKYGNQ  186



>ref|NP_001235051.1| uncharacterized protein LOC100527878 [Glycine max]
 gb|ACU17081.1| unknown [Glycine max]
Length=175

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 124/173 (72%), Gaps = 9/173 (5%)
 Frame = +3

Query  57   RSLVSSFARILLNPTNQTSPIPSNR----PLLGSFSRLCSSNL-GIDLSDEEAKRRLVNR  221
            R LVSS    +LN   QT+P+ + R    P +  F+   S +   I LS++E+KRRL NR
Sbjct  7    RRLVSS----VLNSRVQTNPLLTFRCFCSPPVTPFTSHASYDPNSIHLSNQESKRRLFNR  62

Query  222  LLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDG  401
            LLYRSKQRG+LELDL+LGKWVED+IHS+DE  ++AL+ +LD+ENPDLWKW++GQE  P+ 
Sbjct  63   LLYRSKQRGFLELDLVLGKWVEDNIHSLDEYRVRALILLLDLENPDLWKWISGQEQPPES  122

Query  402  IRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            I  NPVF +V   +M NL+ H+APETRAT G+ WVRGWDD K+     I GNQ
Sbjct  123  IHINPVFAAVREGVMKNLESHSAPETRATPGKPWVRGWDDIKKFPGGSITGNQ  175



>gb|ABK26064.1| unknown [Picea sitchensis]
Length=190

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 117/168 (70%), Gaps = 8/168 (5%)
 Frame = +3

Query  57   RSLVSSFARILLNPTNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDEEAKRRLVNRLLYRS  236
            R     F     NPT   SP  S    +GS      SN   D+ DE  KRR +NRLLYRS
Sbjct  31   RKFAPLFNSEYGNPTAGLSPRFSTEAEVGS------SNPTGDILDEN-KRRFLNRLLYRS  83

Query  237  KQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNP  416
            KQRG LELDL+LGKWVE++I S+DET IKALV VL++ENPDLWKWL+ QEPAP+ +  NP
Sbjct  84   KQRGLLELDLVLGKWVEENIQSLDETHIKALVEVLNLENPDLWKWLSAQEPAPEAVFKNP  143

Query  417  VFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            VF+++H K++  L+ +A+PETRA  GQ WVRGWDD KRG   PIAGNQ
Sbjct  144  VFSALHEKVLKKLNAYASPETRAAPGQPWVRGWDD-KRGLGGPIAGNQ  190



>gb|AFJ66194.1| hypothetical protein 7G9.12 [Boechera stricta]
Length=212

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 124/172 (72%), Gaps = 13/172 (8%)
 Frame = +3

Query  33   RKTMAITRRSLVSSFARILLNPTNQTSPIPSNRPLLGS--FSRLCSS--NLGIDLSDEEA  200
            R T  + R S++ + A       N+T  I  NR  LG+  FS + +S  N  IDLS+EE 
Sbjct  15   RSTAVVGRSSVIPAAA-------NRTYHISRNRVDLGTRFFSGITASPQNFDIDLSNEEN  67

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            KRR +NRLLYRSKQRG+LELDL+LG WVE+++ SMDE G+K+L+HVL++ENPDLWKWLT 
Sbjct  68   KRRTINRLLYRSKQRGFLELDLVLGNWVEENVKSMDENGVKSLIHVLNLENPDLWKWLTE  127

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGR  536
            QE  P+ + +NPVF+++H K+M NL+KHAAPETRA  GQ W +  D F +G+
Sbjct  128  QEQPPEAVISNPVFSALHEKVMKNLNKHAAPETRAAAGQPWFQ--DKFGKGK  177



>ref|XP_006844641.1| hypothetical protein AMTR_s00016p00232260 [Amborella trichopoda]
 gb|ERN06316.1| hypothetical protein AMTR_s00016p00232260 [Amborella trichopoda]
Length=178

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            +DLS+EE++RR VNRLLYRSKQRG+LELDL+LG+WVE++I +MDE  IKALV VLD+ENP
Sbjct  52   LDLSNEESRRRNVNRLLYRSKQRGFLELDLVLGRWVEENIKTMDEANIKALVEVLDLENP  111

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGR  536
            DLWKWLTGQE  PD +  NPVF++VHTKI  NL  +A+ ETRA  GQ WVRGWDD KRG 
Sbjct  112  DLWKWLTGQEQPPDEVNRNPVFSAVHTKISGNLKSYASAETRAAPGQPWVRGWDD-KRGL  170

Query  537  DSPIAGNQ  560
             +   GNQ
Sbjct  171  GTTPFGNQ  178



>emb|CDX71677.1| BnaC09g27180D [Brassica napus]
Length=118

 Score =   174 bits (442),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  234  SKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTN  413
            +KQRG+LELDL+LG WVE++++SMDE  +K+L+HVLD+ENPDLWKWLTGQE  P+ + +N
Sbjct  10   NKQRGFLELDLVLGNWVEENVNSMDENTVKSLIHVLDLENPDLWKWLTGQEQPPEIVSSN  69

Query  414  PVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            PVF ++H K+M NL+KHAAP+TRA  GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  70   PVFLALHKKVMTNLNKHAAPKTRAEAGQPWVKGWDDFKRGRDAPISGNQ  118



>gb|KHN16894.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=452

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            I LS++E+KRRL NRLLYRSKQRG+LELDL+LGKWVED+IHS+DE  ++AL+ +LD+ENP
Sbjct  325  IHLSNQESKRRLFNRLLYRSKQRGFLELDLVLGKWVEDNIHSLDEYRVRALILLLDLENP  384

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGR  536
            DLWKW++GQE  P+ I  NPVF +V   +M NL+ H+APETRAT G+ WVRGWDD K+  
Sbjct  385  DLWKWISGQEQPPESININPVFAAVREGVMKNLESHSAPETRATPGKPWVRGWDDIKKFP  444

Query  537  DSPIAGNQ  560
               I GNQ
Sbjct  445  GGSITGNQ  452



>gb|KHG13984.1| Carbonyl reductase [NADPH] 1 [Gossypium arboreum]
Length=489

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 12/181 (7%)
 Frame = +3

Query  45   AITRRSLVSSFARILLNPT--NQTSPIPSNRPLLGSFSRLCSSN------LGIDLSDEEA  200
            AIT +  + +  R++ + T  N+T+ I   RP  G  SR  S+N      L +DLS EE+
Sbjct  300  AITGKRALLNAQRLVKSSTIANRTTTIF--RPQYGWVSRFSSTNISNAQSLEMDLSTEES  357

Query  201  KRRLVNRLLYR-SKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLT  377
            KRRL N L++  S  RG+LELDL+LGKWVE+HI+SMDE GIKALVHVLD+ENPDL +WLT
Sbjct  358  KRRLFNMLIFSISFWRGFLELDLVLGKWVEEHIYSMDENGIKALVHVLDLENPDLRRWLT  417

Query  378  GQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGN  557
            GQE  P+ +  NPVF++V  K++ NL+ H+APETRAT GQ  VRGWDDF++G D PI G 
Sbjct  418  GQERPPEAVSGNPVFSAVQGKVLKNLN-HSAPETRATPGQPCVRGWDDFQKGHDVPITGG  476

Query  558  Q  560
            +
Sbjct  477  E  477



>gb|KHG13985.1| Carbonyl reductase [NADPH] 1 [Gossypium arboreum]
Length=476

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 131/180 (73%), Gaps = 13/180 (7%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPT--NQTSPIPSNRPLLGSFSRLCSSN------LGIDLSDEEAK  203
            + RR+L+++  R++ + T  N+T+ I   RP  G  SR  S+N      L +DLS EE+K
Sbjct  289  MLRRALLNA-QRLVKSSTIANRTTTI--FRPQYGWVSRFSSTNISNAQSLEMDLSTEESK  345

Query  204  RRLVNRLLYR-SKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            RRL N L++  S  RG+LELDL+LGKWVE+HI+SMDE GIKALVHVLD+ENPDL +WLTG
Sbjct  346  RRLFNMLIFSISFWRGFLELDLVLGKWVEEHIYSMDENGIKALVHVLDLENPDLRRWLTG  405

Query  381  QEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            QE  P+ +  NPVF++V  K++ NL+ H+APETRAT GQ  VRGWDDF++G D PI G +
Sbjct  406  QERPPEAVSGNPVFSAVQGKVLKNLN-HSAPETRATPGQPCVRGWDDFQKGHDVPITGGE  464



>gb|AFJ66223.1| hypothetical protein 34G24.28 [Capsella rubella]
Length=162

 Score =   173 bits (439),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 116/173 (67%), Gaps = 25/173 (14%)
 Frame = +3

Query  48   ITRRSLVSSFARILLNPTNQTSP-IPSNRPLLGS-FSRLCSSNLGIDLSDEEAKRRLVNR  221
            I R + V   + ++  P+NQT P I  N   LG+ F  +   N  IDLS+EE KRR +NR
Sbjct  13   IIRSTAVIGRSSVIPTPSNQTYPVIFRNGVDLGTRFFCVSPQNFDIDLSNEENKRRTINR  72

Query  222  LLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDG  401
            LLYRSKQRG+LELDL+LG WVE+++ SMDE+G+K+L+HVL                    
Sbjct  73   LLYRSKQRGFLELDLVLGNWVEENVKSMDESGVKSLIHVL--------------------  112

Query  402  IRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
               N VF+++H K+M NL+KHAAPETRA  GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  113  ---NLVFSALHEKVMKNLNKHAAPETRAAAGQPWVKGWDDFKRGRDAPISGNQ  162



>gb|EMT20783.1| hypothetical protein F775_28401 [Aegilops tauschii]
Length=113

 Score =   162 bits (409),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +3

Query  225  LYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGI  404
            +YRSKQRG+LELDL+LG WVE H+ SMDE  I++L+ +LD+ENPDLWKWLTGQE AP+ +
Sbjct  1    MYRSKQRGFLELDLVLGTWVEQHVRSMDEANIRSLLQILDLENPDLWKWLTGQEQAPETV  60

Query  405  RTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDF-KRGRDSPIAGNQ  560
             +NPVF ++ +K+ +NL KH++PETR+  GQ WVRGWDD  KRG D P  GNQ
Sbjct  61   NSNPVFAAIKSKVTDNLSKHSSPETRSAPGQPWVRGWDDKDKRGLDGPKYGNQ  113



>ref|XP_011082852.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
isoform X2 [Sesamum indicum]
 ref|XP_011082861.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=135

 Score =   162 bits (411),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPS-NRPLLGSFSRLCSSN-----LGIDLSDEEAK  203
            MA  RR+L S+  RIL   +++TS + + +RP+LGSF R  SSN     + IDLS+EE+K
Sbjct  1    MASFRRALFSTVPRIL--SSSRTSAVAALHRPVLGSFWRFYSSNESNQSVDIDLSNEESK  58

Query  204  RRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQ  383
            RRL NRLLYRSKQRG+LELDLILGKWVEDHIHSMDE+GI++LVHVLD+ENPDLWKWLT Q
Sbjct  59   RRLFNRLLYRSKQRGFLELDLILGKWVEDHIHSMDESGIRSLVHVLDLENPDLWKWLTCQ  118

Query  384  EPAPDGIRTN  413
               P+ ++ N
Sbjct  119  GQPPEAVKKN  128



>gb|EMS54449.1| hypothetical protein TRIUR3_02167 [Triticum urartu]
Length=113

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +3

Query  225  LYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGI  404
            +YRSKQRG+LELDL+LG WVE H+ SMDE  I++L+ +LD+ENPDLWKWLTGQE  P+ +
Sbjct  1    MYRSKQRGFLELDLVLGTWVEQHVRSMDEANIRSLLQILDLENPDLWKWLTGQEQPPETV  60

Query  405  RTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDF-KRGRDSPIAGNQ  560
             +NPVF ++ +K+ +NL KH++PETR+  GQ WVRGWDD  KRG D P  GNQ
Sbjct  61   NSNPVFAAIKSKVTDNLSKHSSPETRSAPGQPWVRGWDDKDKRGLDGPKYGNQ  113



>ref|XP_011040389.1| PREDICTED: uncharacterized protein LOC105136661 [Populus euphratica]
Length=216

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 124/216 (57%), Gaps = 47/216 (22%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSNRPL---LGSFSRLCSSN--------LGIDLS  188
            MA  RR+LV+     +LN T  T+ I    PL    G FSR  + N        L  DLS
Sbjct  5    MASWRRALVT--VHRILNSTTTTNHISVTSPLRSQYGLFSRYSTLNKNDNKNPSLDFDLS  62

Query  189  DEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWK  368
            +EE+KRRL NRLLYRS+QRG+LELDL+LGKWVE+HI+SMDE G+KAL+ VLD+ N +   
Sbjct  63   NEESKRRLCNRLLYRSRQRGFLELDLVLGKWVEEHIYSMDENGVKALIDVLDLVNNNSPS  122

Query  369  W----------------------LTGQE----------PAPDGIRTNPVFTSVHTKIMNN  452
            +                      L G +            P+ +R   VF++V  KIMNN
Sbjct  123  FHLLVSMSFYILSIGTKVLHLPQLFGSDFCVVHYAMACAEPEDLRQ--VFSAVRDKIMNN  180

Query  453  LDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
            L  HAAPETRA  GQ WVRGWDD K+   SP+AGNQ
Sbjct  181  LSSHAAPETRAIPGQPWVRGWDDIKKSAGSPVAGNQ  216



>ref|XP_010112900.1| hypothetical protein L484_017736 [Morus notabilis]
 gb|EXC35035.1| hypothetical protein L484_017736 [Morus notabilis]
Length=177

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 93/128 (73%), Gaps = 23/128 (18%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            IDL++EE+KRRL NRL+YRSKQRG+LELDL+LGKWVE++IHSMD+ GIKAL +VL     
Sbjct  73   IDLANEESKRRLCNRLIYRSKQRGFLELDLVLGKWVEENIHSMDDNGIKALSYVL-----  127

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGR  536
                              N VFT+V  K+MNNL+ HA+PETRA  GQ WVRGWDD KRGR
Sbjct  128  ------------------NLVFTAVSGKVMNNLNAHASPETRAKPGQPWVRGWDDIKRGR  169

Query  537  DSPIAGNQ  560
            DSPI GNQ
Sbjct  170  DSPITGNQ  177



>ref|XP_002973356.1| hypothetical protein SELMODRAFT_98920, partial [Selaginella moellendorffii]
 ref|XP_002976544.1| hypothetical protein SELMODRAFT_105340, partial [Selaginella 
moellendorffii]
 gb|EFJ22213.1| hypothetical protein SELMODRAFT_105340, partial [Selaginella 
moellendorffii]
 gb|EFJ25730.1| hypothetical protein SELMODRAFT_98920, partial [Selaginella moellendorffii]
Length=122

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +3

Query  198  AKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLT  377
            + ++ + RLLYRSKQRG+LELDL+LGKW +++IH +D+  +++L+ VLD+ENPDLWKWLT
Sbjct  1    SSQKFLYRLLYRSKQRGFLELDLVLGKWTQENIHQLDDKHLESLIQVLDLENPDLWKWLT  60

Query  378  GQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKR-GRDSPIAG  554
            GQ   P+ I  NPVF  +  +I  NL+ HAA ETRA  GQ WVRGWDDFK+ G ++   G
Sbjct  61   GQAEVPESITANPVFACIQKQISGNLENHAAVETRAKPGQPWVRGWDDFKKTGPNNAFLG  120

Query  555  NQ  560
            NQ
Sbjct  121  NQ  122



>gb|KCW58842.1| hypothetical protein EUGRSUZ_H01475 [Eucalyptus grandis]
Length=168

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 77/102 (75%), Gaps = 5/102 (5%)
 Frame = +3

Query  129  RPLLGSFSRLCSSN-----LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDH  293
            RP  G  SR  S       LG+D SDEE+KRRL NRLLYRS+QRGYLELDL+LG+WVED+
Sbjct  44   RPQNGWVSRFSSGGDGDRFLGVDFSDEESKRRLCNRLLYRSRQRGYLELDLVLGQWVEDN  103

Query  294  IHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPV  419
            I+SMD  GIKALV  LD ENPDLWKWLT QE  P+ ++ NPV
Sbjct  104  IYSMDVDGIKALVDFLDWENPDLWKWLTNQEQPPEAVKMNPV  145



>ref|XP_001752564.1| predicted protein [Physcomitrella patens]
 gb|EDQ82803.1| predicted protein [Physcomitrella patens]
Length=134

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            R+LYRS+QRGYLELDL+LGKW ED+I+++DE  ++ LV +L+ ENPDLW WLTGQ   P 
Sbjct  22   RILYRSRQRGYLELDLLLGKWAEDNINNLDENRLQELVDLLEGENPDLWNWLTGQAEVPA  81

Query  399  GIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  560
             +  N VF ++  +I  NL  +++P+TRA  G+ WVRGWDD  R    P AGNQ
Sbjct  82   ALAENSVFAAIKGQIAENLSTYSSPQTRAQPGKPWVRGWDD-NRKIGGPQAGNQ  134



>ref|XP_001694005.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02941.1| predicted protein [Chlamydomonas reinhardtii]
Length=173

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = +3

Query  144  SFSRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIK  323
            S+S    +  G     EE +R + N+LLYRSKQRG+LELDL++G W E +I  M    + 
Sbjct  30   SYSTSADTVNGQQHVSEERRRGIANKLLYRSKQRGFLELDLLMGLWAEANIPKMTMAELN  89

Query  324  ALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSW  503
             +  VLD ENPDL+KWLTGQ  AP+ ++ NPVF ++ + +   L   A P+TRA  G+ W
Sbjct  90   QMAFVLDEENPDLFKWLTGQLQAPEHMQKNPVFVAIQSHVAQQLQDSAPPQTRAPAGRDW  149

Query  504  VRGWDDFKRGR  536
            VRGWDD  RG+
Sbjct  150  VRGWDDGWRGQ  160



>ref|XP_009604827.1| PREDICTED: uncharacterized protein LOC104099523 [Nicotiana tomentosiformis]
Length=138

