BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050I04

Length=590
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097296.1|  PREDICTED: chloride channel protein CLC-b-like     124   2e-34   Sesamum indicum [beniseed]
ref|XP_002509531.1|  chloride channel clc, putative                     120   1e-33   Ricinus communis
emb|CDP16685.1|  unnamed protein product                                135   9e-33   Coffea canephora [robusta coffee]
ref|XP_007151531.1|  hypothetical protein PHAVU_004G054600g             116   1e-32   Phaseolus vulgaris [French bean]
ref|NP_001236494.1|  chloride channel                                   118   5e-32   
gb|KHN01525.1|  Chloride channel protein CLC-b                          118   5e-32   Glycine soja [wild soybean]
ref|XP_010111585.1|  Chloride channel protein CLC-b                     121   1e-31   Morus notabilis
gb|KDO43322.1|  hypothetical protein CISIN_1g0039661mg                  116   1e-31   Citrus sinensis [apfelsine]
ref|XP_007031848.1|  Chloride channel B isoform 2                       117   5e-31   
ref|XP_007031850.1|  Chloride channel B isoform 4                       117   6e-31   
emb|CDX67478.1|  BnaA07g15180D                                          119   1e-30   
ref|XP_009125164.1|  PREDICTED: chloride channel protein CLC-a-like     119   1e-30   Brassica rapa
emb|CDY11722.1|  BnaC06g13300D                                          119   2e-30   Brassica napus [oilseed rape]
ref|XP_008365471.1|  PREDICTED: chloride channel protein CLC-a-like     118   4e-30   
ref|XP_009761471.1|  PREDICTED: chloride channel protein CLC-b-like     127   6e-30   Nicotiana sylvestris
gb|AAD29679.1|AF133209_1  CLC-Nt2 protein                               127   6e-30   Nicotiana tabacum [American tobacco]
ref|XP_008353449.1|  PREDICTED: chloride channel protein CLC-b-like     119   1e-29   
ref|XP_002300101.1|  Chloride channel protein CLC-a                     125   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_003618847.1|  Chloride channel protein CLC-a                     108   3e-29   
gb|AES75065.2|  ClC chloride channel family protein                     108   3e-29   Medicago truncatula
ref|XP_011098867.1|  PREDICTED: chloride channel protein CLC-a-like     109   4e-29   Sesamum indicum [beniseed]
ref|XP_006395477.1|  hypothetical protein EUTSA_v10003679mg             117   6e-29   Eutrema salsugineum [saltwater cress]
gb|KFK33637.1|  hypothetical protein AALP_AA5G039600                    118   7e-29   Arabis alpina [alpine rockcress]
ref|XP_004233300.1|  PREDICTED: chloride channel protein CLC-b          124   7e-29   Solanum lycopersicum
ref|XP_004303984.1|  PREDICTED: chloride channel protein CLC-b-like     108   7e-29   Fragaria vesca subsp. vesca
gb|KDP46292.1|  hypothetical protein JCGZ_10132                         124   8e-29   Jatropha curcas
ref|NP_189353.1|  chloride channel protein CLC-b                        117   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001267676.1|  chloride channel protein CLC-b-like                123   1e-28   Cucumis sativus [cucumbers]
ref|XP_009596046.1|  PREDICTED: chloride channel protein CLC-b-like     123   1e-28   Nicotiana tomentosiformis
emb|CDX83663.1|  BnaC07g24030D                                          117   1e-28   
ref|XP_011003929.1|  PREDICTED: chloride channel protein CLC-b          123   1e-28   Populus euphratica
ref|XP_006357190.1|  PREDICTED: chloride channel protein CLC-b-like     123   1e-28   Solanum tuberosum [potatoes]
ref|XP_009151988.1|  PREDICTED: chloride channel protein CLC-b          116   1e-28   Brassica rapa
emb|CDY13685.1|  BnaA06g32380D                                          116   1e-28   Brassica napus [oilseed rape]
ref|XP_002875360.1|  CLC-B                                              118   2e-28   
ref|XP_010905204.1|  PREDICTED: chloride channel protein CLC-b-like     112   3e-28   
ref|XP_010514406.1|  PREDICTED: chloride channel protein CLC-b          117   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010660593.1|  PREDICTED: uncharacterized protein LOC100260...    112   6e-28   Vitis vinifera
ref|NP_001268190.1|  uncharacterized protein LOC100260066               112   7e-28   Vitis vinifera
ref|XP_009371657.1|  PREDICTED: chloride channel protein CLC-b-like     120   7e-28   
ref|XP_006290621.1|  hypothetical protein CARUB_v10016713mg             116   7e-28   Capsella rubella
emb|CAN82189.1|  hypothetical protein VITISV_031114                     112   8e-28   Vitis vinifera
ref|XP_008231135.1|  PREDICTED: chloride channel protein CLC-b          120   9e-28   Prunus mume [ume]
ref|XP_007217037.1|  hypothetical protein PRUPE_ppa001619mg             120   9e-28   Prunus persica
gb|KJB76409.1|  hypothetical protein B456_012G087500                    120   9e-28   Gossypium raimondii
gb|KJB76407.1|  hypothetical protein B456_012G087500                    120   9e-28   Gossypium raimondii
gb|AAB17007.1|  voltage-gated chloride channel                          120   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24139.1|  putative anion channel protein                          120   9e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CAA96057.1|  CLC-a chloride channel protein                         120   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198905.1|  chloride channel protein CLC-a                        120   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KJB76408.1|  hypothetical protein B456_012G087500                    120   9e-28   Gossypium raimondii
ref|XP_010425454.1|  PREDICTED: chloride channel protein CLC-b-li...    116   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010502677.1|  PREDICTED: chloride channel protein CLC-b-li...    116   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006447084.1|  hypothetical protein CICLE_v10014341mg             120   1e-27   Citrus clementina [clementine]
ref|XP_010425455.1|  PREDICTED: chloride channel protein CLC-b-li...    116   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010502678.1|  PREDICTED: chloride channel protein CLC-b-li...    116   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_008441347.1|  PREDICTED: chloride channel protein CLC-b-like     119   2e-27   Cucumis melo [Oriental melon]
ref|XP_010450591.1|  PREDICTED: chloride channel protein CLC-a          119   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010441254.1|  PREDICTED: chloride channel protein CLC-a          119   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010436030.1|  PREDICTED: chloride channel protein CLC-a-like     119   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009392485.1|  PREDICTED: chloride channel protein CLC-a-like     113   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008379124.1|  PREDICTED: chloride channel protein CLC-b is...    118   6e-27   
ref|XP_008379123.1|  PREDICTED: chloride channel protein CLC-b is...    118   6e-27   
ref|XP_008806046.1|  PREDICTED: chloride channel protein CLC-a-like     114   8e-27   
ref|XP_009129444.1|  PREDICTED: chloride channel protein CLC-b-like     110   9e-27   Brassica rapa
emb|CDY34173.1|  BnaA02g28670D                                          110   9e-27   Brassica napus [oilseed rape]
emb|CDY28488.1|  BnaC02g36720D                                          110   1e-26   Brassica napus [oilseed rape]
emb|CDX99630.1|  BnaC04g33870D                                          117   1e-26   
gb|KFK33054.1|  hypothetical protein AALP_AA6G324100                    117   1e-26   Arabis alpina [alpine rockcress]
gb|KJB11653.1|  hypothetical protein B456_001G270200                    117   2e-26   Gossypium raimondii
ref|XP_006604142.1|  PREDICTED: chloride channel protein CLC-b-li...    116   2e-26   Glycine max [soybeans]
ref|XP_003553925.1|  PREDICTED: chloride channel protein CLC-b-li...    116   2e-26   Glycine max [soybeans]
gb|KHN24330.1|  Chloride channel protein CLC-b                          116   3e-26   Glycine soja [wild soybean]
ref|XP_007161741.1|  hypothetical protein PHAVU_001G094700g             116   3e-26   Phaseolus vulgaris [French bean]
ref|XP_007161742.1|  hypothetical protein PHAVU_001G094700g             116   3e-26   Phaseolus vulgaris [French bean]
gb|ADD09860.1|  chloride channel A                                      116   3e-26   Eutrema halophilum
ref|XP_006405416.1|  hypothetical protein EUTSA_v10027650mg             116   3e-26   Eutrema salsugineum [saltwater cress]
ref|XP_008788897.1|  PREDICTED: chloride channel protein CLC-b-like     109   3e-26   
ref|XP_010670516.1|  PREDICTED: chloride channel protein CLC-b-like     115   4e-26   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ33828.1|  unnamed protein product                                112   8e-26   Eutrema halophilum
ref|XP_009140242.1|  PREDICTED: chloride channel protein CLC-a          114   1e-25   Brassica rapa
emb|CDY15925.1|  BnaA04g11860D                                          114   1e-25   Brassica napus [oilseed rape]
ref|XP_006285462.1|  hypothetical protein CARUB_v10006880mg             114   2e-25   Capsella rubella
ref|XP_010528167.1|  PREDICTED: chloride channel protein CLC-b-like     106   2e-25   Tarenaya hassleriana [spider flower]
gb|EYU34803.1|  hypothetical protein MIMGU_mgv1a001623mg                112   6e-25   Erythranthe guttata [common monkey flower]
ref|XP_010678325.1|  PREDICTED: chloride channel protein CLC-b-li...    112   1e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010029007.1|  PREDICTED: chloride channel protein CLC-b          111   2e-24   Eucalyptus grandis [rose gum]
gb|KHN10806.1|  Chloride channel protein CLC-b                          110   4e-24   Glycine soja [wild soybean]
ref|XP_004513192.1|  PREDICTED: chloride channel protein CLC-b-like     108   1e-23   Cicer arietinum [garbanzo]
ref|XP_002868624.1|  ATCLC-A                                            108   2e-23   
dbj|BAJ96369.1|  predicted protein                                      102   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88201.1|  predicted protein                                      102   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92499.1|  predicted protein                                      102   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006664534.1|  PREDICTED: chloride channel protein CLC-a-like   99.0    2e-22   Oryza brachyantha
gb|EYU45399.1|  hypothetical protein MIMGU_mgv1a001597mg                104   3e-22   Erythranthe guttata [common monkey flower]
gb|EMT23598.1|  hypothetical protein F775_52599                       99.0    4e-22   
ref|XP_010248967.1|  PREDICTED: chloride channel protein CLC-b          103   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004962544.1|  PREDICTED: chloride channel protein CLC-a-li...  96.7    2e-21   
ref|XP_004962545.1|  PREDICTED: chloride channel protein CLC-a-li...  96.7    2e-21   Setaria italica
dbj|BAJ91019.1|  predicted protein                                    97.1    2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002438781.1|  hypothetical protein SORBIDRAFT_10g026090        95.1    4e-21   Sorghum bicolor [broomcorn]
ref|XP_003576525.1|  PREDICTED: chloride channel protein CLC-a-like   95.1    4e-21   Brachypodium distachyon [annual false brome]
ref|XP_010929772.1|  PREDICTED: chloride channel protein CLC-b-like     100   6e-21   
ref|XP_008658999.1|  PREDICTED: chloride channel protein isoform X1   90.9    9e-21   Zea mays [maize]
ref|NP_001183936.1|  chloride channel protein                         90.9    9e-21   Zea mays [maize]
ref|XP_006338691.1|  PREDICTED: chloride channel protein CLC-a-like   99.8    1e-20   Solanum tuberosum [potatoes]
gb|EEE53145.1|  hypothetical protein OsJ_35963                        92.8    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006848424.1|  hypothetical protein AMTR_s00013p00233520        93.2    2e-20   
gb|EMS65031.1|  Chloride channel protein CLC-b                        92.8    5e-20   Triticum urartu
gb|EEC69203.1|  hypothetical protein OsI_38196                        91.7    1e-19   Oryza sativa Indica Group [Indian rice]
gb|EMT27070.1|  Chloride channel protein CLC-b                        91.3    1e-19   
gb|AFW87644.1|  hypothetical protein ZEAMMB73_318834                  87.8    3e-19   
gb|KEH22046.1|  ClC chloride channel family protein                   95.5    5e-19   Medicago truncatula
ref|XP_004231786.1|  PREDICTED: chloride channel protein CLC-a-like   92.0    6e-18   Solanum lycopersicum
ref|XP_009355373.1|  PREDICTED: chloride channel protein CLC-c-like   83.6    8e-17   Pyrus x bretschneideri [bai li]
ref|NP_001268053.1|  uncharacterized protein LOC100245380             83.6    9e-17   Vitis vinifera
ref|XP_010657885.1|  PREDICTED: uncharacterized protein LOC100245...  83.6    9e-17   Vitis vinifera
ref|XP_010930514.1|  PREDICTED: chloride channel protein CLC-c-like   86.7    5e-16   Elaeis guineensis
ref|XP_006389435.1|  chloride channel-like family protein             85.9    9e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011028391.1|  PREDICTED: chloride channel protein CLC-c-like   82.0    1e-15   Populus euphratica
ref|XP_011016274.1|  PREDICTED: chloride channel protein CLC-c-like   82.0    1e-15   Populus euphratica
ref|XP_011020210.1|  PREDICTED: putative chloride channel-like pr...  85.1    1e-15   Populus euphratica
ref|XP_009127371.1|  PREDICTED: chloride channel protein CLC-c        80.9    1e-15   Brassica rapa
emb|CDX91539.1|  BnaC02g16210D                                        80.9    1e-15   
ref|XP_004952777.1|  PREDICTED: chloride channel protein CLC-c-like   80.5    2e-15   Setaria italica
ref|XP_010529978.1|  PREDICTED: chloride channel protein CLC-c        80.1    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_009134029.1|  PREDICTED: chloride channel protein CLC-c        80.9    2e-15   Brassica rapa
emb|CDX83179.1|  BnaA03g23270D                                        80.9    2e-15   
emb|CDY21447.1|  BnaC03g27500D                                        80.9    2e-15   Brassica napus [oilseed rape]
ref|XP_010442463.1|  PREDICTED: chloride channel protein CLC-c        84.7    2e-15   Camelina sativa [gold-of-pleasure]
gb|KDP42489.1|  hypothetical protein JCGZ_00286                       84.7    2e-15   Jatropha curcas
ref|XP_010682061.1|  PREDICTED: chloride channel protein CLC-c-like   69.3    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009405902.1|  PREDICTED: chloride channel protein CLC-c-like   83.6    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786445.1|  PREDICTED: chloride channel protein CLC-c-like   83.6    6e-15   Phoenix dactylifera
gb|AFW58337.1|  hypothetical protein ZEAMMB73_926410                  80.9    6e-15   
ref|XP_006385193.1|  Chloride channel protein CLC-c                   75.5    7e-15   
ref|XP_006381102.1|  chloride channel-like family protein             82.8    1e-14   
ref|XP_010674330.1|  PREDICTED: chloride channel protein CLC-c-like   82.4    1e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006280044.1|  hypothetical protein CARUB_v10025921mg           82.4    1e-14   Capsella rubella
gb|KDP30234.1|  hypothetical protein JCGZ_17016                       82.0    1e-14   Jatropha curcas
ref|XP_011047852.1|  PREDICTED: chloride channel protein CLC-c-like   74.7    2e-14   Populus euphratica
ref|NP_199800.1|  chloride channel protein CLC-c                      82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008674757.1|  PREDICTED: chloride channel protein CLC-c        72.8    2e-14   
tpg|DAA56573.1|  TPA: chloride channel protein                        72.8    2e-14   
gb|ADF78069.1|  chloride channel protein                              72.8    2e-14   Zea mays [maize]
emb|CBI29647.3|  unnamed protein product                              75.9    2e-14   Vitis vinifera
ref|XP_002865761.1|  CLC-C                                            81.6    2e-14   
ref|XP_004499372.1|  PREDICTED: chloride channel protein CLC-c-like   76.3    2e-14   Cicer arietinum [garbanzo]
ref|NP_001105216.1|  LOC542114                                        79.3    2e-14   Zea mays [maize]
ref|XP_006647383.1|  PREDICTED: chloride channel protein CLC-c-like   76.3    2e-14   Oryza brachyantha
ref|XP_008644266.1|  PREDICTED: LOC542114 isoform X1                  79.3    2e-14   Zea mays [maize]
ref|XP_010482284.1|  PREDICTED: chloride channel protein CLC-c-like   81.3    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010441249.1|  PREDICTED: chloride channel protein CLC-c-like   80.9    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002530769.1|  chloride channel clc, putative                   80.9    4e-14   Ricinus communis
gb|ADD09861.1|  chloride channel C                                    76.6    4e-14   Eutrema halophilum
ref|XP_006402220.1|  hypothetical protein EUTSA_v10012744mg           76.6    4e-14   Eutrema salsugineum [saltwater cress]
ref|XP_008378937.1|  PREDICTED: chloride channel protein CLC-c-li...  77.0    4e-14   
ref|XP_009393492.1|  PREDICTED: chloride channel protein CLC-c        78.2    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC71893.1|  hypothetical protein OsI_04638                        71.6    5e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAD82092.1|  putative chloride channel                            71.6    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003711.1|  PREDICTED: chloride channel protein CLC-c-like   72.8    5e-14   Populus euphratica
ref|XP_002456727.1|  hypothetical protein SORBIDRAFT_03g041480        70.9    5e-14   Sorghum bicolor [broomcorn]
gb|EEE55755.1|  hypothetical protein OsJ_04269                        71.6    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007013577.1|  Voltage-gated chloride channel family protei...  80.5    5e-14   
ref|XP_007013578.1|  Voltage-gated chloride channel family protei...  80.5    5e-14   
ref|XP_009411882.1|  PREDICTED: chloride channel protein CLC-c-like   75.1    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008336976.1|  PREDICTED: putative chloride channel-like pr...  80.5    6e-14   
ref|XP_004288642.1|  PREDICTED: chloride channel protein CLC-c        76.3    6e-14   Fragaria vesca subsp. vesca
ref|XP_006385076.1|  Chloride channel protein CLC-c                   75.5    6e-14   
ref|XP_011017858.1|  PREDICTED: putative chloride channel-like pr...  80.1    7e-14   Populus euphratica
ref|XP_011017857.1|  PREDICTED: putative chloride channel-like pr...  80.1    7e-14   Populus euphratica
ref|XP_008385147.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...  80.1    7e-14   
ref|XP_008365341.1|  PREDICTED: chloride channel protein CLC-c-like   77.0    7e-14   
gb|EMT06377.1|  Putative chloride channel-like protein CLC-g          75.5    7e-14   