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 85/114 (75%), Gaps = 13/114 (11%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTN----QTSPIPSN---RPLLGSFSRLCSSNLG-----IDL  185
            MA  RR+L+ +  RIL N +N     TS +PS+   RPL G+FSR  +SN       IDL
Sbjct  1    MANLRRALLFTIPRIL-NSSNGTSVATSTLPSHNLYRPLTGTFSRFITSNEASSPNNIDL  59

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDV  347
            S+EE+KRRL NRL+YRSKQRGYLELDL+LGKWVE+HI SMDE GIK+LVHVLD+
Sbjct  60   SNEESKRRLFNRLIYRSKQRGYLELDLVLGKWVEEHIQSMDENGIKSLVHVLDL  113



>ref|XP_009770861.1| PREDICTED: uncharacterized protein LOC104221491, partial [Nicotiana 
sylvestris]
Length=71

 Score =   124 bits (311),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  348  ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFK  527
            ENPDLWKWLTGQE  PD I TNPVF++V  K+MNNLDKHA+PETRA  G+ WVRGWDD K
Sbjct  1    ENPDLWKWLTGQEQPPDAISTNPVFSAVREKVMNNLDKHASPETRAVPGKPWVRGWDDIK  60

Query  528  RGRDSPIAGNQ  560
            RGRD+PIAGNQ
Sbjct  61   RGRDAPIAGNQ  71



>ref|XP_009622307.1| PREDICTED: uncharacterized protein LOC104113746 [Nicotiana tomentosiformis]
Length=78

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  348  ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFK  527
            ENPDLWKWLTGQE  PD I TNPVF++V  K+MNNLDKHA+PETRA  G+ WVRGWDD K
Sbjct  8    ENPDLWKWLTGQEQPPDAIITNPVFSAVREKVMNNLDKHASPETRAVPGKPWVRGWDDIK  67

Query  528  RGRDSPIAGNQ  560
            RGRD+PIAGNQ
Sbjct  68   RGRDAPIAGNQ  78



>ref|XP_009768410.1| PREDICTED: uncharacterized protein LOC104219416 [Nicotiana sylvestris]
Length=169

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 82/113 (73%), Gaps = 12/113 (11%)
 Frame = +3

Query  42   MAITRRSLVSSFARILLNPTNQTSPIPSN-------RPLLGSFSRLCSSNLG----IDLS  188
            MA  RR+L+ +  RIL N +N TS  PS        RPL G+FSR  SSN      IDLS
Sbjct  1    MANLRRALLFTIPRIL-NSSNGTSVAPSTLPFHNLYRPLAGTFSRFLSSNEASSPNIDLS  59

Query  189  DEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDV  347
            +EE++RRL NRL+YRSKQRGYLELDL+LGKWVE+HI SMDE GI +LVHVLD+
Sbjct  60   NEESRRRLFNRLIYRSKQRGYLELDLVLGKWVEEHIQSMDENGISSLVHVLDL  112



>ref|XP_005644390.1| hypothetical protein COCSUDRAFT_67604 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19846.1| hypothetical protein COCSUDRAFT_67604 [Coccomyxa subellipsoidea 
C-169]
Length=124

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +3

Query  210  LVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEP  389
            LVNRLLYRSKQRG+LE+DL++G W E ++ SMD++ + A+  VLD ENPDL+KWLTGQE 
Sbjct  4    LVNRLLYRSKQRGFLEMDLLVGLWAERNLPSMDDSQLAAMETVLDQENPDLFKWLTGQEE  63

Query  390  APDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDF  524
            AP  ++ NP F  +   +   L  H      +  G+ WVRGWDD+
Sbjct  64   APQAMQANPAFVDMKHNVEERLAAHRDNAAMSQPGKDWVRGWDDW  108



>ref|XP_002956425.1| hypothetical protein VOLCADRAFT_66963 [Volvox carteri f. nagariensis]
 gb|EFJ42569.1| hypothetical protein VOLCADRAFT_66963 [Volvox carteri f. nagariensis]
Length=110

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +3

Query  210  LVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEP  389
            +VN+LLYRSKQRG+LELDL++G W E +I  MD   +K +  VL+ ENPDL+KWLTGQ  
Sbjct  1    MVNKLLYRSKQRGFLELDLLIGLWAEVNIPKMDFAELKQMALVLEEENPDLFKWLTGQLQ  60

Query  390  APDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDD  521
             PD +  N VF ++   +   L + A   TRA  G+ WVRGWDD
Sbjct  61   PPDRMSGNAVFEALRRHVAQQLSETAPATTRAALGRDWVRGWDD  104



>ref|XP_008239648.1| PREDICTED: uncharacterized protein LOC103338241, partial [Prunus 
mume]
Length=77

 Score =   111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  348  ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFK  527
            ENPDLWKWL GQE  P+ ++TNPVFT+V  K++NNL+ ++APETRAT GQ WVRGWDD K
Sbjct  7    ENPDLWKWLIGQEQPPEALKTNPVFTAVRNKVLNNLNSYSAPETRATPGQPWVRGWDDIK  66

Query  528  RGRDSPIAGNQ  560
            +G+  PI GNQ
Sbjct  67   KGQGGPITGNQ  77



>ref|XP_003056014.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59390.1| predicted protein [Micromonas pusilla CCMP1545]
Length=174

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = +3

Query  126  NRPLLGSFS---RLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHI  296
             +PL  S+S   +L + ++    ++ +  ++L NRLLYR+KQRG+LELD+++GKW + H+
Sbjct  33   QKPLFCSYSEKSQLHTDSVTPSYAERKHSKKLFNRLLYRAKQRGFLELDILVGKWAQRHL  92

Query  297  HSMDETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPE  476
             +  E  + +   VLD ENP+L+KWLTGQE  P  +  N  F S+   ++  +++ +   
Sbjct  93   INRSEEFMASFSEVLDEENPELFKWLTGQEYPPSRLANNLAFISLQVHVITIMNQKSHRG  152

Query  477  TRATTGQSWVRGWDD  521
             RA  G SW+RGW D
Sbjct  153  ARAEAGHSWLRGWSD  167



>ref|XP_007515400.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14279.1| predicted protein [Bathycoccus prasinos]
Length=214

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 83/134 (62%), Gaps = 8/134 (6%)
 Frame = +3

Query  168  NLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHS--MDETGIKALVHVL  341
            N   D   EE ++RL+N+ LYR+KQRG+LELD+++G+W E ++++    ++ +     VL
Sbjct  86   NNNYDEEKEEHRKRLINKTLYRAKQRGFLELDVVVGEWAERNLNAKTTSDSFLTQFAKVL  145

Query  342  DVENPDLWKWLTGQEPAPDGIR-TNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            + ENPDL+ +LTGQ  AP  +R  N  + ++   +M  LD+ +  +TRA  G+ WVRGW+
Sbjct  146  EEENPDLYSYLTGQSEAPKYLREENEAYKALKAHVMKFLDEKSDEKTRAKFGKEWVRGWN  205

Query  519  DFKRGRDSPIAGNQ  560
            D      S   GNQ
Sbjct  206  D-----GSSEGGNQ  214



>tpg|DAA42045.1| TPA: hypothetical protein ZEAMMB73_302044, partial [Zea mays]
Length=76

 Score =   103 bits (257),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +3

Query  336  VLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGW  515
            ++  ENPDLWKWLT QE  P+ + +NPVF+++ +K+ +NL KHA+PETR+T GQ WVRGW
Sbjct  2    LIPQENPDLWKWLTSQEQPPEDLISNPVFSAIKSKVTDNLIKHASPETRSTPGQPWVRGW  61

Query  516  DDFKRGRDSPIAGNQ  560
            DD K+G+D P  GNQ
Sbjct  62   DDIKKGKDGPNYGNQ  76



>ref|XP_005845121.1| hypothetical protein CHLNCDRAFT_137510 [Chlorella variabilis]
 gb|EFN53019.1| hypothetical protein CHLNCDRAFT_137510 [Chlorella variabilis]
Length=141

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 1/109 (1%)
 Frame = +3

Query  198  AKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLT  377
            A+ RLVNRLLYRS+QRG+LELDL++G W E  +  M    ++    VL  ENPD++KWLT
Sbjct  7    AQPRLVNRLLYRSRQRGFLELDLLVGMWAEKELPQMSVEQMREFEVVLGQENPDMFKWLT  66

Query  378  GQEPAPDGIRTNPVFTSVHTKIMNNLDK-HAAPETRATTGQSWVRGWDD  521
             Q  AP+ +R N  F ++   +    D+ H+ P       + WVRGW D
Sbjct  67   AQAEAPEELRHNRTFAALQAHVQALRDRHHSVPRAAGEAPKEWVRGWSD  115



>gb|KIZ01550.1| hypothetical protein MNEG_6410 [Monoraphidium neglectum]
Length=198

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 71/124 (57%), Gaps = 0/124 (0%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
            C  +      +E  +R+L ++LLYRSKQRG+LELDL++G W E+ +  M    +     V
Sbjct  44   CPYSTAAGPENEAERRKLASKLLYRSKQRGFLELDLLVGLWAEEKLPMMTIAALTEFGAV  103

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            LD ENPDL+KWLTGQ P P  +  N  + ++ + +   L  +      A  G+ WVRGWD
Sbjct  104  LDEENPDLFKWLTGQLPTPPHLAANQQYMALKSHVDAQLSDNLHRAAAAAAGRDWVRGWD  163

Query  519  DFKR  530
            D  R
Sbjct  164  DPGR  167



>ref|XP_003074399.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL50250.1| Flavinator of succinate dehydrogenase [Ostreococcus tauri]
Length=148

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 74/124 (60%), Gaps = 13/124 (10%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKW----VEDHIHSMDETGIKALVHVLDVENPDLWK  368
            KR  +NR LYR++QRG+LELD+++G W    ++    SM+   + A   VL  ENP+L+K
Sbjct  34   KRARINRALYRARQRGFLELDIVVGAWATRTLDPETASME--FLDAFDEVLRAENPELFK  91

Query  369  WLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPI  548
            WLTGQE AP  +  N  + S+       LD+ ++ +TRA  G+ W+RGW+D         
Sbjct  92   WLTGQERAPRAMAENAAYASLAEHCKKFLDEKSSADTRAAYGREWIRGWND-------SG  144

Query  549  AGNQ  560
            AGNQ
Sbjct  145  AGNQ  148



>ref|XP_002507517.1| hypothetical protein MICPUN_113604 [Micromonas sp. RCC299]
 gb|ACO68775.1| hypothetical protein MICPUN_113604 [Micromonas sp. RCC299]
Length=157

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            +N+L+YR+KQRG+LELD+++G W E ++ S  +        +LD ENP+L++WLT QE  
Sbjct  53   LNKLIYRAKQRGFLELDILIGTWAECNLSSRSQGFWAEFSEILDEENPELFRWLTCQEQP  112

Query  393  PDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDD  521
            P  +  N  F S+H    + + +    ETRA  G  WVRGWDD
Sbjct  113  PPRMTRNRAFISLHAYTSSLMRRKCDRETRALKGHHWVRGWDD  155



>gb|KHN23465.1| hypothetical protein glysoja_045738 [Glycine soja]
Length=92

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  171  LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSM  305
            L IDLS+EE+KR L N+LLYRSKQRG+LELDL+LGKWVE   HS+
Sbjct  46   LEIDLSNEESKRHLFNQLLYRSKQRGFLELDLVLGKWVEAGQHSL  90



>gb|KJB40073.1| hypothetical protein B456_007G045300 [Gossypium raimondii]
 gb|KJB40074.1| hypothetical protein B456_007G045300 [Gossypium raimondii]
Length=95

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 8/75 (11%)
 Frame = +3

Query  102  NQTSPIPSNRPLLGSFSRLCSSN------LGIDLSDEEAKRRLVNRLLYRSKQRGYLELD  263
            N+T+ I   RP  G  SR  S+N      L +DLS  E+KRRL NRLLYRS+QRG+LELD
Sbjct  20   NRTTTII--RPQYGWVSRFSSTNISNAQSLEMDLSTGESKRRLFNRLLYRSQQRGFLELD  77

Query  264  LILGKWVEDHIHSMD  308
            L+LGKWV      M+
Sbjct  78   LVLGKWVSTPWMKME  92



>ref|XP_001415883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94175.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=85

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  318  IKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  497
            + AL  VLDVENP+L+KWLT QE AP  +R N  + S+       LD+ ++  +RA  G+
Sbjct  12   LDALDAVLDVENPELFKWLTAQETAPREMRENEAYASLAAHCAKFLDEKSSEASRAAHGR  71

Query  498  SWVRGWDDFKRG  533
             W+RGW+D   G
Sbjct  72   EWIRGWNDSGAG  83



>ref|WP_010703780.1| hypothetical protein [Bartonella schoenbuchensis]
 emb|CBI82253.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
 gb|ENN91761.1| hypothetical protein m07a_06440 [Bartonella schoenbuchensis m07a]
 emb|CDP80136.1| Flavinator of succinate dehydrogenase [Bartonella schoenbuchensis]
Length=96

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            +N  ID +   A+RR   RL++R+  RG  E+DLILG++V+ HI  M +  I  L +++ 
Sbjct  2    TNFVIDKNQLNARRR---RLIFRAWHRGIREMDLILGQYVDSHIIEMSDETISELEYIMS  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             E+ DL  W+TG+ P P  +  +P+F  +
Sbjct  59   FEDRDLLMWITGEIPTPSEV-DSPLFRDI  86



>ref|WP_008039513.1| hypothetical protein [Bartonella tamiae]
 gb|EJF88728.1| hypothetical protein ME5_01279 [Bartonella tamiae Th239]
 gb|EJF95022.1| hypothetical protein MEG_00603 [Bartonella tamiae Th307]
Length=97

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            RL++R+  RG  E+DLILG++V+ ++H M+E  IK +  ++  E+ DL  W+TG+  +P+
Sbjct  17   RLVFRAWHRGIKEMDLILGQYVDKYVHQMNEETIKEMEFIMSFEDRDLLTWVTGEVASPE  76

Query  399  GIRTNPVFTSV  431
             I T P+F  +
Sbjct  77   TINT-PLFQDI  86



>ref|WP_013545055.1| hypothetical protein [Bartonella clarridgeiae]
 emb|CBI76416.1| conserved protein of unknown function [Bartonella clarridgeiae 
73]
Length=96

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 56/89 (63%), Gaps = 4/89 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            +NL ID +  +++RR   RL++R+  RG  E+DLILG++V+ HI  M++  +  L +++ 
Sbjct  2    TNLAIDENQLDSRRR---RLIFRAWHRGIREMDLILGQYVDAHIAKMNDQTVSELEYIMS  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             E+ DL  W+TG+   P  +  +P+F  +
Sbjct  59   FEDRDLLTWITGEVSVPYKV-DSPLFRDI  86



>emb|CCA27700.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=186

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 53/95 (56%), Gaps = 9/95 (9%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            S++E K     RLLYRS+QRG+LE+DL+LG W +  +  + E  +     +L+ E  D++
Sbjct  80   SEDEVKLARKKRLLYRSRQRGWLEVDLLLGSWTQKSVEGLQEAELDHFEAILNQETIDIY  139

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAA  470
             ++T Q P P  + TN         +M+ L ++ A
Sbjct  140  NYITKQRPIPSELDTN---------VMHRLQEYCA  165



>ref|WP_012169751.1| hypothetical protein [Azorhizobium caulinodans]
 dbj|BAF87218.1| uncharacterized conserved protein [Azorhizobium caulinodans ORS 
571]
Length=98

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 56/93 (60%), Gaps = 9/93 (10%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
              S+ G+D+     +RR   R++YR+  RG  E+DLI+G++ + +I ++ E  +    H+
Sbjct  5    VKSSAGLDV-----RRR---RIIYRAWHRGTREMDLIMGRFADANIETLTEAEVDIFEHL  56

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHT  437
            L++E+PDL+ WL+G  P P  + T P F  + T
Sbjct  57   LEIEDPDLFSWLSGSLPVPAELDT-PFFRKIQT  88



>ref|WP_007477238.1| hypothetical protein [Bartonella melophagi]
 gb|EJF90174.1| hypothetical protein ME3_00726 [Bartonella melophagi K-2C]
Length=96

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            +N  ID +    +RR   RL++R+  RG  E+DLILG++V+ HI  M +  I  L +++ 
Sbjct  2    TNFVIDKNQLNTRRR---RLIFRAWHRGIREMDLILGQYVDSHIIRMSDETISELEYIMS  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             E+ DL  W+TG+ P P  +  +P+F  +
Sbjct  59   FEDRDLLMWITGEIPTPSEV-DSPLFRDI  86



>ref|WP_029005817.1| hypothetical protein [Azorhizobium doebereinerae]
Length=103

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (57%), Gaps = 9/93 (10%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
              S+ G+D+     +RR   R+L+R+  RG  E+DLI+G++ +  I  + E  I    H+
Sbjct  5    VKSSAGLDV-----RRR---RILFRAWHRGTREMDLIMGRFADAEIEGLSEAEIDVFEHL  56

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHT  437
            L+VE+PDL+ W++G  P P  + T P F  +  
Sbjct  57   LEVEDPDLFAWVSGSLPVPAALDT-PFFRKIQA  88



>ref|WP_010701226.1| hypothetical protein [Bartonella bovis]
 gb|ENN92364.1| hypothetical protein BBbe_06730 [Bartonella bovis 91-4]
 gb|ENN93643.1| hypothetical protein m02_06580 [Bartonella bovis m02]
Length=96

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            +N  ID +   A+RR   RL++R+  RG  E+DLILG++V+ HI  M +  I  L +++ 
Sbjct  2    TNFVIDKNQLNARRR---RLIFRAWHRGIREMDLILGQYVDSHIIEMSDETISELEYIMS  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             E+ DL  W+TG+   P  +  +P+F  +
Sbjct  59   FEDRDLLMWITGEISTPSDV-DSPLFRDI  86



>ref|WP_024707839.1| hypothetical protein [Martelella sp. AD-3]
Length=100

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D + +RR   R+L+R   RG  E+DLILG++ E+++  MD+  + AL  ++  E+ DL 
Sbjct  9    ADLDPRRR---RILFRCWHRGIREMDLILGQFAEENLAGMDDETLTALETIMAEEDNDLI  65

Query  366  KWLTGQEPAPDGIRTNPVFTSV  431
            KW+ G E APD +R  P+F  +
Sbjct  66   KWINGAEAAPDHVRI-PLFERI  86



>ref|XP_005781647.1| hypothetical protein EMIHUDRAFT_434617 [Emiliania huxleyi CCMP1516]
 gb|EOD29218.1| hypothetical protein EMIHUDRAFT_434617 [Emiliania huxleyi CCMP1516]
Length=160

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 18/118 (15%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHI-----------HSMDET-GIKALVHVLD  344
            KRR   +LLYRSKQRG+LE+D++LG W                H    T  +     +++
Sbjct  49   KRR--RQLLYRSKQRGWLEMDIMLGGWARRPCPGRRRLPDVPPHPPHSTPALTQFAEIIE  106

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWD  518
            +ENPDL+ WLTGQ+  PD I +NP+  ++  ++    + +A   T  +TG    + W+
Sbjct  107  MENPDLYCWLTGQQDVPDDI-SNPLLRTLCAELK---ESYAPKATLRSTGSFEGKVWE  160



>ref|WP_036260985.1| hypothetical protein [Methylocapsa aurea]
Length=98

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 9/93 (10%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+RR   R+L+RS  RG  E+DLILG++V+  I  +DE+ +     +++ ++ D++ WL
Sbjct  12   DARRR---RVLFRSWHRGMREVDLILGRFVDVEIAKLDESELDDYEALMEAQDRDIFSWL  68

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAP  473
            TG+ P P G    PVF  +          HAAP
Sbjct  69   TGEAPTP-GQYDTPVFRKIRA-----FHAHAAP  95



>emb|CCC90966.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=147

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 70/149 (47%), Gaps = 10/149 (7%)
 Frame = +3

Query  21   LLEERKTMAITRRSLVSSFARILLN--PTNQTSPIPSNRPLLGSFSRLCSSNLGIDLSDE  194
            +L    T  +TR       A++L +  P    +P+     L     R+ SS        E
Sbjct  1    MLRRLSTRLVTRAQRHEELAKMLRDGPPVLAKAPVAGEGCLTFRDVRVVSSG-----EAE  55

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            EAKRR   RLLY+S  RG  E+D+ILG +   HI S+    ++    +L   + DL+KWL
Sbjct  56   EAKRR---RLLYQSTYRGMTEMDIILGAYARRHIQSLSSPQLQEYDTILRHFDNDLYKWL  112

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNNLDK  461
               E AP  +   P + S+H  + +  ++
Sbjct  113  VMDEVAPAELVALPTYQSLHRFVRDEREQ  141



>emb|CBI79302.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
Length=96

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            +NL I+ +  +++RR   RL++R+  RG  E+DLI G++V+ HI+ M +  +  L +++ 
Sbjct  2    TNLAINENQLDSRRR---RLIFRAWHRGIREIDLIFGQYVDAHINKMSDQTVSKLEYIMS  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             E+ DL  W+TG+   P  + + P+F  +
Sbjct  59   FEDRDLLTWITGEVSVPSEVDS-PLFRDI  86



>ref|WP_004597938.1| hypothetical protein [Rickettsia prowazekii]
 ref|NP_220967.1| hypothetical protein RP599 [Rickettsia prowazekii str. Madrid 
E]
 emb|CAA15043.1| unknown [Rickettsia prowazekii str. Madrid E]
 gb|ADE30136.1| Tetratricopeptide repeat-containing protein [Rickettsia prowazekii 
str. Rp22]
 gb|AFE53021.1| hypothetical protein MA5_04235 [Rickettsia prowazekii str. GvV257]
 gb|AFE53593.1| hypothetical protein MA7_02865 [Rickettsia prowazekii str. RpGvF24]
 gb|AFE49399.1| hypothetical protein M9W_02870 [Rickettsia prowazekii str. Chernikova]
 gb|AFE50243.1| hypothetical protein M9Y_02875 [Rickettsia prowazekii str. Katsinyian]
 gb|AFE51089.1| hypothetical protein MA1_02865 [Rickettsia prowazekii str. BuV67-CWPP]
 gb|AFE51925.1| hypothetical protein MA3_02910 [Rickettsia prowazekii str. Dachau]
 gb|AGJ01745.1| hypothetical protein H374_4600 [Rickettsia prowazekii str. NMRC 
Madrid E]
 gb|AGJ02241.1| Tetratricopeptide repeat-containing protein [Rickettsia prowazekii 
str. Breinl]
 gb|EOB09976.1| Tetratricopeptide repeat-containing protein [Rickettsia prowazekii 
str. GvF12]
 gb|EOB10869.1| hypothetical protein H377_1700 [Rickettsia prowazekii str. Cairo 
3]
Length=87

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK+RG  E+D ILG++ E ++ SMDE  +K+   +LD  + DL+ W+  
Sbjct  6    KNALQKKLFYRSKKRGCREMDYILGRFAEKYLSSMDEKKLKSYTLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KPSAP  70



>emb|CCI50500.1| unnamed protein product [Albugo candida]
Length=165

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +++ AK     RLLYRS+QRG+LE+DL+LG W + +I  + E  +     +L+ E  D++
Sbjct  59   ANDSAKIARKKRLLYRSRQRGWLEVDLLLGSWTQKNIDGLQEGELNDFEAILNQETIDIY  118

Query  366  KWLTGQEPAPDGIRTN  413
             ++T Q P P  + TN
Sbjct  119  NYITKQRPIPSELDTN  134



>ref|WP_015452777.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gb|ACT57419.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter 
asiaticus str. psy62]
 gb|AGH17182.1| hypothetical protein WSI_04060 [Candidatus Liberibacter asiaticus 
str. gxpsy]
 gb|EXU77991.1| hypothetical protein CD16_04470 [Candidatus Liberibacter asiaticus]
 dbj|BAP26710.1| hypothetical protein CGUJ_04225 [Candidatus Liberibacter asiaticus 
str. Ishi-1]
 gb|KIH96064.1| hypothetical protein RH08_04190 [Candidatus Liberibacter asiaticus]
Length=98

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            +++YR  +RG  E+DLILG +V+  I  +    +  L  +++ ++ +L+KW TG E  P+
Sbjct  11   KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE  70

Query  399  GIRTNPVFTSVHTKIMNNLDK  461
             +RT P+F  ++    NNLD+
Sbjct  71   YLRT-PIFKKIYDYYSNNLDR  90



>ref|WP_018391021.1| hypothetical protein [Ancylobacter sp. FA202]
Length=98

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+RR   R+LYRS  RG  E+DL++G++ +  I  + E  + A   +++VE+PDL+ WL
Sbjct  12   DARRR---RILYRSWHRGTREMDLLMGRFADACIGELSEEDVAAFEQLIEVEDPDLYGWL  68

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPE  476
             G  PAP+     P+F   H     +L     PE
Sbjct  69   GGAPPAPE--FDTPLF---HRFRQFHLSGEGVPE  97



>ref|WP_022712338.1| hypothetical protein [Pseudochrobactrum sp. AO18b]
Length=100

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 6/87 (7%)
 Frame = +3

Query  150  SRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKAL  329
            S+L  +  G  L   + +RR   +LL+RS  RG  E+DLI G++ + HI +MDE  +   
Sbjct  5    SKLSGTEAGAQL---DPRRR---KLLFRSWHRGMKEMDLIFGQYADMHIATMDEDTLNEF  58

Query  330  VHVLDVENPDLWKWLTGQEPAPDGIRT  410
              +L+V + DL+KW+TG++  P+   T
Sbjct  59   ERLLEVLDRDLFKWITGEDKTPEAFDT  85



>ref|WP_036553171.1| hypothetical protein [Nisaea denitrificans]
Length=86

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +3

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
             +L+YRS   G  E DL+LG +   HI  +DE G+     +L++ +P L+KW+TGQE AP
Sbjct  9    KKLIYRSAYTGTKETDLLLGAFARTHIADLDEEGLDTYETLLEIPDPRLYKWITGQEEAP  68

Query  396  DGIRTNPVFTSV  431
            +   T P+   +
Sbjct  69   EEYET-PILDMI  79



>ref|XP_005836517.1| hypothetical protein GUITHDRAFT_151400, partial [Guillardia theta 
CCMP2712]
 gb|EKX49537.1| hypothetical protein GUITHDRAFT_151400, partial [Guillardia theta 
CCMP2712]
Length=133

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  222  LLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEP  389
            L+YRS+Q G+LE DLI+G+W E ++  + +  IK    ++  E  D+++W+ GQ+P
Sbjct  77   LIYRSRQTGWLETDLIMGRWAEANVEKLTDAEIKEYCKIVQCEIIDIFQWIVGQKP  132



>ref|WP_035376784.1| hypothetical protein, partial [Acetobacter nitrogenifigens]
Length=104

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+RR   +LL+R++ RG  E D+++G +VE +  +MD   +  +  VL++ +PDL  WL
Sbjct  25   DARRR---KLLFRARHRGTFETDILIGGFVERNAQTMDSAALDDMEAVLEIPDPDLADWL  81

Query  375  TGQEPAPD  398
            TG+ P P+
Sbjct  82   TGRMPLPE  89



>ref|XP_009833593.1| hypothetical protein H257_09161 [Aphanomyces astaci]
 gb|ETV76681.1| hypothetical protein H257_09161 [Aphanomyces astaci]
Length=176

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
             SS   ID+  + A R+   R++YRSKQRG+LE+DL++G+W  +++ ++    ++    +
Sbjct  64   ASSQGDIDIDADTANRK---RVIYRSKQRGWLEVDLLMGRWASENVWTLTADELQQYEDI  120

Query  339  LDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNN  452
            L+ E  D++ +++G++  P+ + T PV   +     +N
Sbjct  121  LNRETIDIFNFISGKDAIPEEVNT-PVMKRIQDFCFSN  157



>emb|CBH11749.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
Length=146

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            EAKRR   RLLY+S  RG +E+D+ILG +   +I ++    ++    VL   + DL+KWL
Sbjct  55   EAKRR---RLLYQSTYRGMVEMDIILGAFARQNIETLSAPQLEEYDAVLRHFDNDLYKWL  111

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNNLDK  461
                 AP  +   PVF S+H+ + +  +K
Sbjct  112  VMDVEAPAEVAQIPVFQSLHSFVRDEREK  140



>ref|XP_845372.1| hypothetical protein [Trypanosoma brucei brucei TREU927]
 gb|AAX80883.1| hypothetical protein, conserved [Trypanosoma brucei]
 gb|AAZ11813.1| hypothetical protein, conserved [Trypanosoma brucei brucei TREU927]
Length=146

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            EAKRR   RLLY+S  RG +E+D+ILG +   +I ++    ++    VL   + DL+KWL
Sbjct  55   EAKRR---RLLYQSTYRGMVEMDIILGAFARQNIETLSAPQLEEYDAVLRHFDNDLYKWL  111

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNNLDK  461
                 AP  +   PVF S+H+ + +  +K
Sbjct  112  VMDVEAPAEVAQIPVFQSLHSFVRDEREK  140



>ref|WP_025047688.1| hypothetical protein [Sulfitobacter mediterraneus]
 gb|KIN78012.1| Sdh5 domain containing protein [Sulfitobacter mediterraneus KCTC 
32188]
Length=92

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            EE +   V RL  RS +RG  E+DLIL  +  DH+ +MD+ G+    ++L+  + DL++W
Sbjct  3    EELRAHKVKRLHMRSMRRGIKEMDLILSAYAADHLETMDDAGLTLYDNMLNENDHDLYQW  62

Query  372  LTGQEPAPD  398
            +TGQ   PD
Sbjct  63   VTGQVAVPD  71



>ref|WP_037909588.1| hypothetical protein [Sulfitobacter mediterraneus]
 gb|KAJ02343.1| hypothetical protein PM02_14140 [Sulfitobacter mediterraneus]
Length=92

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            EE +   V RL  RS +RG  E+DLIL  +  DH+ +MD+ G+    ++L+  + DL++W
Sbjct  3    EELRAHKVKRLHMRSMRRGIKEMDLILSAYAADHLETMDDAGLTLYDNMLNENDHDLYQW  62

Query  372  LTGQEPAPD  398
            +TGQ   PD
Sbjct  63   VTGQVAVPD  71



>gb|AFK53465.1| Succinate dehydrogenase assembly factor [Tistrella mobilis KA081020-065]
Length=102

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 8/97 (8%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
             D E +RR   RL Y+S  RG  E D++ GK+ +  I   D   + A   +LD  + DL+
Sbjct  3    EDLEIRRR---RLRYQSWYRGCKETDILFGKFADAWIDRFDADQLDAFEALLDESDVDLY  59

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPE  476
             WL+G+EP P+ +  NPV      K+M   D   AP+
Sbjct  60   NWLSGREPLPEDLADNPV-----MKMMMQFDVATAPD  91



>ref|XP_004347184.1| TPR repeat region protein, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21802.1| TPR repeat region protein, partial [Acanthamoeba castellanii 
str. Neff]
Length=154

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            RLL+RSK+RG LE DLILG +   ++ +M+ET +     +LD  +PDL+ +LT +   P 
Sbjct  65   RLLFRSKERGMLETDLILGSFAIQNLEAMNETQLAQFEQILDCIDPDLFLYLTKKVETPA  124

Query  399  GIRTNPVFTSVHTKIMNN  452
             +  N V  ++     NN
Sbjct  125  EL-DNEVMHAIQKHTFNN  141



>ref|WP_027486486.1| hypothetical protein [Rhizobium undicola]
Length=97

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            + L +  +D + +RR   R+LYR   RG  E+DLILG++ E  I ++ E  +  L  ++ 
Sbjct  2    TGLVLSSADLDPRRR---RILYRCWHRGIREMDLILGQFAEAEIATLSEVELDELELIMA  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             E+ DL KW+ G EP P+  +T P+FT V
Sbjct  59   EEDNDLIKWINGAEPVPERHQT-PMFTRV  86



>ref|WP_018687838.1| MULTISPECIES: hypothetical protein [Ahrensia]
Length=91

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 4/79 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+R+   R  +RS  RG  E+D+ILG + + HI+ + E+ +  L  ++D  + DL+KW 
Sbjct  8    DARRK---RARFRSWHRGMKEMDMILGGYADAHINDISESDLTILEDLMDSLDRDLFKWF  64

Query  375  TGQEPAPDGIRTNPVFTSV  431
            TG+ P PD   T PVF  +
Sbjct  65   TGEGPVPDEFNT-PVFHKI  82



>ref|WP_011191033.1| hypothetical protein [Rickettsia typhi]
 emb|CAC33733.1| hypothetical protein [Rickettsia typhi]
 gb|AAU04052.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
 gb|AFE54431.1| hypothetical protein RTTH1527_02830 [Rickettsia typhi str. TH1527]
 gb|AFE55269.1| hypothetical protein RTB9991CWPP_02830 [Rickettsia typhi str. 
B9991CWPP]
Length=90

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK+RG  E+D ILG + E ++  MDE  +K    +LD  + DL+ W+  
Sbjct  6    KNALQKKLFYRSKKRGCREMDYILGSFAEKYLSFMDEKTLKRYTLILDQNDNDLYNWINN  65

Query  381  QEPAPDGIRTNPV  419
            +  AP  I +  +
Sbjct  66   KSSAPSYIDSEII  78



>ref|WP_027673296.1| hypothetical protein [Agrobacterium larrymoorei]
Length=103

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 4/82 (5%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D E +RR   R+LYR   RG  E+DL+LG++ ED+I  + E  +  L  ++  E+ DL 
Sbjct  9    ADLEPRRR---RILYRCWHRGIREMDLVLGQFAEDNIGDLSEAELDELEVIMAEEDNDLV  65

Query  366  KWLTGQEPAPDGIRTNPVFTSV  431
            K +TG  P P+  +T P+FT +
Sbjct  66   KMVTGASPIPEKFQT-PLFTKI  86



>ref|WP_019404098.1| hypothetical protein [Chelatococcus sp. GW1]
Length=98

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = +3

Query  180  DLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPD  359
            D SD   +RR   R+LYR+  RG  E+DLI+G++ + H+  +DE  I     ++++ + D
Sbjct  7    DDSDLAMRRR---RILYRAWHRGMREMDLIMGRFADAHVAELDEGEIAEFERLIELIDKD  63

Query  360  LWKWLTGQEPAPDGIRTNPVF  422
            L+ W++G EP P    T P+F
Sbjct  64   LFSWISGSEPVPAAYDT-PLF  83



>ref|XP_002903388.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY55812.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=172

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +3

Query  159  CSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHV  338
             SS    D+  +EA R+   R++YRSKQRG+LE+DL+LG+W   ++  +    +K    +
Sbjct  60   ASSQGDHDVDSDEANRK---RIIYRSKQRGWLEVDLLLGRWASQNVMQLSSDELKQYEDI  116

Query  339  LDVENPDLWKWLTGQEPAP  395
            L+ E  D++ +++G+   P
Sbjct  117  LNEETIDIFNYISGKSAVP  135



>ref|WP_016830859.1| hypothetical protein [Rickettsia conorii]
Length=87

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +LLYRSK RG  E+D ILG + E ++  MDET + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLLYRSKNRGCREMDYILGSFAEKYLSLMDETQLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_018063308.1| hypothetical protein [Martelella mediterranea]
Length=100

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 4/82 (5%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D + +RR   R+L+R+  RG  E+DLILG++ ED+I  MD+  +     ++  E+ DL 
Sbjct  9    ADLDPRRR---RMLFRAWHRGIREMDLILGQYAEDNIADMDDATLDQFETIMAEEDADLI  65

Query  366  KWLTGQEPAPDGIRTNPVFTSV  431
             W+ G  P P+ +R   +F S+
Sbjct  66   AWINGASPVPEHLRMK-LFESI  86



>ref|WP_007798034.1| hypothetical protein [Pelagibaca bermudensis]
 gb|EAU46566.1| TPR repeat family protein [Roseovarius sp. HTCC2601]
Length=86