ref|XP_008354360.1|  PREDICTED: putative chloride channel-like pr...  80.1    7e-14   
gb|KHN47107.1|  Putative chloride channel-like protein CLC-g          77.8    7e-14   Glycine soja [wild soybean]
ref|XP_003542650.1|  PREDICTED: putative chloride channel-like pr...  77.8    7e-14   Glycine max [soybeans]
ref|XP_007225226.1|  hypothetical protein PRUPE_ppa001898mg           76.6    8e-14   
ref|XP_009363967.1|  PREDICTED: putative chloride channel-like pr...  80.1    8e-14   Pyrus x bretschneideri [bai li]
ref|NP_001275140.1|  chloride channel protein CLC-c-like              79.7    8e-14   Solanum tuberosum [potatoes]
ref|XP_010050093.1|  PREDICTED: putative chloride channel-like pr...  79.7    9e-14   Eucalyptus grandis [rose gum]
ref|XP_004248849.1|  PREDICTED: chloride channel protein CLC-c-like   79.7    9e-14   Solanum lycopersicum
gb|EEE60792.1|  hypothetical protein OsJ_14377                        78.6    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008218680.1|  PREDICTED: chloride channel protein CLC-c        76.6    1e-13   
dbj|BAD16425.1|  chloride channel                                     74.7    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652320.1|  PREDICTED: chloride channel protein CLC-c-like   78.6    1e-13   Oryza brachyantha
ref|XP_003592890.1|  Chloride channel protein CLC-c                   73.9    1e-13   Medicago truncatula
dbj|BAJ92873.1|  predicted protein                                    76.3    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC77341.1|  hypothetical protein OsI_16021                        77.8    1e-13   Oryza sativa Indica Group [Indian rice]
gb|EAY94258.1|  hypothetical protein OsI_16029                        78.2    1e-13   Oryza sativa Indica Group [Indian rice]
gb|ADF30876.1|  chloride channel protein                              79.3    1e-13   Citrus trifoliata [hardy orange]
ref|XP_004975700.1|  PREDICTED: chloride channel protein CLC-c-li...  75.1    1e-13   
dbj|BAJ97961.1|  predicted protein                                    76.3    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC73409.1|  hypothetical protein OsI_07665                        74.7    1e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_004975698.1|  PREDICTED: chloride channel protein CLC-c-li...  75.1    1e-13   
ref|XP_004975699.1|  PREDICTED: chloride channel protein CLC-c-li...  75.1    1e-13   
ref|XP_004975701.1|  PREDICTED: chloride channel protein CLC-c-li...  75.1    2e-13   
ref|XP_008378936.1|  PREDICTED: chloride channel protein CLC-c-li...  75.5    2e-13   
ref|XP_002454002.1|  hypothetical protein SORBIDRAFT_04g022890        77.0    2e-13   Sorghum bicolor [broomcorn]
ref|XP_007152471.1|  hypothetical protein PHAVU_004G133400g           70.1    2e-13   Phaseolus vulgaris [French bean]
ref|XP_009358559.1|  PREDICTED: putative chloride channel-like pr...  78.6    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_010541946.1|  PREDICTED: putative chloride channel-like pr...  78.6    3e-13   Tarenaya hassleriana [spider flower]
emb|CDO97645.1|  unnamed protein product                              78.6    3e-13   Coffea canephora [robusta coffee]
ref|XP_010274995.1|  PREDICTED: chloride channel protein CLC-c        78.2    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_004970759.1|  PREDICTED: chloride channel protein CLC-c-like   68.9    3e-13   Setaria italica
ref|XP_009108066.1|  PREDICTED: putative chloride channel-like pr...  78.2    3e-13   Brassica rapa
emb|CDY47559.1|  BnaA08g07280D                                        78.2    3e-13   Brassica napus [oilseed rape]
dbj|BAB97267.1|  chloride channel                                     78.2    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008801913.1|  PREDICTED: putative chloride channel-like pr...  75.9    4e-13   Phoenix dactylifera
gb|EMS55037.1|  Chloride channel protein CLC-c                        70.9    4e-13   Triticum urartu
ref|XP_008801915.1|  PREDICTED: putative chloride channel-like pr...  75.9    4e-13   Phoenix dactylifera
ref|XP_008806106.1|  PREDICTED: chloride channel protein CLC-c-like   77.8    4e-13   
ref|XP_010030223.1|  PREDICTED: chloride channel protein CLC-c-li...  75.9    4e-13   Eucalyptus grandis [rose gum]
ref|XP_006395982.1|  hypothetical protein EUTSA_v10003685mg           77.8    5e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010927804.1|  PREDICTED: chloride channel protein CLC-c-like   77.8    5e-13   
gb|EMS56861.1|  Putative chloride channel-like protein CLC-g          75.5    5e-13   Triticum urartu
ref|NP_001267998.1|  uncharacterized protein LOC100255837             77.4    5e-13   Vitis vinifera
ref|XP_010656505.1|  PREDICTED: uncharacterized protein LOC100255...  77.4    5e-13   Vitis vinifera
ref|XP_009599120.1|  PREDICTED: chloride channel protein CLC-c-like   77.4    5e-13   Nicotiana tomentosiformis
gb|EMT28663.1|  Chloride channel protein CLC-c                        70.9    5e-13   
ref|XP_002447895.1|  hypothetical protein SORBIDRAFT_06g017570        73.9    5e-13   Sorghum bicolor [broomcorn]
emb|CAN62616.1|  hypothetical protein VITISV_036165                   77.4    5e-13   Vitis vinifera
ref|XP_006470992.1|  PREDICTED: chloride channel protein CLC-c-li...  77.4    6e-13   Citrus sinensis [apfelsine]
gb|KDO42564.1|  hypothetical protein CISIN_1g003885mg                 76.3    6e-13   Citrus sinensis [apfelsine]
ref|XP_006431490.1|  hypothetical protein CICLE_v10000336mg           76.3    6e-13   Citrus clementina [clementine]
gb|AIY56605.1|  CLC                                                   71.6    6e-13   Arachis hypogaea [goober]
ref|XP_003581281.1|  PREDICTED: chloride channel protein CLC-c-like   74.7    6e-13   Brachypodium distachyon [annual false brome]
gb|EMT13398.1|  Chloride channel protein CLC-c                        73.2    1e-12   
ref|XP_009791971.1|  PREDICTED: chloride channel protein CLC-c-like   76.6    1e-12   Nicotiana sylvestris
ref|XP_009618449.1|  PREDICTED: chloride channel protein CLC-c-like   76.6    1e-12   Nicotiana tomentosiformis
dbj|BAB97268.1|  chloride channel                                     76.3    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006349289.1|  PREDICTED: chloride channel protein CLC-c-like   76.3    1e-12   Solanum tuberosum [potatoes]
ref|XP_001756485.1|  predicted protein                                69.3    1e-12   
ref|XP_003575152.1|  PREDICTED: chloride channel protein CLC-c-like   75.1    1e-12   Brachypodium distachyon [annual false brome]
gb|EYU35026.1|  hypothetical protein MIMGU_mgv1a001577mg              75.9    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_007204268.1|  hypothetical protein PRUPE_ppa001699mg           75.9    2e-12   Prunus persica
ref|XP_002870407.1|  hypothetical protein ARALYDRAFT_493576           75.9    2e-12   
ref|NP_198313.2|  putative chloride channel-like protein CLC-g        75.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004230422.1|  PREDICTED: chloride channel protein CLC-c        75.9    2e-12   Solanum lycopersicum
ref|XP_009586704.1|  PREDICTED: putative chloride channel-like pr...  75.9    2e-12   Nicotiana tomentosiformis
ref|XP_009392132.1|  PREDICTED: putative chloride channel-like pr...  69.3    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009768532.1|  PREDICTED: chloride channel protein CLC-c-like   75.5    2e-12   Nicotiana sylvestris
ref|XP_010909770.1|  PREDICTED: chloride channel protein CLC-c-like   75.5    2e-12   
ref|XP_009392134.1|  PREDICTED: putative chloride channel-like pr...  69.3    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392135.1|  PREDICTED: putative chloride channel-like pr...  69.3    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008242835.1|  PREDICTED: putative chloride channel-like pr...  75.5    3e-12   Prunus mume [ume]
ref|XP_004133730.1|  PREDICTED: chloride channel protein CLC-c-li...  71.2    3e-12   Cucumis sativus [cucumbers]
ref|XP_008788814.1|  PREDICTED: putative chloride channel-like pr...  72.4    3e-12   Phoenix dactylifera
ref|XP_008788815.1|  PREDICTED: putative chloride channel-like pr...  72.4    3e-12   Phoenix dactylifera
gb|EMT27046.1|  Chloride channel protein CLC-c                        73.9    3e-12   
ref|XP_009403721.1|  PREDICTED: chloride channel protein CLC-c-like   75.1    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS67360.1|  Chloride channel protein CLC-c                        73.2    3e-12   Triticum urartu
ref|XP_010099780.1|  Chloride channel protein CLC-c                   75.1    3e-12   Morus notabilis
ref|XP_003573678.1|  PREDICTED: putative chloride channel-like pr...  71.2    3e-12   Brachypodium distachyon [annual false brome]
dbj|BAB97269.1|  chloride channel                                     74.7    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009777968.1|  PREDICTED: putative chloride channel-like pr...  74.7    4e-12   Nicotiana sylvestris
gb|ADW93911.1|  chloride channel 1                                    73.6    4e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY12393.1|  BnaC08g08120D                                        74.7    4e-12   Brassica napus [oilseed rape]
gb|EYU34964.1|  hypothetical protein MIMGU_mgv1a001646mg              74.7    4e-12   Erythranthe guttata [common monkey flower]
ref|XP_010450335.1|  PREDICTED: putative chloride channel-like pr...  74.7    5e-12   Camelina sativa [gold-of-pleasure]
gb|KJB64678.1|  hypothetical protein B456_010G060300                  74.3    6e-12   Gossypium raimondii
ref|NP_001268085.1|  uncharacterized protein LOC100259734             68.6    6e-12   Vitis vinifera
emb|CBI27719.3|  unnamed protein product                              68.6    6e-12   Vitis vinifera
ref|XP_010250239.1|  PREDICTED: putative chloride channel-like pr...  73.9    9e-12   Nelumbo nucifera [Indian lotus]
ref|XP_006852872.1|  hypothetical protein AMTR_s00033p00206270        68.6    9e-12   Amborella trichopoda
ref|XP_010999722.1|  PREDICTED: chloride channel protein CLC-c-like   73.6    9e-12   Populus euphratica
ref|XP_003567326.1|  PREDICTED: chloride channel protein CLC-c-like   67.8    1e-11   Brachypodium distachyon [annual false brome]
gb|KFK30515.1|  hypothetical protein AALP_AA7G272300                  73.6    1e-11   Arabis alpina [alpine rockcress]
ref|XP_006652911.1|  PREDICTED: putative chloride channel-like pr...  72.4    1e-11   Oryza brachyantha
ref|XP_006836849.1|  hypothetical protein AMTR_s00099p00074960        73.6    1e-11   Amborella trichopoda
ref|XP_006283171.1|  hypothetical protein CARUB_v10004204mg           73.2    1e-11   
ref|XP_010096974.1|  Putative chloride channel-like protein CLC-g     72.8    2e-11   
ref|XP_003609433.1|  hypothetical protein MTR_4g115640                72.8    2e-11   Medicago truncatula
gb|KDO73468.1|  hypothetical protein CISIN_1g003801mg                 72.8    2e-11   Citrus sinensis [apfelsine]
ref|XP_006453099.1|  hypothetical protein CICLE_v10007502mg           72.8    2e-11   
gb|EPS68170.1|  hypothetical protein M569_06601                       72.8    2e-11   Genlisea aurea
gb|KCW74788.1|  hypothetical protein EUGRSUZ_E03522                   72.8    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010057598.1|  PREDICTED: putative chloride channel-like pr...  72.8    2e-11   Eucalyptus grandis [rose gum]
emb|CDM85188.1|  unnamed protein product                              72.8    2e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011087632.1|  PREDICTED: chloride channel protein CLC-c        72.4    2e-11   
ref|XP_002453459.1|  hypothetical protein SORBIDRAFT_04g006250        68.2    3e-11   
ref|XP_010928311.1|  PREDICTED: putative chloride channel-like pr...  70.9    3e-11   
ref|XP_011084085.1|  PREDICTED: putative chloride channel-like pr...  72.0    3e-11   
ref|XP_006388251.1|  hypothetical protein POPTR_0261s002202g          68.9    3e-11   
ref|XP_009418228.1|  PREDICTED: putative chloride channel-like pr...  67.4    3e-11   
ref|XP_011078419.1|  PREDICTED: putative chloride channel-like pr...  72.0    3e-11   
ref|XP_010241599.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...  72.0    4e-11   
ref|XP_010435388.1|  PREDICTED: putative chloride channel-like pr...  72.0    4e-11   
gb|EPS73799.1|  hypothetical protein M569_00956                       71.6    4e-11   
gb|KEH25446.1|  ClC chloride channel family protein                   47.4    4e-11   
ref|XP_007048601.1|  Chloride channel C                               71.6    4e-11   
ref|XP_008452224.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  71.6    5e-11   
gb|ACF87782.1|  unknown                                               69.7    5e-11   
ref|XP_004242745.2|  PREDICTED: putative chloride channel-like pr...  71.2    5e-11   
gb|AAQ56538.1|  putative chloride channel                             69.7    8e-11   
ref|XP_004508447.1|  PREDICTED: putative chloride channel-like pr...  68.9    8e-11   
ref|XP_004979167.1|  PREDICTED: putative chloride channel-like pr...  68.9    9e-11   
ref|XP_008644088.1|  PREDICTED: uncharacterized protein LOC100383...  67.0    1e-10   
ref|XP_009401374.1|  PREDICTED: putative chloride channel-like pr...  70.5    1e-10   
gb|KJB46914.1|  hypothetical protein B456_008G001200                  65.5    1e-10   
ref|XP_009401373.1|  PREDICTED: putative chloride channel-like pr...  70.5    1e-10   
ref|XP_010905336.1|  PREDICTED: putative chloride channel-like pr...  66.6    1e-10   
gb|EEE61792.1|  hypothetical protein OsJ_16396                        68.2    1e-10   
gb|KDP44103.1|  hypothetical protein JCGZ_05570                       70.1    1e-10   
emb|CAD41919.2|  OSJNBa0033G05.20                                     68.2    1e-10   
emb|CAJ86158.1|  H0413E07.11                                          68.2    1e-10   
gb|ABB86548.1|  chloride channel-like protein Osclc                   68.2    1e-10   
ref|XP_010025693.1|  PREDICTED: chloride channel protein CLC-c-like   70.1    2e-10   
ref|XP_008793993.1|  PREDICTED: putative chloride channel-like pr...  65.5    2e-10   
gb|KHG13135.1|  Chloride channel CLC-b -like protein                  69.7    2e-10   
gb|KJB40520.1|  hypothetical protein B456_007G067500                  69.3    2e-10   
gb|KJB40519.1|  hypothetical protein B456_007G067500                  69.3    2e-10   
ref|XP_007155066.1|  hypothetical protein PHAVU_003G170300g           69.3    2e-10   
ref|XP_009403199.1|  PREDICTED: putative chloride channel-like pr...  68.9    3e-10   
ref|XP_009403198.1|  PREDICTED: putative chloride channel-like pr...  68.9    3e-10   
ref|XP_008227672.1|  PREDICTED: chloride channel protein CLC-c-like   68.6    4e-10   
ref|XP_006359489.1|  PREDICTED: putative chloride channel-like pr...  68.6    4e-10   
ref|XP_006599664.1|  PREDICTED: chloride channel protein CLC-c-li...  62.4    4e-10   
ref|XP_006599656.1|  PREDICTED: chloride channel protein CLC-c-li...  62.4    4e-10   
gb|EMS50378.1|  Chloride channel protein CLC-c                        66.6    4e-10   
gb|AFW70590.1|  hypothetical protein ZEAMMB73_498282                  63.9    5e-10   
tpg|DAA35719.1|  TPA: hypothetical protein ZEAMMB73_781870            68.6    5e-10   
ref|XP_008667038.1|  PREDICTED: chloride channel G isoform X1         68.2    5e-10   
ref|XP_004486231.1|  PREDICTED: chloride channel protein CLC-c-like   63.5    6e-10   
ref|XP_006587397.1|  PREDICTED: chloride channel protein CLC-c-li...  60.8    8e-10   
ref|XP_003533268.2|  PREDICTED: chloride channel protein CLC-c-li...  60.8    8e-10   
gb|KHM99790.1|  Chloride channel protein CLC-c                        60.8    8e-10   
gb|KHF97413.1|  Chloride channel CLC-b -like protein                  67.4    1e-09   
ref|XP_010241601.1|  PREDICTED: putative chloride channel-like pr...  67.0    1e-09   
ref|XP_010241600.1|  PREDICTED: putative chloride channel-like pr...  67.0    1e-09   
ref|XP_004977021.1|  PREDICTED: putative chloride channel-like pr...  67.0    2e-09   
ref|XP_004287270.1|  PREDICTED: putative chloride channel-like pr...  66.6    2e-09   
ref|XP_004287269.1|  PREDICTED: putative chloride channel-like pr...  66.6    2e-09   
ref|XP_002447212.1|  hypothetical protein SORBIDRAFT_06g030530        66.6    2e-09   
gb|KEH32756.1|  chloride channel ClC1 protein                         61.2    2e-09   
ref|XP_004173256.1|  PREDICTED: chloride channel protein CLC-c-like   62.4    3e-09   
ref|XP_007214607.1|  hypothetical protein PRUPE_ppa001700mg           66.2    3e-09   
ref|XP_002974253.1|  hypothetical protein SELMODRAFT_100906           58.9    5e-09   
ref|XP_008457165.1|  PREDICTED: putative chloride channel-like pr...  61.6    6e-09   
ref|XP_002985623.1|  hypothetical protein SELMODRAFT_181899           58.5    6e-09   
gb|AES75975.2|  chloride channel ClC1 protein                         61.6    6e-09   
ref|XP_003619757.1|  Chloride channel protein CLC-c                   61.6    7e-09   
gb|KJB53990.1|  hypothetical protein B456_009G015100                  64.7    7e-09   
ref|XP_002885387.1|  hypothetical protein ARALYDRAFT_898491           53.1    8e-09   
ref|NP_001267618.1|  putative chloride channel-like protein CLC-g...  61.6    9e-09   
ref|XP_004165980.1|  PREDICTED: putative chloride channel-like pr...  61.6    1e-08   
ref|XP_010687880.1|  PREDICTED: putative chloride channel-like pr...  60.5    2e-08   
ref|XP_004512644.1|  PREDICTED: chloride channel protein CLC-c-li...  63.2    2e-08   
ref|XP_004512643.1|  PREDICTED: chloride channel protein CLC-c-li...  63.2    2e-08   
ref|XP_010687879.1|  PREDICTED: putative chloride channel-like pr...  60.5    2e-08   
ref|XP_009339814.1|  PREDICTED: chloride channel protein CLC-c-like   63.2    3e-08   
tpg|DAA35720.1|  TPA: chloride channel G                              62.8    3e-08   
tpg|DAA35721.1|  TPA: hypothetical protein ZEAMMB73_781870            62.8    3e-08   
ref|NP_001130407.2|  chloride channel G                               62.8    3e-08   
gb|EMS56130.1|  Putative chloride channel-like protein CLC-g          62.0    6e-08   
dbj|BAJ97313.1|  predicted protein                                    61.2    8e-08   
emb|CDP10469.1|  unnamed protein product                              60.8    1e-07   
ref|XP_008368156.1|  PREDICTED: chloride channel protein CLC-c-like   60.8    1e-07   
ref|XP_008361634.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  60.8    1e-07   
ref|XP_003580671.2|  PREDICTED: putative chloride channel-like pr...  60.5    2e-07   
gb|EMT23162.1|  Putative chloride channel-like protein CLC-g          60.5    2e-07   
gb|KDO43323.1|  hypothetical protein CISIN_1g0039661mg                53.9    3e-06   
ref|XP_002527858.1|  chloride channel clc, putative                   49.7    6e-04   