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            + RL  RS +RG  E+D+IL ++ +  + +MD   + A   +L+  + DL++W++GQ PA
Sbjct  9    LKRLTMRSMRRGIKEMDIILMRYADARLAAMDAAQLDAYEALLEENDQDLYQWVSGQRPA  68

Query  393  PDGIRTNPVFTSVHTKIMN  449
            P+ +R  P+ T +     N
Sbjct  69   PEALR--PLITDISQVACN  85



>gb|ESR26581.1| hypothetical protein N177_0800 [Lutibaculum baratangense AMV1]
Length=108

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
             RLLYR   RG  E+DL+LG++ E +I  MDE  +  L  +++V+  +L+ WLT  +P P
Sbjct  26   RRLLYRCWHRGTREMDLLLGRYAEVYIAGMDEAQLGDLETLMEVDEKELFAWLTETKPMP  85

Query  396  DG  401
            DG
Sbjct  86   DG  87



>ref|XP_007313875.1| hypothetical protein SERLADRAFT_342967 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO29633.1| hypothetical protein SERLADRAFT_342967 [Serpula lacrymans var. 
lacrymans S7.9]
Length=102

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 8/93 (9%)
 Frame = +3

Query  210  LVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEP  389
            L  RLLY+S++RG LE DL+L  +  DH+ +MDE  +K    +LD  + D++ W TG+  
Sbjct  12   LRARLLYQSRKRGTLESDLLLSTFARDHLAAMDEAELKEYDRLLDEPDWDIYYWSTGKRT  71

Query  390  APDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  488
             P+           H+ I+  L  HA  E R  
Sbjct  72   PPERW--------AHSAILEKLSVHAKNEGRVV  96



>ref|WP_040485112.1| hypothetical protein [Lutibaculum baratangense]
Length=94

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
             RLLYR   RG  E+DL+LG++ E +I  MDE  +  L  +++V+  +L+ WLT  +P P
Sbjct  12   RRLLYRCWHRGTREMDLLLGRYAEVYIAGMDEAQLGDLETLMEVDEKELFAWLTETKPMP  71

Query  396  DG  401
            DG
Sbjct  72   DG  73



>ref|WP_004997963.1| MULTISPECIES: hypothetical protein [spotted fever group]
 gb|EAA26343.1| hypothetical protein rsib_orf1185 [Rickettsia sibirica 246]
 gb|ACP53699.1| Tetratricopeptide repeat-containing protein [Rickettsia africae 
ESF-5]
 gb|AEV92463.1| Tetratricopeptide repeat-containing protein [Rickettsia slovaca 
13-B]
 gb|AFC75095.1| Tetratricopeptide repeat-containing protein [Rickettsia parkeri 
str. Portsmouth]
 gb|AFD19922.1| Tetratricopeptide repeat-containing protein [Rickettsia slovaca 
str. D-CWPP]
Length=87

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDET + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDETKLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_014130575.1| hypothetical protein [Pelagibacterium halotolerans]
 gb|AEQ51426.1| hypothetical protein KKY_1404 [Pelagibacterium halotolerans B2]
Length=90

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            R LYR++ RG  E+D+++G +V DH+ ++D   +  L  ++D E  DL  WL GQ   PD
Sbjct  13   RALYRAQHRGTQEMDILIGGFVADHLDTLDAEMLDRLEALMDHEETDLQAWLMGQSAIPD  72

Query  399  GIRTNPVFTSVHTKIMNN  452
                + + T  + KI  N
Sbjct  73   NTDRDLIDTIRNHKISQN  90



>ref|WP_004273267.1| hypothetical protein [Nitrospirillum amazonense]
 gb|EGY00832.1| hypothetical protein AZA_89193 [Nitrospirillum amazonense Y2]
Length=93

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +3

Query  183  LSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDL  362
            LS E+A      RL++RS  RG  E+DL++G + E H+ +     +    H+LD+ +PD+
Sbjct  6    LSPEDALAVRRKRLIFRSWHRGMKEMDLLMGTFAEKHVPAFTVEQLDRYEHLLDLNDPDV  65

Query  363  WKWLTGQEPAPDGIRTN  413
            + WL G+ P PD +  +
Sbjct  66   FDWLLGRAPFPDDLDAD  82



>ref|XP_009531410.1| hypothetical protein PHYSODRAFT_256191 [Phytophthora sojae]
 gb|EGZ13981.1| hypothetical protein PHYSODRAFT_256191 [Phytophthora sojae]
Length=134

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            EA R+   R++YRSKQRG+LE+DL+LG+W   ++ ++    ++    +L+ E  D++ ++
Sbjct  34   EANRK---RVIYRSKQRGWLEVDLLLGRWASQNVMALSSDELRQYEDILNEETIDIFNYI  90

Query  375  TGQEPAP  395
            +G+ P P
Sbjct  91   SGKSPVP  97



>ref|WP_006110548.1| hypothetical protein [Brucella abortus]
 gb|ENR90431.1| hypothetical protein C043_03153 [Brucella abortus 80/101]
Length=95

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            +LL+R+  RG  E+DLILG++ + +I S ++  +    H+L+V + DL KW+TG+ P P 
Sbjct  17   KLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWVTGESPIPA  76

Query  399  GIRTNPVFTSV  431
               T P+F  +
Sbjct  77   EYDT-PLFRDI  86



>ref|WP_034480686.1| hypothetical protein [Agrobacterium rhizogenes]
Length=104

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            + L +  +D + +RR   R+L+R   RG  E+DL+ G++ ++ +  + E  +  L  ++D
Sbjct  2    TGLTLSSADLDPRRR---RILFRCWHRGIREMDLVFGQFADNELPGLAEADLDELESIMD  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             E+ DL KW+ G EP P+ +RT P+F  +
Sbjct  59   EEDNDLVKWILGTEPTPEHLRT-PLFERI  86



>ref|WP_018974713.1| hypothetical protein [Rudaea cellulosilytica]
Length=80

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
              RL +R + RG  ELD +LG W++ H    DET   A   +L+  +P+LW+WL G   A
Sbjct  4    TGRLRWRCR-RGMRELDQLLGGWLDTHYARADETAKAAFAELLEQPDPELWRWLQGH-GA  61

Query  393  PDGIRTNPVFTSVHTK  440
            PD +R   +   + T+
Sbjct  62   PDDLRFRRIIDEIRTR  77



>ref|WP_002966054.1| MULTISPECIES: hypothetical protein [Brucella]
 ref|YP_008843822.1| cytoplasmic protein [Brucella ceti TE28753-12]
 gb|AAN33769.1| conserved hypothetical protein [Brucella suis 1330]
 gb|AAX76055.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 emb|CAJ12826.1| Protein of unknown function DUF339 [Brucella abortus 2308]
 gb|ABQ62377.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gb|ABX63757.1| protein of unknown function DUF339 [Brucella canis ATCC 23365]
 gb|ABY39565.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gb|ACD74112.1| Protein of unknown function DUF339 [Brucella abortus S19]
 gb|ACO02384.1| protein of unknown function DUF339 [Brucella melitensis ATCC 
23457]
 gb|ACU49703.1| hypothetical protein BMI_II574 [Brucella microti CCM 4915]
 gb|EEW81945.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gb|EEW89879.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gb|EEX57346.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gb|EEX60568.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59]
 gb|EEX63586.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gb|EEX79071.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gb|EEX84500.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gb|EEX85653.1| conserved hypothetical protein [Brucella ceti B1/94]
 gb|EEX88853.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gb|EEX96253.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gb|EEY01463.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gb|EEY02654.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gb|EEY05878.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gb|EEY24766.1| conserved hypothetical protein [Brucella sp. F5/99]
 gb|EEY27968.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gb|EEY31241.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gb|EEZ06691.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gb|EEZ09903.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. 
Ether]
 gb|EEZ16527.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 
63/9]
 gb|EEZ28999.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gb|EEZ34306.1| conserved hypothetical protein [Brucella sp. 83/13]
 gb|EFH32836.1| hypothetical protein BAYG_02362 [Brucella abortus bv. 5 str. 
B3196]
 gb|EFM55641.1| protein of unknown function DUF339 [Brucella inopinata BO1]
 gb|EFM59564.1| protein of unknown function DUF339 [Brucella sp. BO2]
 gb|EFM62154.1| protein of unknown function DUF339 [Brucella sp. NF 2653]
 gb|ADZ67801.1| conserved hypothetical protein [Brucella melitensis M28]
 gb|ADZ88669.1| conserved hypothetical protein [Brucella melitensis M5-90]
 gb|AEK56060.1| hypothetical protein BPI_II632 [Brucella pinnipedialis B2/94]
 gb|AEM20046.1| hypothetical protein BS1330_II0575 [Brucella suis 1330]
 gb|AEQ10256.1| hypothetical protein BMNI_II0546 [Brucella melitensis NI]
 gb|AEU07717.1| hypothetical protein BSVBI22_B0574 [Brucella suis VBI22]
 gb|AEW19344.1| hypothetical protein BAA13334_II01259 [Brucella abortus A13334]
 gb|AEW15389.1| hypothetical protein BCA52141_II0353 [Brucella canis HSK A52141]
 gb|EHR07966.1| hypothetical protein M19_02556 [Brucella abortus bv. 1 str. NI474]
 gb|EHR09259.1| hypothetical protein M17_02232 [Brucella abortus bv. 1 str. NI435a]
 gb|EHR11748.1| hypothetical protein M1A_01642 [Brucella abortus bv. 1 str. NI486]
 gb|EHR17503.1| hypothetical protein M1G_02552 [Brucella abortus bv. 1 str. NI010]
 gb|EHR18345.1| hypothetical protein M1I_02554 [Brucella abortus bv. 1 str. NI016]
 gb|EHR26134.1| hypothetical protein M1E_00384 [Brucella abortus bv. 1 str. NI488]
 gb|EHR26949.1| hypothetical protein M1K_02553 [Brucella abortus bv. 1 str. NI021]
 gb|EHR27602.1| hypothetical protein M1M_01838 [Brucella abortus bv. 1 str. NI259]
 gb|ENP28410.1| hypothetical protein C041_02142 [Brucella abortus 63/59]
 gb|ENP30730.1| hypothetical protein C084_02458 [Brucella abortus 64/122]
 gb|ENP34661.1| hypothetical protein C088_02333 [Brucella abortus 65/110]
 gb|ENP37785.1| hypothetical protein C040_02769 [Brucella abortus 67/781]
 gb|ENP40594.1| hypothetical protein C055_02840 [Brucella abortus 78/36]
 gb|ENP43212.1| hypothetical protein C082_02332 [Brucella abortus 80/102]
 gb|ENP46657.1| hypothetical protein C077_02668 [Brucella abortus 80/108]
 gb|ENP50265.1| hypothetical protein C053_02768 [Brucella abortus 85/140]
 gb|ENP53371.1| hypothetical protein C072_02622 [Brucella abortus 863/67]
 gb|ENP56346.1| hypothetical protein C029_02552 [Brucella abortus 88/19]
 gb|ENP59258.1| hypothetical protein C073_02763 [Brucella abortus 88/226]
 gb|ENP62718.1| hypothetical protein C075_03150 [Brucella abortus 90/50]
 gb|ENP65416.1| hypothetical protein C076_02666 [Brucella abortus 93/1]
 gb|ENP68545.1| hypothetical protein C975_02663 [Brucella abortus CNGB 1011]
 gb|ENP71674.1| hypothetical protein C976_02666 [Brucella abortus CNGB 1432]
 gb|ENP74803.1| hypothetical protein C971_02665 [Brucella abortus CNGB 308]
 gb|ENP78428.1| hypothetical protein C970_02339 [Brucella abortus CNGB 436]
 gb|ENP81067.1| hypothetical protein C972_02667 [Brucella abortus CNGB 752]
 gb|ENP84084.1| hypothetical protein C973_02550 [Brucella abortus CNGB 759]
 gb|ENP87327.1| hypothetical protein C974_02665 [Brucella abortus CNGB 966]
 gb|ENP90455.1| hypothetical protein C070_02663 [Brucella abortus F1/06 B1]
 gb|ENP94071.1| hypothetical protein C071_03170 [Brucella abortus F2/06-8]
 gb|ENP96715.1| hypothetical protein C984_02665 [Brucella abortus F3/01-300]
 gb|ENP99841.1| hypothetical protein C042_02661 [Brucella abortus F3/07-1]
 gb|ENQ03449.1| hypothetical protein C031_02622 [Brucella abortus F6/05-2]
 gb|ENQ06118.1| hypothetical protein C080_02706 [Brucella abortus levi gila]
 gb|ENQ09376.1| hypothetical protein C083_02842 [Brucella abortus LEVI237]
 gb|ENQ12312.1| hypothetical protein C014_02667 [Brucella abortus NI240]
 gb|ENQ15572.1| hypothetical protein C015_02767 [Brucella abortus NI274]
 gb|ENQ18571.1| hypothetical protein C017_02667 [Brucella abortus NI380]
 gb|ENQ21698.1| hypothetical protein C018_02665 [Brucella abortus NI388]
 gb|ENQ24825.1| hypothetical protein C020_02662 [Brucella abortus NI492]
 gb|ENQ27952.1| hypothetical protein C012_02666 [Brucella abortus NI518]
 gb|ENQ31038.1| hypothetical protein C022_02625 [Brucella abortus NI593]
 gb|ENQ34696.1| hypothetical protein C023_02622 [Brucella abortus NI613]
 gb|ENQ37335.1| hypothetical protein C024_02664 [Brucella abortus NI622]
 gb|ENQ40455.1| hypothetical protein C011_02461 [Brucella abortus NI628]
 gb|ENQ44016.1| hypothetical protein C025_03076 [Brucella abortus NI633]
 gb|ENQ47144.1| hypothetical protein C026_02623 [Brucella abortus NI639]
 gb|ENQ49513.1| hypothetical protein C027_02336 [Brucella abortus NI645]
 gb|ENQ52852.1| hypothetical protein C013_02549 [Brucella abortus NI649]
 gb|ENQ56186.1| hypothetical protein C969_02705 [Brucella canis CNGB 1172]
 gb|ENQ59033.1| hypothetical protein C979_02519 [Brucella canis UK10/02]
 gb|ENQ62108.1| hypothetical protein C045_02767 [Brucella melitensis 64/150]
 gb|ENQ65036.1| hypothetical protein C089_02742 [Brucella melitensis 66/59]
 gb|ENQ80753.1| hypothetical protein C091_02999 [Brucella melitensis F2/06-6]
 gb|ENQ86991.1| hypothetical protein C004_02761 [Brucella melitensis F6/05-6]
 gb|ENQ87478.1| hypothetical protein C061_02125 [Brucella melitensis F5/07-239A]
 gb|ENQ93348.1| hypothetical protein C035_02274 [Brucella melitensis R3/07-2]
 gb|ENQ94857.1| hypothetical protein C048_02322 [Brucella melitensis UK19/04]
 gb|ENQ99948.1| hypothetical protein C046_02712 [Brucella melitensis UK22/06]
 gb|ENR00411.1| hypothetical protein C010_02814 [Brucella ovis 80/125]
 gb|ENR05812.1| hypothetical protein C961_02514 [Brucella ovis F8/05B]
 gb|ENR08157.1| hypothetical protein C068_02587 [Brucella sp. UK38/05]
 gb|ENR11950.1| hypothetical protein C066_02952 [Brucella sp. UK5/01]
 gb|ENR15716.1| hypothetical protein C064_02332 [Brucella suis 63/252]
 gb|ENR18352.1| hypothetical protein C062_02621 [Brucella suis 92/29]
 gb|ENR20170.1| hypothetical protein C050_02403 [Brucella suis 92/63]
 gb|ENR25119.1| hypothetical protein C978_02358 [Brucella suis 94/11]
 gb|ENR27060.1| hypothetical protein C965_02625 [Brucella suis CNGB 786]
 gb|ENR31824.1| hypothetical protein C977_02347 [Brucella suis F4/06-146]
 gb|ENR33141.1| hypothetical protein C006_02497 [Brucella suis F5/03-2]
 gb|ENR38104.1| hypothetical protein B990_02658 [Brucella abortus 225/65]
 gb|ENR38849.1| hypothetical protein C063_02496 [Brucella suis F8/06-2]
 gb|ENR43908.1| hypothetical protein B993_02599 [Brucella abortus 355/78]
 gb|ENR45527.1| hypothetical protein B977_02803 [Brucella abortus 544]
 gb|ENR48961.1| hypothetical protein C002_02820 [Brucella abortus 600/64]
 gb|ENR52410.1| hypothetical protein B991_02594 [Brucella abortus 63/130]
 gb|ENR56402.1| hypothetical protein B994_02597 [Brucella abortus 63/138]
 gb|ENR58853.1| hypothetical protein B992_02585 [Brucella abortus 63/144]
 gb|ENR62287.1| hypothetical protein C028_02626 [Brucella abortus 63/168]
 gb|ENR65605.1| hypothetical protein C032_02600 [Brucella abortus 63/294]
 gb|ENR67300.1| hypothetical protein C078_02664 [Brucella abortus 64/108]
 gb|ENR71403.1| hypothetical protein B978_02804 [Brucella abortus 64/81]
 gb|ENR75316.1| hypothetical protein C079_02402 [Brucella abortus 65/157]
 gb|ENR77442.1| hypothetical protein B979_02802 [Brucella abortus 65/63]
 gb|ENR80622.1| hypothetical protein B983_02600 [Brucella abortus 67/93]
 gb|ENR83491.1| hypothetical protein B996_02588 [Brucella abortus 78/14]
 gb|ENR88009.1| hypothetical protein C981_02851 [Brucella abortus 78/32]
 gb|ENR93593.1| hypothetical protein B973_02602 [Brucella abortus 80/28]
 gb|ENR95501.1| hypothetical protein B971_02817 [Brucella abortus 84/26]
 gb|ENS00072.1| hypothetical protein C030_02917 [Brucella abortus 85/69]
 gb|ENS03000.1| hypothetical protein B974_02600 [Brucella abortus 87/28]
 gb|ENS05009.1| hypothetical protein C085_02838 [Brucella abortus 877/67]
 gb|ENS09481.1| hypothetical protein C980_02577 [Brucella abortus 88/217]
 gb|ENS12373.1| hypothetical protein B995_02600 [Brucella abortus F1/06-B21]
 gb|ENS14929.1| hypothetical protein B972_02805 [Brucella abortus F10/05-11]
 gb|ENS19110.1| hypothetical protein B982_02601 [Brucella abortus F10/06-3]
 gb|ENS20270.1| hypothetical protein C081_03155 [Brucella abortus F5/04-7]
 gb|ENS25652.1| hypothetical protein C086_02323 [Brucella abortus F6/05-3]
 gb|ENS27010.1| hypothetical protein C054_02836 [Brucella abortus F6/05-4]
 gb|ENS31230.1| hypothetical protein C087_02978 [Brucella abortus F6/05-9]
 gb|ENS33303.1| hypothetical protein C016_02623 [Brucella abortus NI352]
 gb|ENS37628.1| hypothetical protein C019_02665 [Brucella abortus NI422]
 gb|ENS38714.1| hypothetical protein C021_02667 [Brucella abortus NI495a]
 gb|ENS43337.1| hypothetical protein B976_03081 [Brucella canis 79/122]
 gb|ENS44346.1| hypothetical protein B980_02586 [Brucella abortus R42-08]
 gb|ENS49926.1| hypothetical protein C968_02485 [Brucella canis CNGB 513]
 gb|ENS52290.1| hypothetical protein C005_02317 [Brucella melitensis BG2 (S27)]
 gb|ENS55604.1| hypothetical protein C036_02765 [Brucella melitensis F1/06 B10]
 gb|ENS58817.1| hypothetical protein B970_02534 [Brucella melitensis F10/06-16]
 gb|ENS62263.1| hypothetical protein C090_02771 [Brucella melitensis F8/01-155]
 gb|ENS63841.1| hypothetical protein C003_02837 [Brucella melitensis F9/05]
 gb|ENS67688.1| hypothetical protein C034_03172 [Brucella melitensis UK14/06]
 gb|ENS70726.1| hypothetical protein C060_02790 [Brucella melitensis UK22/04]
 gb|ENS73103.1| hypothetical protein C059_02311 [Brucella melitensis UK23/06]
 gb|ENS77845.1| hypothetical protein C047_02318 [Brucella melitensis Uk24/06]
 gb|ENS80153.1| hypothetical protein B975_02706 [Brucella melitensis UK29/05]
 gb|ENS84507.1| hypothetical protein B997_02702 [Brucella melitensis UK3/06]
 gb|ENS86270.1| hypothetical protein B984_02613 [Brucella melitensis UK31/99]
 gb|ENS90612.1| hypothetical protein C033_02324 [Brucella melitensis UK37/05]
 gb|ENS92197.1| hypothetical protein B999_02781 [Brucella ovis 63/96]
 gb|ENS95709.1| hypothetical protein C009_02662 [Brucella ovis 81/8]
 gb|ENS99828.1| hypothetical protein B989_02566 [Brucella sp. 56/94]
 gb|ENT06504.1| hypothetical protein C983_02477 [Brucella sp. F23/97]
 gb|ENT09162.1| hypothetical protein C001_02621 [Brucella sp. F5/06]
 gb|ENT13135.1| hypothetical protein C067_02885 [Brucella sp. F8/99]
 gb|ENT13963.1| hypothetical protein B998_02620 [Brucella sp. F96/2]
 gb|ENT19507.1| hypothetical protein C065_02422 [Brucella sp. UK1/97]
 gb|ENT20170.1| hypothetical protein C051_02909 [Brucella sp. UK40/99]
 gb|ENT25353.1| hypothetical protein B985_02448 [Brucella suis 01-5744]
 gb|ENT28190.1| hypothetical protein C037_02298 [Brucella suis 63/198]
 gb|ENT31829.1| hypothetical protein C039_02510 [Brucella suis 63/261]
 gb|ENT32781.1| hypothetical protein C966_02619 [Brucella suis CNGB 247]
 gb|ENT38155.1| hypothetical protein C049_02529 [Brucella suis F12/02]
 gb|ENT41020.1| hypothetical protein B986_02517 [Brucella suis F5/05-10]
 gb|ENT42912.1| hypothetical protein B969_02523 [Brucella suis F5/05-4]
 gb|ENT48098.1| hypothetical protein C000_02515 [Brucella suis F7/06-1]
 gb|ENT48498.1| hypothetical protein B988_02511 [Brucella suis F7/06-2]
 gb|ENT53651.1| hypothetical protein B987_02516 [Brucella suis F7/06-5]
 gb|ENT55409.1| hypothetical protein C007_02354 [Brucella suis F8/06-1]
 gb|ENT60288.1| hypothetical protein B968_02525 [Brucella suis F8/06-3]
 gb|ENT62159.1| hypothetical protein C008_02514 [Brucella suis F9/06-1]
 gb|ENT69309.1| hypothetical protein D628_03175 [Brucella melitensis F15/06-7]
 gb|ENT70800.1| hypothetical protein D803_02667 [Brucella abortus RB51-AHVLA]
 gb|ENT75491.1| hypothetical protein H712_02791 [Brucella ovis IntaBari-2009-88-4]
 gb|ENT77491.1| hypothetical protein H720_02576 [Brucella ovis IntaBari-2006-46-348]
 gb|ENT80941.1| hypothetical protein H713_02797 [Brucella ovis IntaBari-2010-47-268]
 gb|ENT85533.1| hypothetical protein H721_02646 [Brucella ovis IntaBari-2006-46-332]
 gb|ENT85944.1| hypothetical protein H714_02792 [Brucella ovis IntaBari-2010-47-871]
 gb|ENT91626.1| hypothetical protein H715_02798 [Brucella ovis IntaBari-2002-82-58]
 gb|ENT93524.1| hypothetical protein H716_02536 [Brucella ovis IntaBari-2001-319-5096]
 gb|ENT97461.1| hypothetical protein H717_02797 [Brucella ovis IntaBari-2001-319-4082]
 gb|ENU00798.1| hypothetical protein H718_02626 [Brucella ovis IntaBari-2008-114-542]
 gb|ENU03301.1| hypothetical protein H719_02808 [Brucella ovis IntaBari-1993-758]
 gb|ENX65830.1| hypothetical protein C967_02792 [Brucella canis CNGB 1324]
 gb|ENX68824.1| hypothetical protein C982_02061 [Brucella canis F7/05A]
 gb|EOQ36574.1| hypothetical protein B981_02576 [Brucella abortus 93/2]
 gb|EOQ40680.1| hypothetical protein C069_02623 [Brucella abortus I103_(UK3/01)]
 gb|EPF76664.1| hypothetical protein L274_02716 [Brucella abortus B10-0973]
 gb|EPF80969.1| hypothetical protein L273_02711 [Brucella abortus B10-0091]
 gb|EPF82786.1| hypothetical protein L272_02713 [Brucella abortus B10-0018]
 gb|EPF88685.1| hypothetical protein L269_02709 [Brucella abortus 01-0648]
 gb|EPF90064.1| hypothetical protein L268_02714 [Brucella abortus 94-1313]
 gb|EPF94002.1| hypothetical protein L267_02713 [Brucella abortus 90-1280]
 gb|EPF98101.1| hypothetical protein L266_02712 [Brucella abortus 90-0737]
 gb|EPG02499.1| hypothetical protein L265_02712 [Brucella abortus 90-0775]
 gb|EPG03105.1| hypothetical protein L264_02706 [Brucella abortus 90-0742]
 gb|EPG06543.1| hypothetical protein L263_02707 [Brucella abortus 90-0962]
 gb|EPG11404.1| hypothetical protein L262_02705 [Brucella abortus 89-0363]
 gb|EPG14424.1| hypothetical protein L258_02716 [Brucella abortus 84-0928]
 gb|EPG16028.1| hypothetical protein L257_02716 [Brucella abortus 82-3893]
 gb|EPG21311.1| hypothetical protein L255_02704 [Brucella abortus 80-1399]
 gb|EPG22299.1| hypothetical protein L254_02710 [Brucella abortus 76-1413]
 gb|EPG26167.1| hypothetical protein L256_02706 [Brucella abortus 82-2330]
 gb|EPG28555.1| hypothetical protein L253_02712 [Brucella abortus 68-3396P]
 gb|EPG33833.1| hypothetical protein H711_02725 [Brucella ovis IntaBari-2009-88-3]
 gb|EPG85106.1| hypothetical protein L270_02710 [Brucella abortus 01-0585]
 gb|EPG86197.1| hypothetical protein L271_02713 [Brucella abortus 01-0065]
 gb|EPG91231.1| hypothetical protein L261_02712 [Brucella abortus 87-2211]
 gb|EPG92447.1| hypothetical protein L259_02711 [Brucella abortus 85-1058]
 gb|EPG93536.1| hypothetical protein L260_02711 [Brucella abortus 87-0095]
 gb|ERM03957.1| hypothetical protein P408_14950 [Brucella abortus S99]
 gb|ERM87835.1| hypothetical protein P865_01055 [Brucella abortus 82]
 gb|ERS16061.1| hypothetical protein N509_02722 [Brucella abortus BC95]
 gb|ERT72613.1| hypothetical protein P051_01801 [Brucella abortus 03-2770-11]
 gb|ERT77484.1| hypothetical protein P053_00024 [Brucella abortus 01-4165]
 gb|ERT79798.1| hypothetical protein P052_00696 [Brucella melitensis 02-7258]
 gb|ERT80891.1| hypothetical protein P050_02462 [Brucella abortus 90-12178]
 gb|ERT87557.1| hypothetical protein P048_00701 [Brucella suis 04-0115]
 gb|ERT88574.1| hypothetical protein P049_00545 [Brucella suis 06-791-1309]
 gb|ERT91143.1| hypothetical protein P040_02246 [Brucella melitensis 11-1823-3434]
 gb|ERT95543.1| hypothetical protein P047_00253 [Brucella abortus 99-9971-159]
 gb|ERT99944.1| hypothetical protein P041_00672 [Brucella sp. 04-5288]
 gb|ERU01212.1| hypothetical protein P039_02637 [Brucella abortus 07-0994-2411]
 gb|ERU01818.1| hypothetical protein P037_02449 [Brucella canis 96-7258]
 gb|ERU02786.1| hypothetical protein P038_01679 [Brucella abortus 99-9971-135]
 gb|ERU07008.1| hypothetical protein P036_02398 [Brucella canis 04-2330-1]
 gb|ERU12447.1| hypothetical protein P035_01907 [Brucella suis 06-988-1656]
 gb|ERU17677.1| hypothetical protein P046_01002 [Brucella suis 06-997-1672]
 gb|ERU22466.1| hypothetical protein P045_00624 [Brucella abortus 03-4923-239-D]
 gb|ERU27310.1| hypothetical protein P042_02066 [Brucella abortus 89-2646-1238]
 gb|ERU28222.1| hypothetical protein P044_00377 [Brucella suis 97-9757]
 gb|ERU30018.1| hypothetical protein P043_00249 [Brucella melitensis 02-5863-1]
 gb|AHB00930.1| cytoplasmic protein [Brucella ceti TE10759-12]
 gb|AHB03345.1| cytoplasmic protein [Brucella ceti TE28753-12]
 emb|CDL78119.1| unnamed protein product [Brucella canis str. Oliveri]
 gb|EXU83910.1| hypothetical protein AX23_02765 [Brucella melitensis 548]
 gb|AHN48314.1| hypothetical protein BSS2_II0552 [Brucella suis bv. 1 str. S2]
 gb|AHZ82795.1| hypothetical protein DA85_13265 [Brucella canis]
 gb|AIB19236.1| Cytoplasmic protein [Brucella suis bv. 2]
 gb|AIB22611.1| Cytoplasmic protein [Brucella suis bv. 2]
 gb|AIB25969.1| Cytoplasmic protein [Brucella suis bv. 2]
 gb|AIB32735.1| Cytoplasmic protein [Brucella suis bv. 2]
 gb|AIB29360.1| Cytoplasmic protein [Brucella suis bv. 2]
 gb|KDV07759.1| hypothetical protein BF16_11005 [Brucella suis 1330]
 gb|KEA02768.1| hypothetical protein BV90_00140 [Brucella melitensis]
 gb|KEO65455.1| hypothetical protein DT51_01130 [Brucella melitensis]
 gb|KEX98709.1| hypothetical protein IL60_0211220 [Brucella inopinata BO1]
 gb|KEX99149.1| hypothetical protein X658_0206735 [Brucella neotomae 5K33]
 gb|KEY02321.1| hypothetical protein IL61_0202740 [Brucella ceti B1/94]
 gb|KEY03908.1| hypothetical protein IL59_0213725 [Brucella suis bv. 4 str. 40]
 gb|KFH19389.1| hypothetical protein IB60_12585 [Brucella abortus LMN1]
 gb|KFH20279.1| hypothetical protein IB63_12575 [Brucella abortus 544]
 gb|KFH25441.1| hypothetical protein IB61_04830 [Brucella abortus LMN2]
 gb|AIJ51046.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus]
 gb|AIJ56686.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus]
 gb|AIJ59109.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus]
 gb|AIJ62715.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus bv. 9 str. C68]
 gb|AIJ65246.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus bv. 6 str. 870]
 gb|AIJ66515.1| flavinator of succinate dehydrogenase family protein [Brucella 
suis]
 gb|AIJ69299.1| flavinator of succinate dehydrogenase family protein [Brucella 
suis bv. 3 str. 686]
 gb|AIJ73026.1| flavinator of succinate dehydrogenase family protein [Brucella 
pinnipedialis]
 gb|AIJ75829.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus]
 gb|AIJ78419.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus]
 gb|AIJ84295.1| flavinator of succinate dehydrogenase family protein [Brucella 
canis]
 gb|AIJ86748.1| flavinator of succinate dehydrogenase family protein [Brucella 
melitensis bv. 3 str. Ether]
 gb|AIJ91108.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus bv. 2 str. 86/8/59]
 gb|AIJ93810.1| flavinator of succinate dehydrogenase family protein [Brucella 
melitensis bv. 2 str. 63/9]
 gb|AIJ96931.1| flavinator of succinate dehydrogenase family protein [Brucella 
suis]
 gb|AIK05410.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus]
 gb|KFJ27063.1| flavinator of succinate dehydrogenase family protein [Brucella 
suis]
 gb|KFJ30433.1| flavinator of succinate dehydrogenase family protein [Brucella 
suis 1330]
 gb|KFJ32492.1| flavinator of succinate dehydrogenase family protein [Brucella 
suis]
 gb|KFJ46134.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus 2308]
 gb|KFJ50004.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus]
 gb|KFJ57729.1| flavinator of succinate dehydrogenase family protein [Brucella 
neotomae 5K33]
 gb|KFJ63568.1| flavinator of succinate dehydrogenase family protein [Brucella 
abortus bv. 4 str. 292]
 gb|AIN92129.1| hypothetical protein DM30_14150 [Brucella abortus]
 gb|AIN83466.1| hypothetical protein IY71_00700 [Brucella suis]
 gb|AIN85867.1| hypothetical protein IY71_13970 [Brucella suis]
 gb|AIN88871.1| hypothetical protein IY72_13510 [Brucella suis]
 gb|AJM86407.1| hypothetical protein TI82_12495 [Brucella suis]
Length=95

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            + +RR   +LL+R+  RG  E+DLILG++ + +I S ++  +    H+L+V + DL KW+
Sbjct  12   DVRRR---KLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWV  68

Query  375  TGQEPAPDGIRTNPVFTSV  431
            TG+ P P    T P+F  +
Sbjct  69   TGESPIPAEYDT-PLFRDI  86



>ref|XP_009041798.1| hypothetical protein AURANDRAFT_16750, partial [Aureococcus anophagefferens]
 ref|XP_009041800.1| hypothetical protein AURANDRAFT_16747, partial [Aureococcus anophagefferens]
 gb|EGB03469.1| hypothetical protein AURANDRAFT_16750 [Aureococcus anophagefferens]
 gb|EGB03471.1| hypothetical protein AURANDRAFT_16747 [Aureococcus anophagefferens]
Length=82

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
            RL+YRSKQRG+LE+DL+LG W  +++  +          +L+ E  D++ ++TG++P P
Sbjct  3    RLIYRSKQRGWLEVDLLLGTWAVENVDGLTSAECDEYEDILNCETIDIFNFITGKDPVP  61



>gb|EFG36278.1| hypothetical protein BAZG_02599 [Brucella sp. NVSL 07-0026]
Length=110

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            + +RR   +LL+R+  RG  E+DLILG++ + +I S ++  +    H+L+V + DL KW+
Sbjct  27   DVRRR---KLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWV  83

Query  375  TGQEPAPDGIRTNPVFTSV  431
            TG+ P P    T P+F  +
Sbjct  84   TGESPIPAEYDT-PLFRDI  101



>gb|EEH12621.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gb|EEP62139.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
Length=110

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            + +RR   +LL+R+  RG  E+DLILG++ + +I S ++  +    H+L+V + DL KW+
Sbjct  27   DVRRR---KLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWV  83

Query  375  TGQEPAPDGIRTNPVFTSV  431
            TG+ P P    T P+F  +
Sbjct  84   TGESPIPAEYDT-PLFRDI  101



>ref|WP_005865286.1| hypothetical protein [Bartonella alsatica]
 gb|EJF75901.1| hypothetical protein MEC_00456 [Bartonella alsatica IBS 382]
Length=96

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +3

Query  171  LGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVE  350
              +D +  +A+RR   RL++R+  RG  E+DLI G +V+ HI  M +  I  L +++  +
Sbjct  4    FAVDENQLDARRR---RLIFRAWHRGIREMDLIFGHYVDAHIIGMSDKTISQLEYIMSFD  60