>ref|XP_011097296.1| PREDICTED: chloride channel protein CLC-b-like [Sesamum indicum]
Length=787

 Score =   124 bits (310),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  190  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  369
            +E   A    + E + + DPESN+LH+PLLKRNRTLSS+P+A++GAKVS IESLDYEINE
Sbjct  8    VEAEAANIQRQGEDEEERDPESNTLHQPLLKRNRTLSSSPLAIVGAKVSHIESLDYEINE  67

Query  370  NDLFKHDWRSRSKSHVLQYVFL  435
            NDLFK DWRSRSK+ VLQY+FL
Sbjct  68   NDLFKQDWRSRSKTEVLQYIFL  89


 Score = 48.5 bits (114),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW LAFL+GLLTGLIATLINLA+ENIAGYKLLAV+ YI+  RYLMGF Y  G
Sbjct  88   FLKWLLAFLVGLLTGLIATLINLAVENIAGYKLLAVVKYIEQKRYLMGFIYMAG  141



>ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF50918.1| chloride channel clc, putative [Ricinus communis]
Length=787

 Score =   120 bits (302),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +1

Query  214  TNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDW  393
            T E   + + DPESNSL +PLLKRNRTLSS+P+A++GAKVS IESLDYEINENDLFKHDW
Sbjct  17   TMEASQEEERDPESNSLQQPLLKRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHDW  76

Query  394  RSRSKSHVLQYVFL  435
            RSRS   +LQY+FL
Sbjct  77   RSRSNVQILQYIFL  90


 Score = 49.7 bits (117),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW LAFL+GLLTGLIATLINLA+ENIAGYKLLAV+ +I+N RYL G AYF G
Sbjct  89   FLKWILAFLVGLLTGLIATLINLAVENIAGYKLLAVVRFIENERYLTGLAYFTG  142



>emb|CDP16685.1| unnamed protein product [Coffea canephora]
Length=786

 Score =   135 bits (339),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 3/86 (3%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDY  357
            S +FA A  TN+++GQA +   DPESNSLH+PLLKRNRTLSS P+A++GAKVS IESLDY
Sbjct  4    SNQFAAAAVTNDVDGQAQNQERDPESNSLHQPLLKRNRTLSSNPLAVVGAKVSYIESLDY  63

Query  358  EINENDLFKHDWRSRSKSHVLQYVFL  435
            EINENDLFKHDWRSR++  VLQYVFL
Sbjct  64   EINENDLFKHDWRSRAQVQVLQYVFL  89


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KWTLAFL+GLLTG+IATLINLA+ENIAGYKLL V++YI+N RYLMGF +F
Sbjct  80   QVQVLQYVFLKWTLAFLVGLLTGVIATLINLAVENIAGYKLLKVIDYINNKRYLMGFLFF  139