Query  351  NPDLWKWLTGQEPAPDGIRTNPVFTSV  431
            + DL KW+TG+   P  +  +P+F  +
Sbjct  61   DRDLLKWITGEISPPSEV-DSPLFRDI  86



>ref|WP_028735232.1| hypothetical protein [Rhizobium selenitireducens]
Length=105

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  174  GIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVEN  353
            G+ LS  E   R   R+L+R   RG  E+DLILG++ E  I +MD+  +  L  ++  E+
Sbjct  3    GLILSSAELDPRR-RRILFRCWHRGIREMDLILGQFAEAEIATMDDATLDELERIMSEED  61

Query  354  PDLWKWLTGQEPAPDGIRTNPVFTSV  431
             DL K++TG  P P  ++T P+F  +
Sbjct  62   QDLVKYITGASPVPAHLQT-PLFERI  86



>ref|WP_016945838.1| hypothetical protein [Rickettsia conorii]
Length=87

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDET + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDETKLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_006164638.1| hypothetical protein [Brucella sp. 63/311]
 gb|ENT03429.1| hypothetical protein C038_02886 [Brucella sp. 63/311]
Length=95

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 4/79 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            + +RR   +LL+R+  RG  E+DLILG++ + +I S ++       H+L+V + DL KW+
Sbjct  12   DVRRR---KLLFRAWHRGMREMDLILGQYADKYIVSFNDDQFNEFEHILEVLDRDLLKWV  68

Query  375  TGQEPAPDGIRTNPVFTSV  431
            TG+ P P    T P+F  +
Sbjct  69   TGESPIPAEYDT-PLFRDI  86



>ref|WP_004681891.1| MULTISPECIES: hypothetical protein [Brucella]
 gb|AAL53929.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 
16M]
 gb|EEW87407.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 
16M]
 gb|EEZ13252.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 
Rev.1]
 gb|ENQ68280.1| hypothetical protein C962_02315 [Brucella melitensis CNGB 1076]
 gb|ENQ71312.1| hypothetical protein C963_02318 [Brucella melitensis CNGB 1120]
 gb|ENQ75294.1| hypothetical protein C964_02315 [Brucella melitensis CNGB 290]
 gb|ENQ77794.1| hypothetical protein C057_02786 [Brucella melitensis F10/05-2]
 gb|ENQ84318.1| hypothetical protein C056_02755 [Brucella melitensis F3/02]
 gb|ENT65690.1| hypothetical protein D627_02313 [Brucella melitensis B115]
 gb|EPZ76242.1| hypothetical protein M798_02480 [Brucella melitensis ADMAS-G1]
 gb|AIJ88094.1| flavinator of succinate dehydrogenase family protein [Brucella 
melitensis bv. 1 str. 16M]
Length=97

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            + +RR   +LL+R+  RG  E+DLILG++ + +I S ++  +    H+L+V + DL KW+
Sbjct  12   DVRRR---KLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWV  68

Query  375  TGQEPAP  395
            TG+ P+P
Sbjct  69   TGESPSP  75



>ref|WP_026060177.1| hypothetical protein [Pseudaminobacter salicylatoxidans]
Length=97

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            +LL+RS  RG  E+DLILG + +  IH + +  +    H+L+V++ DL  W TG  P PD
Sbjct  17   KLLFRSWHRGIREMDLILGTFADALIHDLTDAELDEYEHLLEVQDADLLAWFTGDRPVPD  76

Query  399  G  401
             
Sbjct  77   A  77



>emb|CBI80887.1| conserved hypothetical protein [Bartonella sp. 1-1C]
Length=96

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            +NL ID +  +++RR   RL++R+  RG  E+DLILG++V+ HI  M +  +  L +++ 
Sbjct  2    TNLAIDENRLDSRRR---RLIFRAWHRGIREIDLILGQYVDAHIAKMSDQTVSELEYIMS  58

Query  345  VENPDLWKWLTGQEPAP  395
             E+ DL  W+T +   P
Sbjct  59   FEDRDLLGWITREVSIP  75



>ref|WP_006924490.1| hypothetical protein [Bartonella washoensis]
 gb|EJF77990.1| hypothetical protein MCQ_01433 [Bartonella washoensis Sb944nv]
Length=94

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            + +RR   RL++R+  RG  E+DLILG +V+ HI  M +T +  L H++  ++ DL  W+
Sbjct  12   DTRRR---RLVFRAWHRGIREMDLILGHYVDAHIVGMSDTMVSQLEHIMSFDDRDLLTWI  68

Query  375  TGQEPAPDGIRTNPVFTSV  431
            TG+   P  I   P+F  +
Sbjct  69   TGEISPPSEI-DGPLFRDI  86



>gb|EGO03769.1| hypothetical protein SERLA73DRAFT_69598 [Serpula lacrymans var. 
lacrymans S7.3]
Length=147

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 8/91 (9%)
 Frame = +3

Query  210  LVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEP  389
            L  RLLY+S++RG LE DL+L  +  DH+ +MDE  +K    +LD  + D++ W TG+  
Sbjct  55   LRARLLYQSRKRGTLESDLLLSTFARDHLAAMDEAELKEYDRLLDEPDWDIYYWSTGKRT  114

Query  390  APDGIRTNPVFTSVHTKIMNNLDKHAAPETR  482
             P+           H+ I+  L  HA  E R
Sbjct  115  PPERW--------AHSAILEKLSVHAKNEGR  137



>ref|WP_006925324.1| hypothetical protein [Bartonella washoensis]
 gb|EJF86004.1| hypothetical protein MCW_00513 [Bartonella washoensis 085-0475]
Length=94

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            + +RR   RL++R+  RG  E+DLILG +V+ HI  M +T +  L H++  ++ DL  W+
Sbjct  12   DTRRR---RLVFRAWHRGIREMDLILGHYVDAHIVGMSDTMVSQLEHIMSFDDRDLLTWI  68

Query  375  TGQEPAPDGIRTNPVFTSV  431
            TG+   P  I   P+F  +
Sbjct  69   TGEISPPSEI-DGPLFRDI  86



>ref|WP_035005833.1| hypothetical protein [Bartonella rochalimae]
 emb|CBI77833.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498]
 gb|KEC56823.1| hypothetical protein O99_00245 [Bartonella rochalimae ATCC BAA-1498]
Length=96

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            +NL ID +  +++RR   RL++R+  RG  E+DLILG++V+ HI  M +  +  L +++ 
Sbjct  2    TNLAIDENRLDSRRR---RLIFRAWHRGIREVDLILGQYVDAHIAKMSDQTVSELEYIMS  58

Query  345  VENPDLWKWLTGQEPAP  395
             E+ DL  W+T +   P
Sbjct  59   FEDRDLLGWITREVSIP  75



>ref|WP_044563814.1| hypothetical protein [Azospirillum sp. B4]
Length=97

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
             D  A RR   RL++RS  RG  E+DL++G + E H+ +     +    H+LD+ +PD++
Sbjct  13   EDALAVRR--KRLIFRSWHRGMKEMDLLMGTFAEKHVPAFTVEQLDRYEHLLDLNDPDVF  70

Query  366  KWLTGQEPAPDGIRTN  413
             WL G+ P PD +  +
Sbjct  71   DWLLGRAPFPDDLDAD  86



>ref|WP_007601033.1| hypothetical protein [Rhizobium sp. PDO1-076]
 gb|EHS52187.1| protein of unknown function DUF339 [Rhizobium sp. PDO1-076]
Length=103

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            R+L+R   RG  E+DL+LG++ E  I ++ +  +  L  ++  E+ DL KW+TG EP P+
Sbjct  17   RILFRCWHRGIREMDLMLGQFCEAEIATLPDADLDELELIMAEEDNDLVKWVTGAEPIPE  76

Query  399  GIRTNPVFTSV  431
              RT P+F  +
Sbjct  77   RFRT-PLFMRI  86



>ref|WP_010421957.1| hypothetical protein [Rickettsia helvetica]
Length=87

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDE  ++    +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLEGYTLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_014412533.1| MULTISPECIES: hypothetical protein [spotted fever group]
 gb|AFC71003.1| hypothetical protein MC5_03295 [Rickettsia australis str. Cutlack]
Length=87

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDE  ++    +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCKEMDYILGSFAEKYLSLMDEKKLEGYTLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_025045323.1| hypothetical protein [Sulfitobacter sp. MM-124]
 gb|KHA52996.1| TPR repeat family protein [Sulfitobacter sp. MM-124]
Length=88

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +3

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            EE +   + RL  RS +RG  E+DLIL  + + H+  M + G+     +L+  + DL++W
Sbjct  3    EELRDHKIKRLYMRSIRRGIKEMDLILTSFADRHLAQMADAGLDLYDAMLNENDHDLYQW  62

Query  372  LTGQEPAP  395
            +TGQ+PAP
Sbjct  63   VTGQQPAP  70



>ref|WP_015827417.1| hypothetical protein [Hirschia baltica]
 gb|ACT59267.1| protein of unknown function DUF339 [Hirschia baltica ATCC 49814]
Length=91

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+RR   +LL+R+  RG+ E+D+++G++   H+  MDE  +     +LD ++ D++ W+
Sbjct  2    DARRR---KLLFRANHRGFKEMDMMMGEFAGKHLDQMDEKALDEFERLLDTDDQDVYGWI  58

Query  375  TGQEPAPD  398
             G+E  P+
Sbjct  59   IGREQEPE  66



>ref|XP_008872066.1| hypothetical protein H310_08184 [Aphanomyces invadans]
 gb|ETV99510.1| hypothetical protein H310_08184 [Aphanomyces invadans]
Length=177

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/97 (26%), Positives = 59/97 (61%), Gaps = 4/97 (4%)
 Frame = +3

Query  162  SSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVL  341
            +S   +D+  + A R+   R++YRS+QRG+LE+DL++G+W  +++ ++    ++    +L
Sbjct  66   ASQGEVDIDADTANRK---RVIYRSRQRGWLEVDLLMGRWASENVWTLTADELQQYEDIL  122

Query  342  DVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNN  452
            + E  D++ +++G++  P+ + T P+   +     +N
Sbjct  123  NRETIDIFNFISGKDEIPEELNT-PIMKRIQAFCFSN  158



>ref|WP_011646986.1| MULTISPECIES: hypothetical protein [Hyphomonas]
 gb|ABI76010.1| TPR repeat protein [Hyphomonas neptunium ATCC 15444]
 gb|KCZ88251.1| hypothetical protein HHI_15154 [Hyphomonas hirschiana VP5]
Length=87

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
            ++L +R+ +RG+ ELDL++G + +  + SM + G+     +LDV + +++ WL GQEP P
Sbjct  7    SKLKFRAWRRGFRELDLLMGSFADQSLESMSQDGLDEFERLLDVPDWEIFAWLVGQEPVP  66

Query  396  D  398
            D
Sbjct  67   D  67



>ref|WP_013166504.1| hypothetical protein [Starkeya novella]
 gb|ADH89000.1| protein of unknown function DUF339 [Starkeya novella DSM 506]
Length=98

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 46/76 (61%), Gaps = 5/76 (7%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+RR   R+LYRS  RG  E+DL++G++ +  I  M +  +     +++VE+PDL+ WL
Sbjct  12   DARRR---RILYRSWHRGTREMDLLMGRFADKLIADMSDEDVADFEQLIEVEDPDLFGWL  68

Query  375  TGQEPAPDGIRTNPVF  422
                PAP+     P+F
Sbjct  69   ASGIPAPE--YDTPIF  82



>ref|WP_012335953.1| hypothetical protein [Methylobacterium sp. 4-46]
 gb|ACA20575.1| protein of unknown function DUF339 [Methylobacterium sp. 4-46]
Length=98

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D + +RR   R L+RS  RG  E+DLI+G++ +  I ++ E  +     +++V + DL+
Sbjct  9    ADLDPRRR---RTLFRSWHRGIREMDLIMGRFADAEIGTLTEEELDNFERLIEVPDRDLF  65

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAP  473
            +W++G+E AP    T PVF     + +    +H AP
Sbjct  66   RWISGEEEAPSNYDT-PVF-----RRLKGFHQHGAP  95



>ref|WP_005767097.1| hypothetical protein [Bartonella bacilliformis]
 gb|ABM45411.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
 gb|EKS44162.1| hypothetical protein BbINS_03747 [Bartonella bacilliformis INS]
 gb|EYS89911.1| hypothetical protein X472_00356 [Bartonella bacilliformis San 
Pedro600-02]
 gb|EYS91973.1| hypothetical protein X471_00252 [Bartonella bacilliformis str. 
Heidi Mejia]
 gb|EYS95253.1| hypothetical protein X470_00775 [Bartonella bacilliformis Peru-18]
 gb|KEG17322.1| hypothetical protein H709_00667 [Bartonella bacilliformis CUSCO5]
 gb|KEG18955.1| hypothetical protein H707_00695 [Bartonella bacilliformis Hosp800-02]
 gb|KEG20475.1| hypothetical protein H704_00718 [Bartonella bacilliformis Peru38]
 gb|KEG22857.1| hypothetical protein H703_00704 [Bartonella bacilliformis Ver075]
 gb|KEG23466.1| hypothetical protein H708_00702 [Bartonella bacilliformis VAB9028]
 gb|KEG24412.1| hypothetical protein H706_00705 [Bartonella bacilliformis CAR600-02]
Length=97

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            RL++R+  RG  E+DL+ G +V+ HI  M +  I  L +++  E+ DL  W+TG+   P 
Sbjct  18   RLIFRAWHRGIREMDLVFGPYVDAHISKMSDKAISELEYIMSFEDRDLLTWITGEAITPP  77

Query  399  GIRTNPVFTSV  431
             + T P+F  V
Sbjct  78   KVDT-PLFRDV  87



>ref|WP_025438573.1| succinate dehydrogenase [Komagataeibacter xylinus]
 gb|AHI25608.1| hypothetical protein H845_1665 [Komagataeibacter xylinus E25]
Length=103

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = +3

Query  180  DLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPD  359
            DLS  + +RR   ++ YR+  RG  E D+++G +V   +  M E  + AL  V+D+ + D
Sbjct  7    DLSRLDTRRR---KIYYRATHRGTHETDVLIGGFVAPRLEGMTEAQLDALEAVMDLPDAD  63

Query  360  LWKWLTGQEPAPDGIRT  410
            L  WL+G+ P PD + T
Sbjct  64   LADWLSGRRPVPDALNT  80



>ref|WP_029356051.1| hypothetical protein [Bosea sp. 117]
Length=98

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +3

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
             R+LYR+  RG  E+DL++G++ + H+ ++ +  +     +++VE+PDL+ WL G EP  
Sbjct  16   RRILYRAWHRGTREMDLLMGRFADAHLAALTDADVIDFERLIEVEDPDLFAWLGGLEPPA  75

Query  396  DGIRTNPVF  422
            D     PVF
Sbjct  76   D--FDTPVF  82



>ref|WP_025812949.1| succinate dehydrogenase [Komagataeibacter kakiaceti]
Length=103

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +3

Query  180  DLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPD  359
            DLS  + +RR   R+ YR+  RG  E D+++G +V   + +M +  + AL  V+D+ + D
Sbjct  7    DLSRLDTRRR---RIYYRATHRGTHETDVLIGGFVAPRLETMTDAQLDALEEVMDLPDAD  63

Query  360  LWKWLTGQEPAPDGIRT  410
            L  WL+G+ P P G+ T
Sbjct  64   LADWLSGRRPVPPGLDT  80



>ref|WP_019995146.1| hypothetical protein [Aureimonas ureilytica]
Length=98

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            SD + +RR   + L+RS  RG  E+DL+LG++ +  I S+ +  +    H+++  + DL+
Sbjct  9    SDLDPRRR---KALFRSWHRGTREMDLVLGRFADAEIGSLSDEDLTVYEHLMEAPDRDLF  65

Query  366  KWLTGQEPAPDGIRTNPVFTSVHT  437
             WLTG E  P    T PVF  + T
Sbjct  66   SWLTGTEATPANYDT-PVFQRIRT  88



>ref|WP_018263478.1| hypothetical protein [Methylobacterium sp. WSM2598]
Length=98

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D + +RR   R L+RS  RG  E+DLI+G++ +  I ++ E  +     +++V + DL+
Sbjct  9    ADLDPRRR---RTLFRSWHRGIREMDLIMGRFADAEIGTLTEEELDDFERLIEVPDRDLF  65

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAP  473
            +W++G+E AP    T PVF     + +    +H AP
Sbjct  66   RWISGEEEAPSNYDT-PVF-----RRLKGFHQHGAP  95



>ref|WP_041605724.1| hypothetical protein, partial [Tistrella mobilis]
Length=87

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 8/91 (9%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
             D E +RR   RL Y+S  RG  E D++ GK+ +  I   D   + A   +LD  + DL+
Sbjct  3    EDLEIRRR---RLRYQSWYRGCKETDILFGKFADAWIDRFDADQLDAFEALLDESDVDLY  59

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLD  458
             WL+G+EP P+ +  NPV      K+M   D
Sbjct  60   NWLSGREPLPEDLADNPV-----MKMMMQFD  85



>gb|KDO24781.1| hypothetical protein SPRG_20818 [Saprolegnia parasitica CBS 223.65]
Length=177

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            R++YRSKQRG+LE+DL+LG+W  +++ S+    ++    +L+ E  D++ +++G++  P 
Sbjct  82   RVIYRSKQRGWLEVDLLLGRWASENVMSLTADELRQYEDILNRETIDIFNFISGKDAVPP  141

Query  399  GIRT  410
             I T
Sbjct  142  EIDT  145



>ref|WP_012093025.1| hypothetical protein [Ochrobactrum anthropi]
 gb|ABS16347.1| protein of unknown function DUF339 [Ochrobactrum anthropi ATCC 
49188]
 gb|AIK41988.1| flavinator of succinate dehydrogenase family protein [Ochrobactrum 
anthropi]
Length=95

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 11/94 (12%)
 Frame = +3

Query  150  SRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKAL  329
            S L + NL +       +RR   +LL+R+  RG  E+DLILG++ +++I    +  +   
Sbjct  4    STLATENLDV-------RRR---KLLFRAWHRGMREMDLILGQYADEYIVGFTDPQLNEF  53