Query  585  VG  590
             G
Sbjct  140  AG  141



>ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
 gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
Length=782

 Score =   116 bits (291),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 6/90 (7%)
 Frame = +1

Query  202  GAGSTNE--MEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEND  375
            G+ S N+  +E   + DPESN L+ PLLKRNRTLSS P+A++GAKVS IESLDYEINEND
Sbjct  10   GSTSMNDTMVEEVEERDPESNPLNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINEND  69

Query  376  LFKHDWRSRSKSHVLQYVFLNGHWRS*LGF  465
            LFK DWRSRS++ VLQY+F    W+  L F
Sbjct  70   LFKQDWRSRSRAQVLQYIF----WKWSLAF  95


 Score = 50.1 bits (118),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV+N+I N RYL GF YF G
Sbjct  113  ENIAGYKLLAVVNFIQNERYLTGFLYFTG  141



>ref|NP_001236494.1| chloride channel [Glycine max]
 gb|AAY43007.1| chloride channel [Glycine max]
Length=783

 Score =   118 bits (296),  Expect(2) = 5e-32, Method: Composition-based stats.
 Identities = 57/91 (63%), Positives = 67/91 (74%), Gaps = 4/91 (4%)
 Frame = +1

Query  193  EFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEN  372
            E      TN +E   + DPESN L+ PLLKRNRTLSS P+A++GAKVS IESLDYEINEN
Sbjct  10   ESTSINDTNMVEEVEERDPESNPLNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINEN  69

Query  373  DLFKHDWRSRSKSHVLQYVFLNGHWRS*LGF  465
            DLFK DWRSRS++ VLQY+F    W+  L F
Sbjct  70   DLFKQDWRSRSRTQVLQYIF----WKWTLAF  96


 Score = 46.2 bits (108),  Expect(2) = 5e-32, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYK LAV+N+I   RYL GF YF G
Sbjct  114  ENIAGYKFLAVVNFIQKERYLRGFLYFTG  142



>gb|KHN01525.1| Chloride channel protein CLC-b [Glycine soja]
Length=783

 Score =   118 bits (296),  Expect(2) = 5e-32, Method: Composition-based stats.
 Identities = 57/91 (63%), Positives = 67/91 (74%), Gaps = 4/91 (4%)
 Frame = +1

Query  193  EFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEN  372
            E      TN +E   + DPESN L+ PLLKRNRTLSS P+A++GAKVS IESLDYEINEN
Sbjct  10   ESTSINDTNMVEEVEERDPESNPLNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINEN  69

Query  373  DLFKHDWRSRSKSHVLQYVFLNGHWRS*LGF  465
            DLFK DWRSRS++ VLQY+F    W+  L F
Sbjct  70   DLFKQDWRSRSRTQVLQYIF----WKWTLAF  96


 Score = 46.2 bits (108),  Expect(2) = 5e-32, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYK LAV+N+I   RYL GF YF G
Sbjct  114  ENIAGYKFLAVVNFIQKERYLRGFLYFTG  142



>ref|XP_010111585.1| Chloride channel protein CLC-b [Morus notabilis]
 gb|EXC31330.1| Chloride channel protein CLC-b [Morus notabilis]
Length=788

 Score =   121 bits (303),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            DPESNSL RPLLKRNRTLSS+P+A++G KVS IESLDYEINENDLFKHDWRSRS++ VLQ
Sbjct  27   DPESNSLTRPLLKRNRTLSSSPLAIVGTKVSHIESLDYEINENDLFKHDWRSRSRAQVLQ  86

Query  424  YVFL  435
            YVFL
Sbjct  87   YVFL  90


 Score = 42.4 bits (98),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV+ YI+  RY+ G  YF  
Sbjct  114  ENIAGYKLLAVVAYIEQERYITGLIYFTA  142



>gb|KDO43322.1| hypothetical protein CISIN_1g0039661mg, partial [Citrus sinensis]
Length=188

 Score =   116 bits (290),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 1/72 (1%)
 Frame = +1

Query  223  MEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  399
            ME   ++ DPESNSL +PLLKR+RTLSS+P+A++GAKVS IESLDYEINENDLFKHDWRS
Sbjct  16   MEADEEERDPESNSLQQPLLKRSRTLSSSPLALVGAKVSHIESLDYEINENDLFKHDWRS  75

Query  400  RSKSHVLQYVFL  435
            RSK  VLQY+FL
Sbjct  76   RSKVQVLQYIFL  87


 Score = 47.0 bits (110),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV+++I+ +RYL GF YF G
Sbjct  111  ENIAGYKLLAVVSFIEKDRYLQGFLYFTG  139



>ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao]
 gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao]
Length=787

 Score =   117 bits (294),  Expect(2) = 5e-31, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  247  PESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQY  426
            PESNSL  PLLKRNRTLSS+P+A++GAKVS IESLDYEINEND+FKHDWRSRSK+ VLQY
Sbjct  28   PESNSLGEPLLKRNRTLSSSPLALVGAKVSHIESLDYEINENDIFKHDWRSRSKAQVLQY  87

Query  427  VFL  435
            +FL
Sbjct  88   IFL  90


 Score = 43.5 bits (101),  Expect(2) = 5e-31, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KWTLAFL+GLLTGLIATLINLAIENIAGYKLLA++ +I+  RYL G  +F G
Sbjct  89   FLKWTLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYLSGLVFFTG  142



>ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao]
 gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao]
Length=799

 Score =   117 bits (294),  Expect(2) = 6e-31, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  247  PESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQY  426
            PESNSL  PLLKRNRTLSS+P+A++GAKVS IESLDYEINEND+FKHDWRSRSK+ VLQY
Sbjct  26   PESNSLGEPLLKRNRTLSSSPLALVGAKVSHIESLDYEINENDIFKHDWRSRSKAQVLQY  85

Query  427  VFL  435
            +FL
Sbjct  86   IFL  88


 Score = 43.1 bits (100),  Expect(2) = 6e-31, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KWTLAFL+GLLTGLIATLINLAIENIAGYKLLA++ +I+  RYL G  +F G
Sbjct  87   FLKWTLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYLSGLVFFTG  140



>emb|CDX67478.1| BnaA07g15180D [Brassica napus]
Length=770

 Score =   119 bits (298),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            S +   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHD
Sbjct  10   SNSNYNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHD  69

Query  391  WRSRSKSHVLQYVF  432
            WRSRSK+ VLQY+F
Sbjct  70   WRSRSKAQVLQYIF  83


 Score = 40.4 bits (93),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KWTLAFL+GLLTGLIATLINLA+ENIAGYKLLAV +YI  +RY+ G   F G
Sbjct  83   FAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYISQDRYVTGLLVFTG  136



>ref|XP_009125164.1| PREDICTED: chloride channel protein CLC-a-like [Brassica rapa]
Length=770

 Score =   119 bits (298),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            S +   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHD
Sbjct  10   SNSNYNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHD  69

Query  391  WRSRSKSHVLQYVF  432
            WRSRSK+ VLQY+F
Sbjct  70   WRSRSKAQVLQYIF  83


 Score = 40.4 bits (93),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KWTLAFL+GLLTGLIATLINLA+ENIAGYKLLAV +YI  +RY+ G   F G
Sbjct  83   FAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYISQDRYVTGLLVFTG  136



>emb|CDY11722.1| BnaC06g13300D [Brassica napus]
Length=770

 Score =   119 bits (299),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            S +   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHD
Sbjct  10   SNSNYNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHD  69

Query  391  WRSRSKSHVLQYVF  432
            WRSRSK+ VLQY+F
Sbjct  70   WRSRSKTQVLQYIF  83


 Score = 40.0 bits (92),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KWTLAFL+GLLTGLIATLINLA+ENIAGYKLLAV +YI  +RY+ G   F G
Sbjct  83   FAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYIGQDRYVTGLLVFTG  136



>ref|XP_008365471.1| PREDICTED: chloride channel protein CLC-a-like [Malus domestica]
Length=117

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +1

Query  199  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
            A    T +  G  + DPES SL +PLLKRNRTLSSTP+AM+GAKVS IESLDYEINEN L
Sbjct  11   AAIPQTMQETGXEERDPESISLQQPLLKRNRTLSSTPLAMVGAKVSHIESLDYEINENXL  70

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FKHDWRSRSK  VLQYVFL
Sbjct  71   FKHDWRSRSKVQVLQYVFL  89



>ref|XP_009761471.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana sylvestris]
Length=786

 Score =   127 bits (318),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 3/79 (4%)
 Frame = +1

Query  208  GSTNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
             + N M+GQ ++   DPESNSLH+PLLKRNRTLSS+P A++GAKVS IESLDYEINENDL
Sbjct  11   ATINNMDGQQNEEERDPESNSLHQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDL  70

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FKHDWR RS+  VLQYVFL
Sbjct  71   FKHDWRRRSRVQVLQYVFL  89


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KWTLAFL+GLLTG+ ATLINLAIEN+AGYKL AV+NYI++ RYLMGFAYF
Sbjct  80   RVQVLQYVFLKWTLAFLVGLLTGVTATLINLAIENMAGYKLRAVVNYIEDRRYLMGFAYF  139

Query  585  VG  590
             G
Sbjct  140  AG  141



>gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum]
Length=786

 Score =   127 bits (318),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 3/79 (4%)
 Frame = +1

Query  208  GSTNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
             + N M+GQ ++   DPESNSLH+PLLKRNRTLSS+P A++GAKVS IESLDYEINENDL
Sbjct  11   ATINNMDGQQNEEERDPESNSLHQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDL  70

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FKHDWR RS+  VLQYVFL
Sbjct  71   FKHDWRRRSRVQVLQYVFL  89


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KWTLAFL+GLLTG+ ATLINLAIEN+AGYKL AV+NYI++ RYLMGFAYF
Sbjct  80   RVQVLQYVFLKWTLAFLVGLLTGVTATLINLAIENMAGYKLRAVVNYIEDRRYLMGFAYF  139

Query  585  VG  590
             G
Sbjct  140  AG  141



>ref|XP_008353449.1| PREDICTED: chloride channel protein CLC-b-like [Malus domestica]
Length=196

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +1

Query  199  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
            A    T +  G  + DPES SL +PLLKRNRTLSSTP+AM+GAKVS IESLDYEINEN L
Sbjct  11   AAIPQTMQETGXEERDPESISLQQPLLKRNRTLSSTPLAMVGAKVSHIESLDYEINENXL  70

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FKHDWRSRSK  VLQYVFL
Sbjct  71   FKHDWRSRSKVQVLQYVFL  89



>ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa]
 gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa]
Length=785

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +1

Query  187  SMEFAGAGSTNEME-GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            S + A A + + +E G+   DPESN+LH+PLLKRNRTLSS P+A++GAKVS IESLDYEI
Sbjct  5    SSQLAEATAGHNLEVGEEGRDPESNTLHQPLLKRNRTLSSNPLALVGAKVSHIESLDYEI  64

Query  364  NENDLFKHDWRSRSKSHVLQYVFLNGHWRS*LGF  465
            NENDLFKHDWRSRSK  VLQY+F    W+  L F
Sbjct  65   NENDLFKHDWRSRSKVQVLQYIF----WKWTLAF  94



>ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula]
Length=780

 Score =   108 bits (271),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            DPE N ++ PLLKRNRTLSS P+A++GAKVS IESLDYEINENDLFK DWRSRS+  V+Q
Sbjct  22   DPERNPMNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRGQVMQ  81

Query  424  YVFL  435
            Y+ L
Sbjct  82   YIIL  85


 Score = 46.6 bits (109),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENI+GYKLL V+ YI   RYLMGF YF+G
Sbjct  109  ENISGYKLLTVVGYIQQERYLMGFLYFLG  137



>gb|AES75065.2| ClC chloride channel family protein [Medicago truncatula]
Length=775

 Score =   108 bits (271),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            DPE N ++ PLLKRNRTLSS P+A++GAKVS IESLDYEINENDLFK DWRSRS+  V+Q
Sbjct  22   DPERNPMNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRGQVMQ  81

Query  424  YVFL  435
            Y+ L
Sbjct  82   YIIL  85


 Score = 46.6 bits (109),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENI+GYKLL V+ YI   RYLMGF YF+G
Sbjct  109  ENISGYKLLTVVGYIQQERYLMGFLYFLG  137



>ref|XP_011098867.1| PREDICTED: chloride channel protein CLC-a-like [Sesamum indicum]
Length=787

 Score =   109 bits (272),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  256  NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            N+LH+PLLKRNRTLSS+P+A++GAKVS IESLDYEINENDLFK DWRSRS+  VLQY+FL
Sbjct  30   NNLHQPLLKRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKQDWRSRSRVQVLQYIFL  89


 Score = 45.4 bits (106),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENI+GYKLLAV+ YI+  RYLMGF Y  G
Sbjct  113  ENISGYKLLAVVRYIEQERYLMGFLYMAG  141



>ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
 gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
Length=778

 Score =   117 bits (294),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +1

Query  184  MSMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            M  +    G+ +   G+ D  PESN+L++PL+K NRTLSSTP+A++GAKVS IESLDYEI
Sbjct  1    MEEDLNQIGNNSNYNGEGD--PESNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEI  58

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
            NENDLFKHDWR RSK+ VLQY+FL
Sbjct  59   NENDLFKHDWRKRSKTQVLQYIFL  82


 Score = 36.6 bits (83),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G   F G
Sbjct  106  ENIAGYKLLAVGHFLAQERYVTGLMMFAG  134



>gb|KFK33637.1| hypothetical protein AALP_AA5G039600 [Arabis alpina]
Length=778

 Score =   118 bits (295),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +1

Query  184  MSMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            M  +    G+ +   G+ D  PESN+L++PL+K NRTLSSTP+A++GAKVS IESLDYEI
Sbjct  1    MEEDLNQIGNNSNYNGEGD--PESNTLNQPLVKANRTLSSTPLALVGAKVSYIESLDYEI  58