Query  330  VHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             H+L+V + DL KW+TG+ P P    T P+F  +
Sbjct  54   EHILEVLDRDLLKWVTGESPIPADYDT-PLFRDI  86



>ref|WP_004860026.1| hypothetical protein [Bartonella taylorii]
 gb|EJF94170.1| hypothetical protein ME9_01091 [Bartonella taylorii 8TBB]
Length=96

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            +D +  + +RR   RL++R+  RG  E+DLI G++V+ HI  M+   I  L +++  ++ 
Sbjct  6    VDENQLDVRRR---RLVFRAWHRGIREMDLIFGRYVDSHIAGMNAKTISELEYIMSFDDR  62

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSV  431
            DL+ W+TG+   P  +  +P+F  V
Sbjct  63   DLFAWVTGEISPPSEV-DSPLFRDV  86



>ref|XP_008611228.1| hypothetical protein SDRG_07186 [Saprolegnia diclina VS20]
 gb|EQC35478.1| hypothetical protein SDRG_07186 [Saprolegnia diclina VS20]
Length=177

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            R++YRSKQRG+LE+DL+LG+W  +++ S+    ++    +L+ E  D++ +++G++  P 
Sbjct  82   RVIYRSKQRGWLEVDLLLGRWASENVMSLTADELRQYEDILNRETIDIFNFISGKDTVPP  141

Query  399  GIRT  410
             I T
Sbjct  142  EIDT  145



>ref|WP_039758625.1| hypothetical protein [Bartonella queenslandensis]
Length=95

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 48/79 (61%), Gaps = 4/79 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+RR   RL++R+  RG  E+DLI G +VE HI  M++  +  L +++  ++ DL  W+
Sbjct  12   DARRR---RLIFRAWHRGIREMDLIFGHYVEAHITGMNDKMLTELEYIMSFDDRDLLTWI  68

Query  375  TGQEPAPDGIRTNPVFTSV  431
            TG+   P  I  +P+F  +
Sbjct  69   TGETLPPSEI-DSPLFRDI  86



>ref|WP_014392563.1| hypothetical protein [Candidatus Rickettsia amblyommii]
 gb|AFC70049.1| hypothetical protein MCE_06095 [Candidatus Rickettsia amblyommii 
str. GAT-30V]
Length=87

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDE  + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_043693702.1| hypothetical protein [Luteibacter sp. 9133]
Length=82

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            + RL +R++ RG  ELD + G W+E+     DE G  A   +LDV++PDLW W+ G   A
Sbjct  6    LKRLRWRTR-RGTRELDRLFGWWLEERFADADEAGKTAFDALLDVQDPDLWDWVMGHARA  64

Query  393  P  395
            P
Sbjct  65   P  65



>ref|WP_036113619.1| MULTISPECIES: hypothetical protein [Luteibacter]
Length=82

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            + RL +R++ RG  ELD + G W+E+     DE G  A   +LDV++PDLW W+ G   A
Sbjct  6    LKRLRWRTR-RGTRELDRLFGWWLEERFADADEAGKTAFDALLDVQDPDLWDWVMGHARA  64

Query  393  P  395
            P
Sbjct  65   P  65



>ref|WP_037923565.1| hypothetical protein [Sulfitobacter pseudonitzschiae]
 gb|KEJ96323.1| hypothetical protein SUH3_13245 [Sulfitobacter pseudonitzschiae]
Length=88

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            + RL  RS +RG  E+D+IL  + +D +H+MD+  +     +L+  + DL++W+TGQ  A
Sbjct  9    LKRLKMRSMRRGIKEMDIILSAYADDTLHTMDDAALTLYDDMLNENDQDLYQWVTGQAEA  68

Query  393  PDGIRT  410
            P+  R 
Sbjct  69   PERFRA  74



>ref|WP_010658839.1| MULTISPECIES: hypothetical protein [Ochrobactrum]
 gb|EXL06045.1| hypothetical protein BG46_14720 [Ochrobactrum anthropi]
 gb|KIU67064.1| hypothetical protein TR92_18105 [Ochrobactrum anthropi]
Length=95

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 11/94 (12%)
 Frame = +3

Query  150  SRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKAL  329
            S L + NL +       +RR   +LL+R+  RG  E+DLILG++ +++I    +  ++  
Sbjct  4    STLATENLDV-------RRR---KLLFRAWHRGMREMDLILGQYADEYIIGFTDPQLEEF  53

Query  330  VHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             H+L+V + DL KW+TG+ P P    T P+F  +
Sbjct  54   EHILEVLDRDLLKWVTGESPIPIDYDT-PLFRDI  86



>ref|WP_019904061.1| hypothetical protein [Methylobacterium sp. 77]
Length=97

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            R L+R+  RG  E+DLI+G++ +  I ++ ET +     +++V + DL++WLTG++  P+
Sbjct  17   RTLFRAWHRGMREMDLIMGRFADAEIGTLTETELDTFELLIEVPDRDLFRWLTGEDETPE  76

Query  399  GIRTNPVFTSVHTKIMNNLDKHAAP  473
               T PV+     + + +  KH AP
Sbjct  77   NYDT-PVY-----RRLKSFHKHDAP  95



>ref|WP_011270705.1| MULTISPECIES: hypothetical protein [spotted fever group]
 gb|AAY61217.1| unknown [Rickettsia felis URRWXCal2]
 gb|KHO03220.1| hypothetical protein JS55_02180 [Rickettsia felis str. LSU]
 gb|KHO03904.1| hypothetical protein JS61_02115 [Rickettsia felis]
 gb|KIJ88630.1| hypothetical protein SB78_04545 [Candidatus Rickettsia asemboensis]
Length=87

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDE  + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCKEMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_039531503.1| hypothetical protein [Ruegeria sp. ANG-S4]
 gb|KIC44712.1| hypothetical protein RA28_17775 [Ruegeria sp. ANG-S4]
Length=85

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            + R+  RS +RG  E+DLIL  + E ++ SMD  G+ A   +L   + DL++W+TGQ  A
Sbjct  9    IKRMKMRSMRRGIKEMDLILSAYAEQNLDSMDADGLDAFDALLHENDQDLYQWITGQVSA  68

Query  393  P  395
            P
Sbjct  69   P  69



>ref|WP_014014557.1| hypothetical protein [Rickettsia heilongjiangensis]
 gb|AEK74914.1| TPR repeat-containing protein [Rickettsia heilongjiangensis 054]
Length=87

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDE  + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_014409406.1| hypothetical protein [Rickettsia montanensis]
 emb|CAC33610.1| hypothetical protein [Rickettsia montanensis]
 gb|AFC73293.1| hypothetical protein MCI_01775 [Rickettsia montanensis str. OSU 
85-930]
Length=87

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDE  + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_028794924.1| hypothetical protein [Thalassobaculum salexigens]
Length=88

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+R+   RL YRS   G  E DL+LG + + H+ S+ ++ +    H+L +E+P L+ W+
Sbjct  6    DARRK---RLRYRSTYTGTKETDLLLGAFADRHLGSLSDSDLDDYEHLLSIEDPRLYTWI  62

Query  375  TGQEPAPDGIRTNPVF  422
            TGQE  P    T PV 
Sbjct  63   TGQETPPAEFET-PVL  77



>ref|WP_022697995.1| hypothetical protein [Maricaulis sp. JL2009]
Length=92

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = +3

Query  183  LSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDL  362
            +SDE  KR    R+LYR+  RG+ E D+++G +  D I +++E  + A   +LD  + D+
Sbjct  1    MSDETEKRH--KRILYRAIHRGFKEADILIGGFARDRIDTLNEAELDAFESLLDQNDHDI  58

Query  363  WKWLTGQEPAP  395
            + W+ G  P P
Sbjct  59   YGWVLGNRPVP  69



>ref|WP_035595905.1| hypothetical protein [Hyphomonas polymorpha]
 gb|KCZ99151.1| hypothetical protein HPO_06268 [Hyphomonas polymorpha PS728]
Length=87

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
            ++L +R+ +RG+ ELDL++G + ++ + +M+E G+     +LDV + +++ WL GQEP P
Sbjct  7    SKLKFRAWRRGFRELDLLMGSFADEALGAMNEEGLDEFERLLDVPDWEIFAWLVGQEPVP  66

Query  396  D  398
            +
Sbjct  67   E  67



>ref|WP_008580148.1| MULTISPECIES: hypothetical protein [Rickettsia]
 gb|ABV85018.1| Tetratricopeptide repeat-containing protein [Rickettsia massiliae 
MTU5]
 gb|EER21926.1| tetratricopeptide repeat-containing protein [Rickettsia endosymbiont 
of Ixodes scapularis]
 dbj|BAK96916.1| hypothetical protein RJP_0714 [Rickettsia japonica YH]
 gb|AFB31507.1| hypothetical protein RMB_03395 [Rickettsia massiliae str. AZT80]
 gb|AFC72644.1| hypothetical protein MCC_05675 [Rickettsia rhipicephali str. 
3-7-female6-CWPP]
 gb|KDO02368.1| Flavinator of succinate dehydrogenase [Rickettsia sp. ISO7]
Length=87

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D ILG + E ++  MDE  + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>gb|KDO17362.1| hypothetical protein SPRG_17211 [Saprolegnia parasitica CBS 223.65]
Length=177

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            R++YRSKQRG+LE+DL+LG+W  +++ S+    ++    +L+ E  D++ +++G++  P 
Sbjct  82   RVIYRSKQRGWLEVDLLLGRWASENVMSLTADELRQYEDILNRETIDIFNFISGKDVVPP  141

Query  399  GIRT  410
             I T
Sbjct  142  EIDT  145



>ref|WP_019221750.1| hypothetical protein [Bartonella senegalensis]
Length=96

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            +D +  + +RR   RL++R+  RG  E+DLILG++V+ HI  M +  +  L +++  E+ 
Sbjct  6    VDENQLDVRRR---RLIFRAWHRGIREMDLILGRYVDAHIGGMSDKKVSELEYIMSFEDR  62

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSV  431
            DL  W+TG+   P  +   P+F  +
Sbjct  63   DLLTWITGEISPPSEV-DGPLFRDI  86



>ref|WP_042994954.1| hypothetical protein [Bartonella bacilliformis]
 gb|KEG16833.1| hypothetical protein H705_00719 [Bartonella bacilliformis Cond044]
Length=97

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            RL++R+  RG  E+DL+ G +V+ HI  M +  I  L +++  E+ DL  W+TG+   P 
Sbjct  18   RLIFRAWHRGIREMDLVFGPYVDAHISKMSDETISELEYIMSFEDRDLLTWITGEAITPP  77

Query  399  GIRTNPVFTSV  431
             + T P+F  V
Sbjct  78   KVDT-PLFRDV  87



>ref|WP_028000444.1| hypothetical protein [Sinorhizobium arboris]
Length=101

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D + +RR   R+L+R+  RG  E+DLILG++ E  + ++ ET +  L  ++  E+ DL 
Sbjct  9    ADLDPRRR---RILFRAWHRGIREMDLILGQFAEAELATLSETELDELEAIMREEDNDLV  65

Query  366  KWLTGQEPAPDGIRTN  413
            +W+TG+ P PD   T 
Sbjct  66   RWITGENPLPDRYATE  81



>emb|CBK22104.2| unnamed protein product [Blastocystis hominis]
Length=174

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +3

Query  210  LVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEP  389
            L  RLL+RS+QRG LE+DL+LGKW + +I+ +    +     +L+ E  D++ W+T + P
Sbjct  76   LRKRLLHRSRQRGMLEVDLLLGKWAQLNINRLSRQELDQYEALLNSETVDIFSWITDKSP  135

Query  390  APDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  497
             P  +   P+   +   + +     A+PE  A   +
Sbjct  136  LPPEMDL-PIVREIQQWVKSKPFGVASPEEYAKNKE  170



>ref|WP_042619037.1| hypothetical protein [Agrobacterium tumefaciens]
 gb|KIP99879.1| hypothetical protein RU07_18020 [Agrobacterium tumefaciens]
Length=105

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D + +RR   R+LYR   RG  E+DL+LG++ E++I  + E  +  L  ++D E+ DL 
Sbjct  9    ADLDPRRR---RILYRCWHRGIREMDLVLGQFAEENISDLSEEQLDELEIIMDEEDQDLV  65

Query  366  KWLTGQEPAPDGIRTNPVFTSV  431
            +++TG +  P+  +T P+F  +
Sbjct  66   QFVTGAQAIPEKFQT-PLFMKI  86



>ref|WP_025090211.1| hypothetical protein [Ochrobactrum intermedium]
Length=95

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 11/94 (12%)
 Frame = +3

Query  150  SRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKAL  329
            S L + NL +       +RR   +LL+R+  RG  E+DLILG++ + +I    +  ++  
Sbjct  4    STLATENLDV-------RRR---KLLFRAWHRGMREMDLILGQYADAYIVGFTDPQLEEF  53

Query  330  VHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             H+L+V + DL KW+TG+ P P    T P+F  +
Sbjct  54   EHILEVLDRDLLKWVTGESPIPADYDT-PLFRDI  86



>emb|CEI84740.1| Uncharacterized protein ehr_00106 [Ehrlichia mineirensis]
Length=92

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            +LLYRS  RG  E+D+ILG +   +IH + +  I+A   ++D  +  L+K++TG+E  P 
Sbjct  10   KLLYRSLHRGCKEMDIILGNFASYYIHLLSDKDIEAYEKIVDTNDHQLYKYITGEELIPQ  69

Query  399  GIRTN  413
             + +N
Sbjct  70   DLDSN  74



>ref|WP_007553351.1| hypothetical protein [Bartonella sp. DB5-6]
 gb|EJF77392.1| hypothetical protein MCO_01307 [Bartonella sp. DB5-6]
Length=96

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            +D +  + +RR   RL++R+  RG  E+DLILG +V+ HI  M+   I  L +++  ++ 
Sbjct  6    VDENSLDVRRR---RLVFRAWHRGIREMDLILGHYVDFHIAGMNAKAISELEYIMSFDDR  62

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSV  431
            DL  W+TG+   P  +  +P+F  V
Sbjct  63   DLLAWVTGEISPPSKV-DSPLFRDV  86



>gb|ETK84784.1| hypothetical protein L915_10288 [Phytophthora parasitica]
 gb|ETL38209.1| hypothetical protein L916_10190 [Phytophthora parasitica]
 gb|ETP14621.1| hypothetical protein F441_10468 [Phytophthora parasitica CJ01A1]
Length=180

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +3

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            +EA R+   R++YRSKQRG+LE+DL+LG+W   ++  +    ++    +L+ E  D++ +
Sbjct  79   DEANRK---RIIYRSKQRGWLEVDLLLGRWASQNVMQLTSDELQQYEDILNEETIDIFNY  135

Query  372  LTGQEPAPDGIRT  410
            ++G+   P  + T
Sbjct  136  ISGKSAVPQRLDT  148



>gb|EEQ93575.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 
3301]
Length=178

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 6/96 (6%)
 Frame = +3

Query  144  SFSRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIK  323
            S  R+  S L  +  D   +RR   +LL+R+  RG  E+DLILG++ + +I    +  + 
Sbjct  80   SLPRMTGSTLATENLD--VRRR---KLLFRAWHRGMREMDLILGQYADAYIVGFTDPQLD  134

Query  324  ALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
               H+L+V + DL KW+TG+ P P    T P+F  +
Sbjct  135  EFEHILEVLDRDLLKWVTGESPIPADYDT-PLFRDI  169



>ref|WP_010507900.1| MULTISPECIES: hypothetical protein [Komagataeibacter]
 gb|KIE61095.1| hypothetical protein GLUCOINTEAF2_02486 [Komagataeibacter intermedius 
AF2]
Length=103

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = +3

Query  180  DLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPD  359
            DLS  + +RR   ++ YR+  RG  E D+++G +V   +  M E  + AL  V+D+ + D
Sbjct  7    DLSRLDTRRR---KIYYRATHRGTHETDVLIGGFVAPRLEGMTEAQLDALEAVMDLPDAD  63

Query  360  LWKWLTGQEPAPDGIRT  410
            L  WL+G+ P PD + T
Sbjct  64   LADWLSGRRPVPDELNT  80



>ref|XP_008893576.1| hypothetical protein PPTG_01936 [Phytophthora parasitica INRA-310]
 gb|ETI44775.1| hypothetical protein F443_10531 [Phytophthora parasitica P1569]
 gb|ETL91298.1| hypothetical protein L917_10128 [Phytophthora parasitica]
 gb|ETM44644.1| hypothetical protein L914_10150 [Phytophthora parasitica]
 gb|ETN21850.1| hypothetical protein PPTG_01936 [Phytophthora parasitica INRA-310]
 gb|ETO73440.1| hypothetical protein F444_10621 [Phytophthora parasitica P1976]
 gb|ETP42694.1| hypothetical protein F442_10428 [Phytophthora parasitica P10297]
Length=180

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +3

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            +EA R+   R++YRSKQRG+LE+DL+LG+W   ++  +    ++    +L+ E  D++ +
Sbjct  79   DEANRK---RIIYRSKQRGWLEVDLLLGRWASQNVMQLTSDELQQYEDILNEETIDIFNY  135

Query  372  LTGQEPAPDGIRT  410
            ++G+   P  + T
Sbjct  136  ISGKSAVPQRLDT  148



>ref|WP_012151075.1| MULTISPECIES: hypothetical protein [spotted fever group]
 ref|YP_001650287.1| hypothetical protein RrIowa_1086 [Rickettsia rickettsii str. 
Iowa]
 ref|YP_002916570.1| hypothetical protein RPR_04120 [Rickettsia peacockii str. Rustic]
 emb|CAC33673.1| hypothetical protein [Rickettsia rickettsii]
 gb|ABV76504.1| hypothetical protein A1G_05045 [Rickettsia rickettsii str. 'Sheila 
Smith']
 gb|ABY72881.1| hypothetical protein RrIowa_1086 [Rickettsia rickettsii str. 
Iowa]
 gb|ACR47521.1| hypothetical protein RPR_04120 [Rickettsia peacockii str. Rustic]
 gb|AFB21929.1| hypothetical protein RPN_01950 [Rickettsia rickettsii str. Brazil]
 gb|AFB23853.1| hypothetical protein RPL_05095 [Rickettsia rickettsii str. Colombia]
 gb|AFB25198.1| hypothetical protein RPO_05100 [Rickettsia rickettsii str. Arizona]
 gb|AFB26541.1| hypothetical protein RSA_05060 [Rickettsia philipii str. 364D]
 gb|AFB27878.1| hypothetical protein RPJ_05050 [Rickettsia rickettsii str. Hino]
 gb|AFB29200.1| hypothetical protein RPK_05005 [Rickettsia rickettsii str. Hlp#2]
 gb|AFB30538.1| hypothetical protein RPM_05070 [Rickettsia rickettsii str. Hauke]
 gb|AJG33290.1| hypothetical protein RRR_04705 [Rickettsia rickettsii str. R]
 gb|AJG34626.1| hypothetical protein RRM_04735 [Rickettsia rickettsii str. Morgan]
Length=87

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L+YRSK RG  E+D ILG + E ++  MDE  + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLVYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_010977514.1| hypothetical protein [Rickettsia conorii]
 gb|AAL03452.1| unknown [Rickettsia conorii str. Malish 7]
Length=87

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +L YRSK RG  E+D IL  + E ++  MDET + +   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLFYRSKNRGCREMDYILSSFAEKYLSLMDETQLGSYSLILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_042695624.1| hypothetical protein [Azospirillum sp. B506]
Length=107

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            RL +RS  RG  E+DL++G + + H+   D   +     +L++ +PDL+ W++G+EP P 
Sbjct  27   RLRFRSWHRGTREMDLLMGSFADAHVGDFDHAMLDRFEALLELGDPDLYDWMSGREPVPA  86

Query  399  G  401
            G
Sbjct  87   G  87



>ref|XP_002365034.1| hypothetical protein TGME49_058100 [Toxoplasma gondii ME49]
Length=144

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +3

Query  174  GIDLSDEEAKRRL---VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            GI  SDE++  R    + RL+YR+KQRG++ELDL+LG + ++++ SM    ++ L  +L 
Sbjct  25   GICGSDEKSVIRASERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILA  84

Query  345  VENPDLWKWLTGQE----PAP  395
             EN  L+  L G++    PAP
Sbjct  85   AENVVLFDCLVGKDWKRAPAP  105



>ref|WP_027491861.1| hypothetical protein [Rhodanobacter sp. OR444]
Length=82

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            + RL +R++ RG  ELD + G W++D   S DE   +A   +LDV++PDLW W+ G
Sbjct  6    IKRLRWRAR-RGTRELDALFGGWLDDRFASADEAQRQAFDELLDVQDPDLWDWVMG  60



>gb|KFG33774.1| TPR repeat region protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG37949.1| TPR repeat region protein [Toxoplasma gondii FOU]
Length=212

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +3

Query  174  GIDLSDEEAKRRL---VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            GI  SDE++  R    + RL+YR+KQRG++ELDL+LG + ++++ SM    ++ L  +L 
Sbjct  93   GICGSDEKSVIRASERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILA  152

Query  345  VENPDLWKWLTGQE----PAP  395
             EN  L+  L G++    PAP
Sbjct  153  AENVVLFDCLVGKDWKRAPAP  173



>emb|CBJ33347.1| conserved unknown protein [Ectocarpus siliculosus]
Length=209

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A RR   RL+YRSKQRG+LE+DL+LG W E ++  +    + +   +L++E  D++ ++
Sbjct  108  DAVRR--KRLVYRSKQRGWLEVDLLLGTWAERNVAGLSAADMDSYEDILNLETVDIFNFI  165

Query  375  TGQEPAPDGIRTNPVFTSVHTKIMNN  452
            TG    P  +   P+   +   + +N
Sbjct  166  TGNADPPAFVDA-PMLARLQAYVKSN  190



>ref|WP_040291656.1| hypothetical protein [Acetobacteraceae bacterium AT-5844]
Length=109

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  168  NLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDV  347
            N   D S EE   R   RL++R+  RG  E DL++G +V  HI S  E  +  L  VL++
Sbjct  6    NTQPDFSPEELSPRR-RRLMFRAWHRGTKETDLMIGHFVARHIASFTEAELDDLEGVLEL  64

Query  348  ENPDLWKWLTGQEPAPDGIRT  410
             + DL +WLTG+ P P  +R+
Sbjct  65   LDVDLAEWLTGRSPIPASVRS  85



>ref|WP_034505622.1| hypothetical protein [Agrobacterium rhizogenes]
Length=104

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            + L +  +D + +RR   R+L+R   RG  E+DL+ G++ ++ +  + E  +  L  ++D
Sbjct  2    TGLTLSSADLDPRRR---RILFRCWHRGIREMDLVFGQFADNELPGLAEADLDELESIMD  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVF  422
             E+ DL KW+ G EP P  ++T P+F
Sbjct  59   EEDNDLVKWILGTEPTPQHLQT-PLF  83



>ref|WP_019218647.1| hypothetical protein [Bartonella sp. R4(2010)]
Length=96

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            +D +  + +RR   RL++R+  RG  E+DLILG +V+ HI  M +  I  L +++  ++ 
Sbjct  6    VDENQLDVRRR---RLIFRAWHRGIREMDLILGHYVDAHIVEMSDKTISELEYIMSFDDR  62

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSV  431
            DL KW+TG+   P  +  +P+F  +
Sbjct  63   DLLKWVTGEISPPPEV-DSPLFRDI  86



>ref|WP_027285193.1| hypothetical protein [Rubritepida flocculans]
Length=98

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +3

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
             RLL+R++ RG  E DL++G +V  HI ++ E  +  L  +L++ + DL  WL G+ P P
Sbjct  18   RRLLFRAQHRGTKECDLMIGGFVRRHIAALGEAELAELEAILELPDVDLADWLCGRRPMP  77

Query  396  DGIRT  410
              +R+
Sbjct  78   ADLRS  82



>ref|WP_037202057.1| hypothetical protein [Rhizobium sp. OK494]
Length=104

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +3

Query  165  SNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            + L +  +D + +RR   R+L+R   RG  E+DL+ G++ ++ +  + E  +  L  ++D
Sbjct  2    TGLTLSSADLDPRRR---RILFRCWHRGIREMDLVFGQFADNELPGLAEADLDELESIMD  58

Query  345  VENPDLWKWLTGQEPAPDGIRTNPVF  422
             E+ DL KW+ G EP P  ++T P+F
Sbjct  59   EEDNDLVKWILGTEPTPQHLQT-PLF  83



>ref|WP_012148511.1| hypothetical protein [Rickettsia canadensis]
 gb|ABV73312.1| hypothetical protein A1E_01835 [Rickettsia canadensis str. McKiel]
 gb|AFB20922.1| hypothetical protein RCA_01725 [Rickettsia canadensis str. CA410]
Length=87

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  KRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTG  380
            K  L  +LLY SK RG  E+D ILG + E ++  MDE  +++   +LD  + DL+ W+  
Sbjct  6    KNSLQKKLLYLSKNRGCKEMDYILGSFTEKYLSLMDEKKLESYALILDQNDNDLYNWINN  65

Query  381  QEPAP  395
            +  AP
Sbjct  66   KSSAP  70



>ref|WP_043598464.1| hypothetical protein [Dyella ginsengisoli]
Length=82

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +3

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            EEA+   + RL +R++ RG  ELD + G W+++   + DE    A   +LDV++PDLW W
Sbjct  2    EEAR---IKRLRWRTR-RGTRELDALFGGWLDERFAAADEATRGAFDELLDVQDPDLWDW  57

Query  372  LTGQEPAP  395
            + G   AP
Sbjct  58   VMGHARAP  65



>ref|XP_005534895.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80288.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=157

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  216  NRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAP  395
             R LYR+ QRG  ELD++LG+W + H+ +  E  +  L  VLD E+P L+ ++T Q   P
Sbjct  77   RRCLYRANQRGLRELDILLGEWTQRHLATFTEQDVSELEQVLDHESPLLYLYITEQRQPP  136

Query  396  DGIRTNPVF  422
              +    +F
Sbjct  137  AELAGLALF  145



>gb|KFG29431.1| TPR repeat region protein [Toxoplasma gondii p89]
Length=209

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +3

Query  174  GIDLSDEEAKRRL---VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            GI  SDE++  R    + RL+YR+KQRG++ELDL+LG + ++++ SM    ++ L  +L 
Sbjct  90   GICGSDEKSVIRASERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILA  149

Query  345  VENPDLWKWLTGQE----PAP  395
             EN  L+  L G++    PAP
Sbjct  150  AENVVLFDCLVGKDWKRAPAP  170



>ref|WP_011631542.1| hypothetical protein [Granulibacter bethesdensis]
 gb|ABI61733.1| TPR repeat containing protein [Granulibacter bethesdensis CGDNIH1]
 gb|AHJ66779.1| TPR repeat containing protein [Granulibacter bethesdensis CGDNIH4]
 gb|AHJ69446.1| TPR repeat containing protein [Granulibacter bethesdensis CGDNIH2]
Length=99

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            E++RR   RLL+R+  RG  E D+++G +V   +    E  + AL  ++D+ +PDL  WL
Sbjct  19   ESRRR---RLLFRATHRGTHENDILIGGYVAARLEQFSEAELDALEAIMDLPDPDLADWL  75

Query  375  TGQEPAP  395
            TG+ P P
Sbjct  76   TGRRPIP  82



>ref|WP_028958270.1| hypothetical protein [Sulfitobacter sp. 20_GPM-1509m]
Length=88

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +3

Query  213  VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPA  392
            + RL  RS +RG  E+DLIL  + +D +H MD+  +     +L+  + DL++W+TGQ  A
Sbjct  9    LKRLKMRSMRRGIKEMDLILSAYADDTLHRMDDAALTLYDDMLNENDQDLYQWVTGQAEA  68

Query  393  PDGIRT  410
            P+  + 
Sbjct  69   PERFKA  74



>gb|KFH13357.1| TPR repeat region protein [Toxoplasma gondii MAS]
Length=209

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +3

Query  174  GIDLSDEEAKRRL---VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            GI  SDE++  R    + RL+YR+KQRG++ELDL+LG + ++++ SM    ++ L  +L 
Sbjct  90   GICGSDEKSVIRASERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILA  149

Query  345  VENPDLWKWLTGQE----PAP  395
             EN  L+  L G++    PAP
Sbjct  150  AENVVLFDCLVGKDWKRAPAP  170



>ref|WP_006471374.1| MULTISPECIES: hypothetical protein [Ochrobactrum]
 gb|ELT49412.1| hypothetical protein D584_09372 [Ochrobactrum intermedium M86]
 gb|ERI15174.1| hypothetical protein O206_20660 [Ochrobactrum sp. EGD-AQ16]
Length=95

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 11/94 (12%)
 Frame = +3

Query  150  SRLCSSNLGIDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKAL  329
            S L + NL +       +RR   +LL+R+  RG  E+DLILG++ + +I    +  +   
Sbjct  4    STLATENLDV-------RRR---KLLFRAWHRGMREMDLILGQYADAYIVGFTDPQLDEF  53

Query  330  VHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSV  431
             H+L+V + DL KW+TG+ P P    T P+F  +
Sbjct  54   EHILEVLDRDLLKWVTGESPIPADYDT-PLFRDI  86



>gb|KFG65086.1| TPR repeat region protein [Toxoplasma gondii RUB]
Length=212

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +3

Query  174  GIDLSDEEAKRRL---VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            GI  SDE++  R    + RL+YR+KQRG++ELDL+LG + ++++ SM    ++ L  +L 
Sbjct  93   GICGSDEKSVIRASERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILA  152

Query  345  VENPDLWKWLTGQE----PAP  395
             EN  L+  L G++    PAP
Sbjct  153  AENVVLFDCLVGKDWKRAPAP  173



>ref|WP_011945193.1| hypothetical protein [Orientia tsutsugamushi]
 emb|CAM81274.1| hypothetical protein OTBS_2179 [Orientia tsutsugamushi str. Boryong]
Length=87

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  DEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWK  368
            +++ K+R++ RL+YR+  RG  E DL+L +++  H+  + +  +     +LD ++ D+++
Sbjct  2    NKDEKQRIIKRLIYRATYRGCKESDLLLSQFLSKHLEFLSDKELLDFALILDCDDKDIYE  61

Query  369  WLTGQEPAP  395
            W T ++P+P
Sbjct  62   WTTNKKPSP  70



>ref|WP_025286345.1| hypothetical protein [Granulibacter bethesdensis]
 gb|AHJ62659.1| TPR repeat containing protein [Granulibacter bethesdensis CGDNIH3]
Length=99

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            E++RR   RLL+R+  RG  E D+++G +V   +    E  + AL  ++D+ +PDL  WL
Sbjct  19   ESRRR---RLLFRATHRGTHENDILIGGYVAARLEQFSEAELDALEAIMDLPDPDLADWL  75

Query  375  TGQEPAP  395
            TG+ P P
Sbjct  76   TGRTPIP  82



>ref|WP_015933487.1| hypothetical protein [Methylobacterium nodulans]
 gb|ACL61924.1| protein of unknown function DUF339 [Methylobacterium nodulans 
ORS 2060]
Length=98

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 54/96 (56%), Gaps = 9/96 (9%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D + +RR   R L+RS  RG  E+DLI+G++ +  I ++ +  +     +++V + DL+
Sbjct  9    ADLDPRRR---RTLFRSWHRGIREMDLIMGRFADAEIGTLTDAELDEFERLIEVPDRDLF  65

Query  366  KWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAP  473
            +W+ G+E AP    T PVF     + +    +H AP
Sbjct  66   RWICGEEEAPANYDT-PVF-----RRLKGFHQHGAP  95



>ref|WP_026607823.1| hypothetical protein [Methylocapsa acidiphila]
Length=98

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = +3

Query  195  EAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWL  374
            +A+RR   R+++R+  RG LE+D+I G++V+  I ++D+  +  L  +LD  + D+  W+
Sbjct  12   DARRR---RIVFRAHHRGMLEMDIIFGRFVDAEIAALDDGELDDLEVLLDEPDRDVLSWV  68

Query  375  TGQEPAPDGIRTNPVFTSV---HTKI  443
            TG+E  P      PVF  +   HT +
Sbjct  69   TGEEKTP-ARHDTPVFQKILRFHTHV  93



>gb|EPR62894.1| TPR repeat region protein [Toxoplasma gondii GT1]
Length=215

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +3

Query  174  GIDLSDEEAKRRL---VNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLD  344
            GI  SDE++  R    + RL+YR+KQRG++ELDL+LG + ++++ SM    ++ L  +L 
Sbjct  96   GICGSDEKSVIRASERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILA  155

Query  345  VENPDLWKWLTGQE----PAP  395
             EN  L+  L G++    PAP
Sbjct  156  AENVVLFDCLVGKDWKRAPAP  176



>ref|WP_007557506.1| hypothetical protein [Candidatus Liberibacter americanus]
 gb|EMS35867.1| hypothetical protein G653_04526 [Candidatus Liberibacter americanus 
PW_SP]
 gb|AHA27957.1| hypothetical protein lam_610 [Candidatus Liberibacter americanus 
str. Sao Paulo]
Length=104

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  219  RLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKWLTGQEPAPD  398
            +++YR  +RG  E+DLILG +V+ +I  + E  +  L  +++ ++  L+KW++G E  P+
Sbjct  17   KIVYRCWRRGTREMDLILGSFVDKYILDLSEAELDMLELIIEKDDGSLFKWISGSEEIPE  76

Query  399  GIRTNPVFTSVHTKIMNNLDKHAAPE  476
             +R  P+F  +      N D +   E
Sbjct  77   DLRI-PIFNKICAYYSFNRDCNVFLE  101



>ref|WP_039682566.1| hypothetical protein [Tateyamaria sp. ANG-S1]
 gb|KIC50766.1| hypothetical protein RA29_02245 [Tateyamaria sp. ANG-S1]
Length=88

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  EEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLWKW  371
            EE +   + RL  RS +RG  E+DLIL  +   H+  M +  +     +L+  + DL++W
Sbjct  3    EELREHRLKRLHMRSMRRGIKEMDLILSTYAGRHLADMTDAELDTYDAMLNENDQDLYRW  62

Query  372  LTGQEPAPDGI  404
            +TGQE APD I
Sbjct  63   VTGQEAAPDHI  73



>ref|WP_012231771.1| hypothetical protein [Bartonella tribocorum]
 emb|CAK01568.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
 emb|CDO48813.1| hypothetical protein BM1374166_01132 [Bartonella tribocorum]
Length=95

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +3

Query  177  IDLSDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENP  356
            +D +  +A+RR   RL++R+  RG  E+DLI G +V+ HI  M++  +  L +++  ++ 
Sbjct  6    VDKNQLDARRR---RLIFRAWHRGIREMDLIFGHYVDAHITGMNDKTLSELEYIMSFDDR  62

Query  357  DLWKWLTGQEPAPDGIRTNPVFTSV  431
            DL  W+TG+   P  I  +P+F  +
Sbjct  63   DLLTWITGEILPPSEI-DSPLFRDI  86



>ref|WP_025427009.1| hypothetical protein [Ensifer adhaerens]
Length=101

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = +3

Query  186  SDEEAKRRLVNRLLYRSKQRGYLELDLILGKWVEDHIHSMDETGIKALVHVLDVENPDLW  365
            +D + +RR   R+L+R+  RG  E+DLILG++ E  + ++ +  +  L  ++  E+ DL 
Sbjct  9    ADLDPRRR---RILFRAWHRGIREMDLILGQFAEAELSALSDIELDELEIIMGEEDNDLV  65

Query  366  KWLTGQEPAPDGIRTNPVFTSV  431
            +W+ G++P P+  +T P+FT +
Sbjct  66   RWIIGEKPVPERYQT-PMFTRI  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500