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
            NENDLFKHDWR RSK+ VLQYVFL
Sbjct  59   NENDLFKHDWRKRSKAQVLQYVFL  82


 Score = 36.2 bits (82),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G   F G
Sbjct  106  ENIAGYKLLAVGHFLGQERYVTGLMLFAG  134



>ref|XP_004233300.1| PREDICTED: chloride channel protein CLC-b [Solanum lycopersicum]
Length=784

 Score =   124 bits (310),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 3/79 (4%)
 Frame = +1

Query  208  GSTNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
             +TN++ GQ ++   DPESNSL +PLLKRNRTLSS+P A++GAKVS IESLDYEINENDL
Sbjct  10   ATTNDINGQLNEEERDPESNSLRQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDL  69

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FKHDWR RS+  VLQYVFL
Sbjct  70   FKHDWRRRSRVQVLQYVFL  88


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KW+LAFL+GLLTG+ ATLINLAIENIAGYKL AV++YIDN RYLMGFAYF
Sbjct  79   RVQVLQYVFLKWSLAFLVGLLTGVTATLINLAIENIAGYKLRAVVDYIDNRRYLMGFAYF  138

Query  585  VG  590
             G
Sbjct  139  AG  140



>ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   108 bits (269),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            D ESNSL +PLL KRNRTLSS P+A++GAKVS IESLDYEINENDLFKHDWRSRSK  VL
Sbjct  28   DLESNSLIQPLLLKRNRTLSSNPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKVQVL  87

Query  421  QYVFL  435
            QY+ L
Sbjct  88   QYILL  92


 Score = 45.8 bits (107),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ENIAGYKLLAV+ YID  RYLMGF + 
Sbjct  116  ENIAGYKLLAVVAYIDEERYLMGFIFL  142



>gb|KDP46292.1| hypothetical protein JCGZ_10132 [Jatropha curcas]
Length=788

 Score =   124 bits (310),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  184  MSMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            ++ E A   S N   G+ + DPESN+L +PLLKRNRTLSS P+A++GAKVS IESLDYEI
Sbjct  8    LAEEQATVQSHNTEAGEDERDPESNTLQQPLLKRNRTLSSNPLALVGAKVSHIESLDYEI  67

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
            NENDLFKHDWRSRS+  VLQY+FL
Sbjct  68   NENDLFKHDWRSRSQIQVLQYIFL  91


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            +I      F KWTLAFL+GLLTGLIATLINLA+ENIAGYKLLAV+++I+N RYL G AYF
Sbjct  82   QIQVLQYIFLKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVVHFIENERYLTGLAYF  141

Query  585  VG  590
             G
Sbjct  142  TG  143



>ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana]
 sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; 
AltName: Full=CBS domain-containing protein CBSCLC7 [Arabidopsis 
thaliana]
 emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana]
 dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana]
Length=780

 Score =   117 bits (294),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            G  S    EG    DPESN+L++PL+K NRTLSSTP+A++GAKVS IESLDYEINENDLF
Sbjct  10   GGNSNYNGEG---GDPESNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEINENDLF  66

Query  382  KHDWRSRSKSHVLQYVFL  435
            KHDWR RSK+ VLQYVFL
Sbjct  67   KHDWRKRSKAQVLQYVFL  84


 Score = 35.8 bits (81),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G    VG
Sbjct  108  ENIAGYKLLAVGHFLTQERYVTGLMVLVG  136



>ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus]
 gb|AFJ15538.1| chloride channel a [Cucumis sativus]
 gb|KGN63173.1| hypothetical protein Csa_2G406710 [Cucumis sativus]
Length=789

 Score =   123 bits (309),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 3/76 (4%)
 Frame = +1

Query  214  TNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            TN ME +  D   DPESN L++PLLKRNRTLSS+P+A++GAKVS IESLDYEINENDLFK
Sbjct  14   TNSMEAEPQDEERDPESNPLNQPLLKRNRTLSSSPLAIVGAKVSLIESLDYEINENDLFK  73

Query  385  HDWRSRSKSHVLQYVF  432
            HDWRSRSK  VLQY+F
Sbjct  74   HDWRSRSKVQVLQYIF  89


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            K+      F KWTLA L+GLLTG+IATLINLAIENIAGYKLL V++YI   RYLMGFAYF
Sbjct  81   KVQVLQYIFSKWTLACLVGLLTGIIATLINLAIENIAGYKLLKVVDYIKEERYLMGFAYF  140



>ref|XP_009596046.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana tomentosiformis]
Length=786

 Score =   123 bits (309),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 66/79 (84%), Gaps = 3/79 (4%)
 Frame = +1

Query  208  GSTNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
             + N M+GQ ++   DPESNSL +PLLKRNRTLSS+P A++GAKVS IESLDYEINENDL
Sbjct  11   ATINNMDGQQNEEERDPESNSLRQPLLKRNRTLSSSPFALVGAKVSYIESLDYEINENDL  70

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FKHDWR RS+  VLQYVFL
Sbjct  71   FKHDWRRRSRVQVLQYVFL  89


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KWTLAFL+GLLTG+ A+LINLAIENIAGYKL AV+NYI+N RYL+GFAYF
Sbjct  80   RVQVLQYVFLKWTLAFLVGLLTGVTASLINLAIENIAGYKLRAVVNYIENRRYLVGFAYF  139

Query  585  VG  590
             G
Sbjct  140  AG  141



>emb|CDX83663.1| BnaC07g24030D [Brassica napus]
Length=783

 Score =   117 bits (292),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  226  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  405
            E +   DPESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EDEEQGDPESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  406  KSHVLQYVFL  435
            K+ VLQY+FL
Sbjct  77   KTQVLQYIFL  86


 Score = 36.6 bits (83),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G   F G
Sbjct  110  ENIAGYKLLAVGHFLAQERYVTGLMVFAG  138



>ref|XP_011003929.1| PREDICTED: chloride channel protein CLC-b [Populus euphratica]
Length=802

 Score =   123 bits (308),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +1

Query  187  SMEFAGAGSTNEME-GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            S + A A + + +E G+   DPESN+LH+PLLKRN TLSS P+A++GAKVS IESLDYEI
Sbjct  5    SSQLAEAPADHNLEVGEEGRDPESNALHKPLLKRNTTLSSNPLALVGAKVSHIESLDYEI  64

Query  364  NENDLFKHDWRSRSKSHVLQYVFLNGHWRS*LGF  465
            NENDLFKHDWRSRSK  VLQY+F    W+  L F
Sbjct  65   NENDLFKHDWRSRSKVQVLQYIF----WKWTLAF  94



>ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum]
Length=784

 Score =   123 bits (308),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 3/79 (4%)
 Frame = +1

Query  208  GSTNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
             +TN++ GQ ++   DPESNS+ +PLLKRNRTLSS+P A++GAKVS IESLDYEINENDL
Sbjct  10   ATTNDINGQLNEEERDPESNSMRQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDL  69

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FKHDWR RS+  VLQYVFL
Sbjct  70   FKHDWRRRSRVQVLQYVFL  88


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KW+LAFL+GLLTG+ ATLINLAIENIAGYKL AV++YIDN RYLMGFAYF
Sbjct  79   RVQVLQYVFLKWSLAFLVGLLTGVTATLINLAIENIAGYKLRAVVDYIDNRRYLMGFAYF  138

Query  585  VG  590
             G
Sbjct  139  AG  140



>ref|XP_009151988.1| PREDICTED: chloride channel protein CLC-b [Brassica rapa]
Length=783

 Score =   116 bits (291),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  226  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  405
            E +   DPESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEEEQGDPESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  406  KSHVLQYVFL  435
            K+ VLQY+FL
Sbjct  77   KTQVLQYIFL  86


 Score = 36.6 bits (83),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G   F G
Sbjct  110  ENIAGYKLLAVGHFLAQERYVTGLMVFAG  138



>emb|CDY13685.1| BnaA06g32380D [Brassica napus]
Length=783

 Score =   116 bits (291),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  226  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  405
            E +   DPESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEEEQGDPESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  406  KSHVLQYVFL  435
            K+ VLQY+FL
Sbjct  77   KTQVLQYIFL  86


 Score = 36.6 bits (83),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G   F G
Sbjct  110  ENIAGYKLLAVGHFLAQERYVTGLMVFAG  138



>ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
Length=779

 Score =   118 bits (296),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 3/77 (4%)
 Frame = +1

Query  205  AGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            +G++N   G+AD  PESN+L++PL+K NRTLSSTP+A++GAKVS IESLDYEINENDLFK
Sbjct  10   SGNSN-YNGEAD--PESNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEINENDLFK  66

Query  385  HDWRSRSKSHVLQYVFL  435
            HDWR RSK+ VLQYVFL
Sbjct  67   HDWRKRSKAQVLQYVFL  83


 Score = 34.3 bits (77),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G     G
Sbjct  107  ENIAGYKLLAVGHFLTQERYVTGLMVLAG  135



>ref|XP_010905204.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=784

 Score =   112 bits (281),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = +1

Query  205  AGSTNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            A +  E++G+ D+ DPES+SLH+PLLKR  TL++  +AM+GAK+S IESLDYEINENDLF
Sbjct  14   AAADLEVDGEEDEQDPESHSLHQPLLKRTPTLTTHHLAMVGAKISHIESLDYEINENDLF  73

Query  382  KHDWRSRSKSHVLQYVFL  435
            KHDWRSRS   VLQY+FL
Sbjct  74   KHDWRSRSSVQVLQYIFL  91


 Score = 39.3 bits (90),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KWTLAFL+GLLTG++A+LINLAIENIAG K+L V   ++ +RY+ GFAYF G
Sbjct  90   FLKWTLAFLVGLLTGVVASLINLAIENIAGIKMLHVARLVNESRYVTGFAYFTG  143



>ref|XP_010514406.1| PREDICTED: chloride channel protein CLC-b [Camelina sativa]
Length=779

 Score =   117 bits (294),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G  +   G+AD  PESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKH
Sbjct  10   GGNSNYNGEAD--PESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKH  67

Query  388  DWRSRSKSHVLQYVFL  435
            DWR RSK+ VLQYVFL
Sbjct  68   DWRKRSKAQVLQYVFL  83


 Score = 33.5 bits (75),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY  G     G
Sbjct  107  ENIAGYKLLAVGHFLSQERYATGLMVLAG  135



>ref|XP_010660593.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 ref|XP_010660594.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 emb|CBI21361.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   112 bits (280),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +1

Query  211  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            S+ E  G+ ++ D ESN L++PLLKR+RTLSS P+A++GAKVS IESLDYEINENDLFKH
Sbjct  17   SSVEGVGEGEERDLESNPLNQPLLKRSRTLSSNPLAIVGAKVSHIESLDYEINENDLFKH  76

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSRS + VLQY+FL
Sbjct  77   DWRSRSSAQVLQYIFL  92


 Score = 38.5 bits (88),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            F KW+LAFL+GLLTGLIATLINLA+ENIAGYKLLAV   ++  RYL GF Y 
Sbjct  91   FLKWSLAFLVGLLTGLIATLINLAVENIAGYKLLAVSGLVEKKRYLTGFIYL  142



>ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera]
 gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera]
Length=789

 Score =   112 bits (280),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +1

Query  211  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            S+ E  G+ ++ D ESN L++PLLKR+RTLSS P+A++GAKVS IESLDYEINENDLFKH
Sbjct  17   SSVEGVGEGEERDLESNPLNQPLLKRSRTLSSNPLAIVGAKVSHIESLDYEINENDLFKH  76

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSRS + VLQY+FL
Sbjct  77   DWRSRSSAQVLQYIFL  92


 Score = 38.5 bits (88),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            F KW+LAFL+GLLTGLIATLINLA+ENIAGYKLLAV   ++  RYL GF Y 
Sbjct  91   FLKWSLAFLVGLLTGLIATLINLAVENIAGYKLLAVSGLVEKKRYLTGFIYL  142



>ref|XP_009371657.1| PREDICTED: chloride channel protein CLC-b-like [Pyrus x bretschneideri]
Length=787

 Score =   120 bits (302),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  199  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
            A    T +  G  + DPES SL +PLLKR+RTLSSTP+AM+GAKVS IESLDYEINENDL
Sbjct  11   AAIPQTMQETGAEERDPESISLQQPLLKRSRTLSSTPLAMVGAKVSHIESLDYEINENDL  70

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FKHDWRSRSK  VLQY+FL
Sbjct  71   FKHDWRSRSKVQVLQYIFL  89



>ref|XP_006290621.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
 gb|EOA23519.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
Length=779

 Score =   116 bits (290),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  235  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
             + DPE+N+L++PL+K NRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK+ 
Sbjct  17   GERDPENNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQ  76

Query  415  VLQYVFL  435
            VLQYVFL
Sbjct  77   VLQYVFL  83


 Score = 34.3 bits (77),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G     G
Sbjct  107  ENIAGYKLLAVGHFLTQERYVTGLMVLAG  135



>emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera]
Length=753

 Score =   112 bits (280),  Expect(2) = 8e-28, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +1

Query  211  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            S+ E  G+ ++ D ESN L++PLLKR+RTLSS P+A++GAKVS IESLDYEINENDLFKH
Sbjct  12   SSVEGVGEGEERDLESNPLNQPLLKRSRTLSSNPLAIVGAKVSHIESLDYEINENDLFKH  71

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSRS + VLQY+FL
Sbjct  72   DWRSRSSAQVLQYIFL  87


 Score = 38.5 bits (88),  Expect(2) = 8e-28, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            F KW+LAFL+GLLTGLIATLINLA+ENIAGYKLLAV   ++  RYL GF Y 
Sbjct  86   FLKWSLAFLVGLLTGLIATLINLAVENIAGYKLLAVSGLVEKKRYLTGFIYL  137



>ref|XP_008231135.1| PREDICTED: chloride channel protein CLC-b [Prunus mume]
Length=791

 Score =   120 bits (302),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 4/75 (5%)
 Frame = +1

Query  223  MEGQADD----DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            MEG+++D    DPES SL +PLL+RNRTLSS+P+A++GAKVS IESLDYEINENDLFKHD
Sbjct  19   MEGESNDGEERDPESISLSQPLLRRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHD  78

Query  391  WRSRSKSHVLQYVFL  435
            WRSRSK  VLQY+FL
Sbjct  79   WRSRSKVQVLQYIFL  93



>ref|XP_007217037.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
 gb|EMJ18236.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
Length=791

 Score =   120 bits (302),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 4/75 (5%)
 Frame = +1

Query  223  MEGQADD----DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            MEG+++D    DPES SL +PLL+RNRTLSS+P+A++GAKVS IESLDYEINENDLFKHD
Sbjct  19   MEGESNDGEERDPESISLSQPLLRRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHD  78

Query  391  WRSRSKSHVLQYVFL  435
            WRSRSK  VLQY+FL
Sbjct  79   WRSRSKVQVLQYIFL  93



>gb|KJB76409.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   120 bits (302),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            DPESNSL +PLLKRNRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK  VLQ
Sbjct  29   DPESNSLRQPLLKRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQVLQ  88

Query  424  YVFL  435
            Y+FL
Sbjct  89   YIFL  92



>gb|KJB76407.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   120 bits (302),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            DPESNSL +PLLKRNRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK  VLQ
Sbjct  29   DPESNSLRQPLLKRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQVLQ  88

Query  424  YVFL  435
            Y+FL
Sbjct  89   YIFL  92



>gb|AAB17007.1| voltage-gated chloride channel [Arabidopsis thaliana]
Length=773

 Score =   120 bits (301),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 3/83 (4%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  366
            +++ + +    E EG+   DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEIN
Sbjct  6    NLQISNSNYNGEEEGE---DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEIN  62

Query  367  ENDLFKHDWRSRSKSHVLQYVFL  435
            ENDLFKHDWRSRSK+ V QY+FL
Sbjct  63   ENDLFKHDWRSRSKAQVFQYIFL  85



>gb|AAL24139.1| putative anion channel protein [Arabidopsis thaliana]
Length=775

 Score =   120 bits (301),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 3/83 (4%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  366
            +++ + +    E EG+   DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEIN
Sbjct  6    NLQISNSNYNGEEEGE---DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEIN  62

Query  367  ENDLFKHDWRSRSKSHVLQYVFL  435
            ENDLFKHDWRSRSK+ V QY+FL
Sbjct  63   ENDLFKHDWRSRSKAQVFQYIFL  85



>emb|CAA96057.1| CLC-a chloride channel protein [Arabidopsis thaliana]
Length=775

 Score =   120 bits (301),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 3/83 (4%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  366
            +++ + +    E EG+   DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEIN
Sbjct  6    NLQISNSNYNGEEEGE---DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEIN  62

Query  367  ENDLFKHDWRSRSKSHVLQYVFL  435
            ENDLFKHDWRSRSK+ V QY+FL
Sbjct  63   ENDLFKHDWRSRSKAQVFQYIFL  85



>ref|NP_198905.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 sp|P92941.2|CLCA_ARATH RecName: Full=Chloride channel protein CLC-a; Short=AtCLC-a; 
AltName: Full=CBS domain-containing protein CBSCLC5 [Arabidopsis 
thaliana]
 gb|AAC05742.1| anion channel protein [Arabidopsis thaliana]
 dbj|BAB11351.1| anion channel protein [Arabidopsis thaliana]
 gb|AAN13022.1| anion channel protein [Arabidopsis thaliana]
 gb|AED94612.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=775

 Score =   120 bits (301),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 3/83 (4%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  366
            +++ + +    E EG+   DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEIN
Sbjct  6    NLQISNSNYNGEEEGE---DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEIN  62

Query  367  ENDLFKHDWRSRSKSHVLQYVFL  435
            ENDLFKHDWRSRSK+ V QY+FL
Sbjct  63   ENDLFKHDWRSRSKAQVFQYIFL  85



>gb|KJB76408.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=818

 Score =   120 bits (302),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            DPESNSL +PLLKRNRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK  VLQ
Sbjct  29   DPESNSLRQPLLKRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQVLQ  88

Query  424  YVFL  435
            Y+FL
Sbjct  89   YIFL  92



>ref|XP_010425454.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   116 bits (290),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 3/76 (4%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G++N   G+AD  PESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKH
Sbjct  11   GNSN-YNGEAD--PESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKH  67

Query  388  DWRSRSKSHVLQYVFL  435
            DWR RSK+ VLQYVFL
Sbjct  68   DWRKRSKAQVLQYVFL  83


 Score = 33.5 bits (75),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY  G     G
Sbjct  107  ENIAGYKLLAVGHFLSQERYATGLMVLAG  135



>ref|XP_010502677.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   116 bits (290),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G  ++  G+AD  PESN+L++PL+K NRTLSSTP+A++G KVS IESL+YEINENDLFKH
Sbjct  10   GGNSKYNGEAD--PESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLNYEINENDLFKH  67

Query  388  DWRSRSKSHVLQYVFL  435
            DWR RSK+ VLQYVFL
Sbjct  68   DWRKRSKAQVLQYVFL  83


 Score = 33.5 bits (75),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY  G     G
Sbjct  107  ENIAGYKLLAVGHFLSQERYATGLMVLAG  135



>ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis]
 gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=783

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 1/72 (1%)
 Frame = +1

Query  223  MEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  399
            ME   ++ DPESNSL +PLLKR+RTLSS+P+A++GAKVS IESLDYEINENDLFKHDWRS
Sbjct  16   MEADEEERDPESNSLQQPLLKRSRTLSSSPLALVGAKVSHIESLDYEINENDLFKHDWRS  75

Query  400  RSKSHVLQYVFL  435
            RSK  VLQY+FL
Sbjct  76   RSKVQVLQYIFL  87


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            K+      F KW+LA L+GLLTGLIATLINLA+ENIAGYKLLAV+++I+ +RYL GF YF
Sbjct  78   KVQVLQYIFLKWSLACLVGLLTGLIATLINLAVENIAGYKLLAVVSFIEKDRYLQGFLYF  137

Query  585  VG  590
             G
Sbjct  138  TG  139



>ref|XP_010425455.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   116 bits (290),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 3/76 (4%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G++N   G+AD  PESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKH
Sbjct  11   GNSN-YNGEAD--PESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKH  67

Query  388  DWRSRSKSHVLQYVFL  435
            DWR RSK+ VLQYVFL
Sbjct  68   DWRKRSKAQVLQYVFL  83


 Score = 33.5 bits (75),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY  G     G
Sbjct  107  ENIAGYKLLAVGHFLSQERYATGLMVLAG  135



>ref|XP_010502678.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   116 bits (290),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G  ++  G+AD  PESN+L++PL+K NRTLSSTP+A++G KVS IESL+YEINENDLFKH
Sbjct  10   GGNSKYNGEAD--PESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLNYEINENDLFKH  67

Query  388  DWRSRSKSHVLQYVFL  435
            DWR RSK+ VLQYVFL
Sbjct  68   DWRKRSKAQVLQYVFL  83


 Score = 33.5 bits (75),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY  G     G
Sbjct  107  ENIAGYKLLAVGHFLSQERYATGLMVLAG  135



>ref|XP_008441347.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=789

 Score =   119 bits (298),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 3/76 (4%)
 Frame = +1

Query  214  TNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            TN ME +  +   DPESN L++PLLKR+RTLSS+P+A++GAKVS IESLDYEINENDLFK
Sbjct  14   TNSMEAEPQEEERDPESNPLNQPLLKRSRTLSSSPLAIVGAKVSLIESLDYEINENDLFK  73

Query  385  HDWRSRSKSHVLQYVF  432
            HDWRSRSK  VLQY+F
Sbjct  74   HDWRSRSKVQVLQYIF  89


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            K+      F KWTLA L+GLLTG+IATLINLAIENIAGYKLL V++YI   RYLMGFAYF
Sbjct  81   KVQVLQYIFSKWTLACLVGLLTGIIATLINLAIENIAGYKLLKVVDYIKQERYLMGFAYF  140



>ref|XP_010450591.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  211  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            S +   G+ ++ DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKH
Sbjct  10   SNSNYNGEEEEVDPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKH  69

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSRSK+ V QY+FL
Sbjct  70   DWRSRSKAQVFQYIFL  85



>ref|XP_010441254.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  211  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            S +   G+ ++ DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKH
Sbjct  10   SNSNYNGEEEEVDPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKH  69

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSRSK+ V QY+FL
Sbjct  70   DWRSRSKAQVFQYIFL  85



>ref|XP_010436030.1| PREDICTED: chloride channel protein CLC-a-like [Camelina sativa]
Length=775

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  211  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            S +   G+ ++ DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKH
Sbjct  10   SNSNYNGEEEEVDPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKH  69

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSRSK+ V QY+FL
Sbjct  70   DWRSRSKAQVFQYIFL  85



>ref|XP_009392485.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392486.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392487.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
Length=798

 Score =   113 bits (282),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +1

Query  229  GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  408
            G+ + DPESNSL +PLLKR+ TL+S+  AM+GAKVS IESLDYEINENDLFKHDWRSRS 
Sbjct  20   GEGELDPESNSLQQPLLKRSPTLTSSHYAMVGAKVSHIESLDYEINENDLFKHDWRSRSS  79

Query  409  SHVLQYVFL  435
            + VLQY+FL
Sbjct  80   TEVLQYIFL  88


 Score = 35.0 bits (79),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KWTLAFL+GLLTG+ A+LINLAIENIAG K+L +  ++ + RY+ GF Y  G
Sbjct  87   FLKWTLAFLVGLLTGVTASLINLAIENIAGIKMLYLARFVKDQRYITGFVYLAG  140



>ref|XP_008379124.1| PREDICTED: chloride channel protein CLC-b isoform X2 [Malus domestica]
Length=790

 Score =   118 bits (295),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +1

Query  187  SMEFAGAGSTNEME--GQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDY  357
            S ++A A     M+  G  + DPES +LH+PLL KRNRTLSSTP+AM+GAKVS IESLDY
Sbjct  8    SNQYAEAAVPQTMQETGAEERDPESIALHQPLLLKRNRTLSSTPLAMVGAKVSHIESLDY  67

Query  358  EINENDLFKHDWRSRSKSHVLQYVFL  435
            EINENDLF HDWRSR+K  VLQYVFL
Sbjct  68   EINENDLFMHDWRSRTKVQVLQYVFL  93



>ref|XP_008379123.1| PREDICTED: chloride channel protein CLC-b isoform X1 [Malus domestica]
Length=791

 Score =   118 bits (295),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +1

Query  187  SMEFAGAGSTNEME--GQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDY  357
            S ++A A     M+  G  + DPES +LH+PLL KRNRTLSSTP+AM+GAKVS IESLDY
Sbjct  8    SNQYAEAAVPQTMQETGAEERDPESIALHQPLLLKRNRTLSSTPLAMVGAKVSHIESLDY  67

Query  358  EINENDLFKHDWRSRSKSHVLQYVFL  435
            EINENDLF HDWRSR+K  VLQYVFL
Sbjct  68   EINENDLFMHDWRSRTKVQVLQYVFL  93



>ref|XP_008806046.1| PREDICTED: chloride channel protein CLC-a-like [Phoenix dactylifera]
Length=792

 Score =   114 bits (284),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +1

Query  220  EMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  396
            E++G+ D+ DPESNSLH+PLL R  TL++  +AM+GAKVS IESLDYEINENDLFKHDWR
Sbjct  19   EVDGEEDEQDPESNSLHQPLLGRTPTLTTNHLAMVGAKVSHIESLDYEINENDLFKHDWR  78

Query  397  SRSKSHVLQYVFL  435
            SRS   VLQYVFL
Sbjct  79   SRSSVQVLQYVFL  91


 Score = 33.5 bits (75),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 7/61 (11%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNN-------RYLMGFAYFV  587
            F KWTL FL+GLLTG+IA+LINLAIENIAG+K+L V   ++         RYL GFAYF 
Sbjct  90   FLKWTLVFLVGLLTGVIASLINLAIENIAGFKMLLVGRLVNEKSLFGWWCRYLTGFAYFT  149

Query  588  G  590
            G
Sbjct  150  G  150



>ref|XP_009129444.1| PREDICTED: chloride channel protein CLC-b-like [Brassica rapa]
Length=783

 Score =   110 bits (275),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  226  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  405
            E +   D ESN+L++PL+K NR LSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEREQGDAESNTLNQPLVKANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  406  KSHVLQYVFL  435
            K+ VLQY+FL
Sbjct  77   KTQVLQYIFL  86


 Score = 36.6 bits (83),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G   F G
Sbjct  110  ENIAGYKLLAVGHFLAQERYVTGLMMFAG  138



>emb|CDY34173.1| BnaA02g28670D [Brassica napus]
Length=780

 Score =   110 bits (275),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  226  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  405
            E +   D ESN+L++PL+K NR LSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEREQGDAESNTLNQPLVKANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  406  KSHVLQYVFL  435
            K+ VLQY+FL
Sbjct  77   KTQVLQYIFL  86


 Score = 36.6 bits (83),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G   F G
Sbjct  110  ENIAGYKLLAVGHFLAQERYVTGLMMFAG  138



>emb|CDY28488.1| BnaC02g36720D [Brassica napus]
Length=783

 Score =   110 bits (275),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  226  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  405
            E +   D ESN+L++PL+K NR LSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEREQGDAESNTLNQPLVKANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  406  KSHVLQYVFL  435
            K+ VLQY+FL
Sbjct  77   KTQVLQYIFL  86


 Score = 36.2 bits (82),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLLAV +++   RY+ G   F G
Sbjct  110  ENIAGYKLLAVGHFLAQERYVTGLMMFAG  138



>emb|CDX99630.1| BnaC04g33870D [Brassica napus]
Length=776

 Score =   117 bits (292),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G++N   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKH
Sbjct  10   GNSN-YNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKH  68

Query  388  DWRSRSKSHVLQYVF  432
            DWRSRSK+ V QY+F
Sbjct  69   DWRSRSKAQVFQYIF  83



>gb|KFK33054.1| hypothetical protein AALP_AA6G324100 [Arabis alpina]
Length=776

 Score =   117 bits (292),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G++N   G+ + DPESN L+ PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKH
Sbjct  10   GNSN-YNGEEEGDPESNILNTPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKH  68

Query  388  DWRSRSKSHVLQYVF  432
            DWRSRSK+ V QY+F
Sbjct  69   DWRSRSKTQVFQYIF  83



>gb|KJB11653.1| hypothetical protein B456_001G270200 [Gossypium raimondii]
Length=788

 Score =   117 bits (292),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/87 (67%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQAD---DDPESNS-LHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  354
            S  F+   + N M+ +A+    DPESNS L  PLLKRNRTLSS P+A++GA VS IESLD
Sbjct  5    SNHFSKPETPNTMKAEAEAEERDPESNSSLSEPLLKRNRTLSSNPLALVGATVSHIESLD  64

Query  355  YEINENDLFKHDWRSRSKSHVLQYVFL  435
            YEINENDLFKHDWRSRSK  VLQY+FL
Sbjct  65   YEINENDLFKHDWRSRSKVQVLQYIFL  91



>ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine 
max]
Length=780

 Score =   116 bits (291),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = +1

Query  187  SMEFAGAGSTNE----MEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  354
            S EF  +   N     +E + + DPESN L+ PLLKRNRTLSS P+A++G KVS IESLD
Sbjct  5    SGEFGESTKINHKMENVEREEEIDPESNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLD  64

Query  355  YEINENDLFKHDWRSRSKSHVLQYVFL  435
            YEINENDLFKHDWRSRS+  VLQY+FL
Sbjct  65   YEINENDLFKHDWRSRSRVQVLQYIFL  91


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KW LAFL+GLLTG+IATLINLA+ENIAGYKLLAVL YI   RYL GF YF
Sbjct  82   RVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLYF  141

Query  585  VG  590
             G
Sbjct  142  TG  143



>ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine 
max]
Length=790

 Score =   116 bits (291),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = +1

Query  187  SMEFAGAGSTNE----MEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  354
            S EF  +   N     +E + + DPESN L+ PLLKRNRTLSS P+A++G KVS IESLD
Sbjct  5    SGEFGESTKINHKMENVEREEEIDPESNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLD  64

Query  355  YEINENDLFKHDWRSRSKSHVLQYVFL  435
            YEINENDLFKHDWRSRS+  VLQY+FL
Sbjct  65   YEINENDLFKHDWRSRSRVQVLQYIFL  91


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KW LAFL+GLLTG+IATLINLA+ENIAGYKLLAVL YI   RYL GF YF
Sbjct  82   RVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLYF  141

Query  585  VG  590
             G
Sbjct  142  TG  143



>gb|KHN24330.1| Chloride channel protein CLC-b [Glycine soja]
Length=773

 Score =   116 bits (291),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  223  MEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSR  402
            +E + + DPESN L+ PLLKRNRTLSS P+A++G KVS IESLDYEINENDLFKHDWRSR
Sbjct  4    VEREEEIDPESNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSR  63

Query  403  SKSHVLQYVFL  435
            S+  VLQY+FL
Sbjct  64   SRVQVLQYIFL  74


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KW LAFL+GLLTG+IATLINLA+ENIAGYKLLAVL YI   RYL GF YF
Sbjct  65   RVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLYF  124

Query  585  VG  590
             G
Sbjct  125  TG  126



>ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33735.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=742

 Score =   116 bits (290),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = +1

Query  187  SMEFAGAGSTN----EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  354
            S EF  +   N    E++ + + DPE N L+ PLLKRNRTLSS P+A++G KVS IESLD
Sbjct  5    SREFGESTKINHKMEEVQREEEIDPEGNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLD  64

Query  355  YEINENDLFKHDWRSRSKSHVLQYVFL  435
            YEINENDLFKHDWRSRS+  VLQY+FL
Sbjct  65   YEINENDLFKHDWRSRSRVQVLQYIFL  91



>ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=791

 Score =   116 bits (290),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = +1

Query  187  SMEFAGAGSTN----EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  354
            S EF  +   N    E++ + + DPE N L+ PLLKRNRTLSS P+A++G KVS IESLD
Sbjct  5    SREFGESTKINHKMEEVQREEEIDPEGNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLD  64

Query  355  YEINENDLFKHDWRSRSKSHVLQYVFL  435
            YEINENDLFKHDWRSRS+  VLQY+FL
Sbjct  65   YEINENDLFKHDWRSRSRVQVLQYIFL  91



>gb|ADD09860.1| chloride channel A [Eutrema halophilum]
Length=776

 Score =   116 bits (290),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            + +   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHD
Sbjct  10   ANSNYNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHD  69

Query  391  WRSRSKSHVLQYVF  432
            WRSRSK+ V QY+F
Sbjct  70   WRSRSKAQVYQYIF  83



>ref|XP_006405416.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
 gb|ESQ46869.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
Length=776

 Score =   116 bits (290),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            + +   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHD
Sbjct  10   ANSNYNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHD  69

Query  391  WRSRSKSHVLQYVF  432
            WRSRSK+ V QY+F
Sbjct  70   WRSRSKAQVYQYIF  83



>ref|XP_008788897.1| PREDICTED: chloride channel protein CLC-b-like [Phoenix dactylifera]
Length=785

 Score =   109 bits (273),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = +1

Query  199  AGAGSTNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEND  375
            A A +  E++ + D+ DPE NSLH+PLLKR  TL++  +AM+GAKVS IESLDYEINEND
Sbjct  13   AAAEANLEVDREEDEHDPERNSLHQPLLKRTATLTTNHLAMVGAKVSHIESLDYEINEND  72

Query  376  LFKHDWRSRSKSHVLQYVFLNGHWRS  453
            +FKHDW SRS   VLQYVFL   W S
Sbjct  73   IFKHDWTSRSSVQVLQYVFLK--WMS  96


 Score = 35.4 bits (80),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW  AFL+GLLTG+IA+LINLAIENIAG K+L +   ++ +RY+ GF YF G
Sbjct  91   FLKWMSAFLVGLLTGVIASLINLAIENIAGIKMLLMARLVNESRYINGFVYFAG  144



>ref|XP_010670516.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670517.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 71/94 (76%), Gaps = 10/94 (11%)
 Frame = +1

Query  181  CMSMEFAGAGSTNEMEGQA----DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIES  348
            CMS E A   ST  ME +A    D D ESN LH+PLLKRNRTLS++ +AM+GAKVS IES
Sbjct  22   CMS-ELA---STPSMEAEAVANGDADLESNVLHQPLLKRNRTLSASHLAMVGAKVSYIES  77

Query  349  LDYEINENDLFKHDWRSRSKSHVLQYVFLNGHWR  450
            LDYEINENDLFK DWRSRSK  VLQYVFL   W+
Sbjct  78   LDYEINENDLFKQDWRSRSKVQVLQYVFLK--WK  109



>dbj|BAJ33828.1| unnamed protein product [Thellungiella halophila]
Length=363

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  229  GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  408
            G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK
Sbjct  16   GEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSK  75

Query  409  SHVLQYVF  432
            + V QY+F
Sbjct  76   AQVYQYIF  83



>ref|XP_009140242.1| PREDICTED: chloride channel protein CLC-a [Brassica rapa]
Length=776

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  232  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  411
            + + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK+
Sbjct  17   EEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKA  76

Query  412  HVLQYVF  432
             V QY+F
Sbjct  77   QVFQYIF  83



>emb|CDY15925.1| BnaA04g11860D [Brassica napus]
Length=776

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  232  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  411
            + + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK+
Sbjct  17   EEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKA  76

Query  412  HVLQYVF  432
             V QY+F
Sbjct  77   QVFQYIF  83



>ref|XP_006285462.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
 gb|EOA18360.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
Length=777

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPESN-SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            +++ + +    + E +AD  PE+N +L++PLLKR+RTLSSTP+A++GAKVS IESLDYEI
Sbjct  6    NLQISNSNYNGDQEEEAD--PENNMALNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEI  63

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
            NENDLFKHDWRSRSK+ V QY+FL
Sbjct  64   NENDLFKHDWRSRSKTQVFQYIFL  87



>ref|XP_010528167.1| PREDICTED: chloride channel protein CLC-b-like [Tarenaya hassleriana]
Length=781

 Score =   106 bits (265),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 66/76 (87%), Gaps = 3/76 (4%)
 Frame = +1

Query  217  NEMEGQADD-DPESNSLHR-PLLKRN-RTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            N+  G+ ++ DPE+N++++ PLLKR+ RTLSSTP+A++GA VS IESLDYEINENDLFKH
Sbjct  10   NKEHGEGEEADPENNAVNQQPLLKRHTRTLSSTPLALVGANVSKIESLDYEINENDLFKH  69

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSR K+ V+QY+FL
Sbjct  70   DWRSRKKTQVIQYIFL  85


 Score = 35.8 bits (81),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENI G+KLLAV ++I   RY+ G   F G
Sbjct  109  ENITGFKLLAVAHFISQKRYVAGLIIFTG  137



>gb|EYU34803.1| hypothetical protein MIMGU_mgv1a001623mg [Erythranthe guttata]
Length=783

 Score =   112 bits (280),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  199  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
            A A    + + + + DPESN+LH PLLK NRTLSS  +A++G KVS IESLDYEINENDL
Sbjct  14   AEANIQTQRQDEQEHDPESNTLHEPLLKVNRTLSSNQLAIVGGKVSHIESLDYEINENDL  73

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FK DWRSRSK  VLQY+FL
Sbjct  74   FKQDWRSRSKVQVLQYIFL  92



>ref|XP_010678325.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =   112 bits (279),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 6/88 (7%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  366
            SME   A +   + G+A+D  ESNSLH+PLLK NRTLS+  +AM+GAKVS IESLDYEIN
Sbjct  55   SME---ADAETLVNGEAED-LESNSLHQPLLKGNRTLSANHLAMVGAKVSHIESLDYEIN  110

Query  367  ENDLFKHDWRSRSKSHVLQYVFLNGHWR  450
            ENDLFK DWRSRSK  VLQYVFL   W+
Sbjct  111  ENDLFKQDWRSRSKMQVLQYVFLK--WK  136



>ref|XP_010029007.1| PREDICTED: chloride channel protein CLC-b [Eucalyptus grandis]
 gb|KCW55840.1| hypothetical protein EUGRSUZ_I01654 [Eucalyptus grandis]
Length=788

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            SNSL++PLL+R+RTLSS P+AM+GAKV+ IESLDYEINENDLFKHDWRSRSK  VLQYVF
Sbjct  31   SNSLNQPLLRRHRTLSSNPLAMVGAKVAHIESLDYEINENDLFKHDWRSRSKVQVLQYVF  90

Query  433  L  435
            L
Sbjct  91   L  91



>gb|KHN10806.1| Chloride channel protein CLC-b [Glycine soja]
Length=774

 Score =   110 bits (274),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +1

Query  220  EMEGQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  396
            E++ + + DPESN L+ PLL KR RTLSS P+A++G KVS IESLDYEINENDLFKHDWR
Sbjct  3    EVQREEEIDPESNPLNEPLLLKRTRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWR  62

Query  397  SRSKSHVLQYVFL  435
            SRS+  VLQY+FL
Sbjct  63   SRSRVQVLQYIFL  75


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KW LAFL+GLLTG+IATLINLA+ENIAGYKLLAVL YI   RYL GF YF
Sbjct  66   RVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLYF  125

Query  585  VG  590
             G
Sbjct  126  TG  127



>ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum]
Length=792

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DPES-NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            DPES NSL++PL+KRNRTLSS P+A++G KVS IESLDYEINENDLFKH WRSRS+  VL
Sbjct  26   DPESSNSLNQPLIKRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHGWRSRSRIEVL  85

Query  421  QYVFL  435
            QY+FL
Sbjct  86   QYIFL  90



>ref|XP_002868624.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44883.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/59 (80%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +1

Query  259  SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            +L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKHDWRSRSK+ V QY+FL
Sbjct  28   TLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKTQVFQYIFL  86



>dbj|BAJ96369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   102 bits (253),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            G GS+ E  G A D    +SL +PLLKR+ TL+S+ +AM+GAKVS IESLDYEI ENDLF
Sbjct  23   GVGSSPEDPGSAGDG--ISSLEKPLLKRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLF  80

Query  382  KHDWRSRSKSHVLQYVFL  435
            KHDWRSRS   VLQY+FL
Sbjct  81   KHDWRSRSNVEVLQYIFL  98


 Score = 32.0 bits (71),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW+LAFL+GLLTG+IA+LINLAIENI+G K+L ++  +   RY  GF YF G
Sbjct  97   FLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKRYWAGFFYFSG  150



>dbj|BAJ88201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   102 bits (253),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            G GS+ E  G A D    +SL +PLLKR+ TL+S+ +AM+GAKVS IESLDYEI ENDLF
Sbjct  23   GVGSSPEDPGSAGDG--ISSLEKPLLKRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLF  80

Query  382  KHDWRSRSKSHVLQYVFL  435
            KHDWRSRS   VLQY+FL
Sbjct  81   KHDWRSRSNVEVLQYIFL  98


 Score = 32.0 bits (71),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW+LAFL+GLLTG+IA+LINLAIENI+G K+L ++  +   RY  GF YF G
Sbjct  97   FLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKRYWAGFFYFSG  150



>dbj|BAJ92499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   102 bits (253),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            G GS+ E  G A D    +SL +PLLKR+ TL+S+ +AM+GAKVS IESLDYEI ENDLF
Sbjct  23   GVGSSPEDPGSAGDG--ISSLEKPLLKRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLF  80

Query  382  KHDWRSRSKSHVLQYVFL  435
            KHDWRSRS   VLQY+FL
Sbjct  81   KHDWRSRSNVEVLQYIFL  98


 Score = 32.0 bits (71),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW+LAFL+GLLTG+IA+LINLAIENI+G K+L ++  +   RY  GF YF G
Sbjct  97   FLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKRYWAGFFYFSG  150



>ref|XP_006664534.1| PREDICTED: chloride channel protein CLC-a-like [Oryza brachyantha]
Length=784

 Score = 99.0 bits (245),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 5/71 (7%)
 Frame = +1

Query  238  DDDPESN-----SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSR  402
            ++DPES      SL +PLLKR+ TL+++ +AM+GAKVS IESLDYEI ENDLFKHDWRSR
Sbjct  27   EEDPESTGGPITSLEQPLLKRSNTLTASHLAMVGAKVSRIESLDYEIIENDLFKHDWRSR  86

Query  403  SKSHVLQYVFL  435
            S   VLQY+FL
Sbjct  87   SNVEVLQYIFL  97


 Score = 33.9 bits (76),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW +AFLIGLLTG+IA+LINLAIENI+G K+L ++  + + RY  GF YF G
Sbjct  96   FLKWAMAFLIGLLTGVIASLINLAIENISGLKMLHMVQLVRDKRYWAGFLYFAG  149



>gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Erythranthe guttata]
Length=788

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 58/73 (79%), Gaps = 3/73 (4%)
 Frame = +1

Query  217  NEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  396
            +E EG+   D  SN+LH+ LLKRNRTLSS  +A +G KVS IESLDYEINENDLFK DWR
Sbjct  19   DEEEGR---DCSSNNLHQSLLKRNRTLSSNQLAFVGTKVSHIESLDYEINENDLFKQDWR  75

Query  397  SRSKSHVLQYVFL  435
            SRSK  VLQY+FL
Sbjct  76   SRSKVQVLQYIFL  88


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            K+      F KW LAFL+GLLTG+IATLINLA+ENIAGYKL AV+ YID  RYLMGF Y 
Sbjct  79   KVQVLQYIFLKWLLAFLVGLLTGVIATLINLAVENIAGYKLRAVVKYIDQERYLMGFVYM  138

Query  585  VG  590
             G
Sbjct  139  AG  140



>gb|EMT23598.1| hypothetical protein F775_52599 [Aegilops tauschii]
Length=664

 Score = 99.0 bits (245),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            G  +++E  G A D    +SL +PLLKR+ TL+S+ +AM+GAKVS IESLDYEI ENDLF
Sbjct  23   GVSNSSEDPGSAGDG--ISSLEKPLLKRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLF  80

Query  382  KHDWRSRSKSHVLQYVFL  435
            KHDWRSRS   VLQY+FL
Sbjct  81   KHDWRSRSNVEVLQYIFL  98


 Score = 32.3 bits (72),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW+LAFL+GLLTG+IA+LINLAIENI+G K+L +++ +   RY  GF YF G
Sbjct  97   FLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVHLVREKRYWAGFFYFSG  150



>ref|XP_010248967.1| PREDICTED: chloride channel protein CLC-b [Nelumbo nucifera]
Length=781

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = +1

Query  223  MEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDW  393
            M G+A+    + ESN LH+ LLKR+ TL S P+AM+GAKV+ +ESLDYEINENDLFKHDW
Sbjct  1    MGGRAEGGEREVESNYLHQTLLKRSPTLPSNPLAMVGAKVTHMESLDYEINENDLFKHDW  60

Query  394  RSRSKSHVLQYVFL  435
            RSRS+  VLQY+FL
Sbjct  61   RSRSRIQVLQYIFL  74



>ref|XP_004962544.1| PREDICTED: chloride channel protein CLC-a-like isoform X1 [Setaria 
italica]
Length=876

 Score = 96.7 bits (239),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 12/91 (13%)
 Frame = +1

Query  199  AGAGSTNEMEGQADD------DPES------NSLHRPLLKRNRTLSSTPVAMIGAKVSPI  342
            A  G   E+E + +D      DPES      +SL +PLLKR+ TL+++ +A++GAKVS I
Sbjct  15   AEPGPAPELECKNEDGVEDLEDPESTAGNGISSLEQPLLKRSPTLTASHLAIVGAKVSHI  74

Query  343  ESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            ESLDYEI ENDLFKHDWRSRS   VLQY+FL
Sbjct  75   ESLDYEIIENDLFKHDWRSRSNVEVLQYIFL  105


 Score = 32.7 bits (73),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW +AFL+GLLTG+IA+LINLAIENI G K+L ++  +   RY  GF YF G
Sbjct  104  FLKWAMAFLVGLLTGVIASLINLAIENITGLKMLHMVGLVREGRYWAGFLYFAG  157



>ref|XP_004962545.1| PREDICTED: chloride channel protein CLC-a-like isoform X2 [Setaria 
italica]
Length=794

 Score = 96.7 bits (239),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 12/91 (13%)
 Frame = +1

Query  199  AGAGSTNEMEGQADD------DPES------NSLHRPLLKRNRTLSSTPVAMIGAKVSPI  342
            A  G   E+E + +D      DPES      +SL +PLLKR+ TL+++ +A++GAKVS I
Sbjct  15   AEPGPAPELECKNEDGVEDLEDPESTAGNGISSLEQPLLKRSPTLTASHLAIVGAKVSHI  74

Query  343  ESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            ESLDYEI ENDLFKHDWRSRS   VLQY+FL
Sbjct  75   ESLDYEIIENDLFKHDWRSRSNVEVLQYIFL  105


 Score = 32.7 bits (73),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW +AFL+GLLTG+IA+LINLAIENI G K+L ++  +   RY  GF YF G
Sbjct  104  FLKWAMAFLVGLLTGVIASLINLAIENITGLKMLHMVGLVREGRYWAGFLYFAG  157



>dbj|BAJ91019.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score = 97.1 bits (240),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 61/85 (72%), Gaps = 6/85 (7%)
 Frame = +1

Query  199  AGAGSTNEMEGQAD-DDPES-----NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYE  360
            AG G   + +   D +DP S     +SL +PLLKR+ TL++  +AM+GAKVS IESLDYE
Sbjct  9    AGPGPGRKHDDGVDSEDPVSTGNGISSLQQPLLKRSNTLTANHLAMVGAKVSHIESLDYE  68

Query  361  INENDLFKHDWRSRSKSHVLQYVFL  435
            I ENDLFKHDWRSRS   VLQYVFL
Sbjct  69   IIENDLFKHDWRSRSTVEVLQYVFL  93


 Score = 32.3 bits (72),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW LAFL+GLLTG+IA+LINLAIENI+G K+L ++  +   RY  GF YF G
Sbjct  92   FLKWALAFLVGLLTGVIASLINLAIENISGIKMLHMVQLVREKRYWAGFFYFSG  145



>ref|XP_002438781.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
 gb|EER90148.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
Length=801

 Score = 95.1 bits (235),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 10/93 (11%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPES----------NSLHRPLLKRNRTLSSTPVAMIGAKVS  336
            S+E+      N+   +  +DPES          +SL +PLLKR+ TL+++ +A++GAKVS
Sbjct  20   SLEWPEPECKNDDGVKDPEDPESTGGGGDGNGISSLEQPLLKRSTTLTASHLAIVGAKVS  79

Query  337  PIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
             IESLDYEI ENDLFKHDWRSRS   VLQY+FL
Sbjct  80   HIESLDYEIIENDLFKHDWRSRSNVEVLQYIFL  112


 Score = 33.1 bits (74),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW +AFL+GLLTG+IA+LINLAIENI+G K+  ++N +   RY  GF YF G
Sbjct  111  FLKWAMAFLVGLLTGVIASLINLAIENISGLKMQHMVNLVREKRYWAGFLYFAG  164



>ref|XP_003576525.1| PREDICTED: chloride channel protein CLC-a-like [Brachypodium 
distachyon]
Length=790

 Score = 95.1 bits (235),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 49/91 (54%), Positives = 60/91 (66%), Gaps = 15/91 (16%)
 Frame = +1

Query  208  GSTNEMEGQADD-------DPESN--------SLHRPLLKRNRTLSSTPVAMIGAKVSPI  342
             S    +G+ DD       DPE+         SL +PLLKR+ TL+++ +AM+GAKVS I
Sbjct  18   ASPGAQQGKHDDGVNNDNEDPENQESGNGGIRSLEQPLLKRSNTLTASHLAMVGAKVSHI  77

Query  343  ESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            ESLDYEI ENDLFKHDWR RS   VLQY+FL
Sbjct  78   ESLDYEIIENDLFKHDWRRRSNGEVLQYIFL  108


 Score = 33.1 bits (74),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW LAFL+GLLTG+IA+LINLAIENI+G K+L ++  + + RY  GF YF G
Sbjct  107  FLKWALAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVRDKRYWAGFLYFSG  160



>ref|XP_010929772.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=795

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            S SLH+PLLKR  TL++  +AM+GAKVS IESLDYEINENDLFKHDWRSRS   VLQYVF
Sbjct  31   SISLHQPLLKRTPTLTTNHLAMVGAKVSHIESLDYEINENDLFKHDWRSRSSVQVLQYVF  90

Query  433  L  435
            L
Sbjct  91   L  91



>ref|XP_008658999.1| PREDICTED: chloride channel protein isoform X1 [Zea mays]
 gb|AFW87643.1| chloride channel protein [Zea mays]
Length=801

 Score = 90.9 bits (224),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L +PLLKR+ TL+++ +A++GAKVS IESLDYEI ENDLFKHDWRSRS   VLQY+FL
Sbjct  55   LEQPLLKRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFL  112


 Score = 36.2 bits (82),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW +AFL+GLLTG+IA+LINLAIENI+G K+L ++N +   RY  GF YF G
Sbjct  111  FLKWAMAFLVGLLTGVIASLINLAIENISGLKMLQMVNLVRGKRYWAGFLYFAG  164



>ref|NP_001183936.1| chloride channel protein [Zea mays]
 gb|ACV66338.1| chloride channel protein [Zea mays]
Length=792

 Score = 90.9 bits (224),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L +PLLKR+ TL+++ +A++GAKVS IESLDYEI ENDLFKHDWRSRS   VLQY+FL
Sbjct  55   LEQPLLKRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFL  112


 Score = 36.2 bits (82),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW +AFL+GLLTG+IA+LINLAIENI+G K+L ++N +   RY  GF YF G
Sbjct  111  FLKWAMAFLVGLLTGVIASLINLAIENISGLKMLQMVNLVRGKRYWAGFLYFAG  164



>ref|XP_006338691.1| PREDICTED: chloride channel protein CLC-a-like [Solanum tuberosum]
Length=774

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +1

Query  220  EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  399
            E+EGQ +++ E  S     L RNRTLSST VA++GAKVS IESLDYEINENDLFKHDWR 
Sbjct  17   ELEGQHNNEEERESTESNYL-RNRTLSSTSVAIVGAKVSHIESLDYEINENDLFKHDWRK  75

Query  400  RSKSHVLQYVFL  435
            RS+   LQYVF+
Sbjct  76   RSRLQTLQYVFI  87



>gb|EEE53145.1| hypothetical protein OsJ_35963 [Oryza sativa Japonica Group]
Length=716

 Score = 92.8 bits (229),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  256  NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            +SL +PLLKR+ TL+++ +AM+GAKVS IESLDYEI ENDLFKHDWR RS   VLQY+FL
Sbjct  37   SSLEQPLLKRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKHDWRRRSNVEVLQYIFL  96


 Score = 33.1 bits (74),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  429  FPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            F KW +AFL+GLLTG+IA+LINLAIENI+G K+L ++  +   RY  GF YF G
Sbjct  95   FLKWAMAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVRKKRYWAGFLYFAG  148



>ref|XP_006848424.1| hypothetical protein AMTR_s00013p00233520 [Amborella trichopoda]
 gb|ERN10005.1| hypothetical protein AMTR_s00013p00233520 [Amborella trichopoda]
Length=127

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 3/59 (5%)
 Frame = +1

Query  259  SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            +LHRPLLKR RT   + +A+IGAK+SPIESLDYEINENDLFKHDWRSRS+  VLQY+ +
Sbjct  30   NLHRPLLKRVRT---SQLALIGAKLSPIESLDYEINENDLFKHDWRSRSRVEVLQYIIM  85



>gb|EMS65031.1| Chloride channel protein CLC-b [Triticum urartu]
Length=518

 Score = 92.8 bits (229),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 5/76 (7%)
 Frame = +1

Query  226  EGQADDDPES-----NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            +G   +DP S     +SL +PLLK++ TL++  +AM+GAKVS IESLDYEI ENDLFKHD
Sbjct  15   DGVDSEDPGSAGNGISSLEQPLLKKSNTLTANHLAMVGAKVSHIESLDYEIIENDLFKHD  74

Query  391  WRSRSKSHVLQYVFLN  438
            WRSRS   VLQYVFL 
Sbjct  75   WRSRSTVEVLQYVFLK  90


 Score = 31.6 bits (70),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENI+G K+L ++  + + RY  GF YF G
Sbjct  113  ENISGVKMLHMVRLVRDKRYWAGFFYFSG  141



>gb|EEC69203.1| hypothetical protein OsI_38196 [Oryza sativa Indica Group]
Length=140

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  256  NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            +SL +PLLKR+ TL+++ +AM+GAKVS IESLDYEI ENDLFKHDWR RS   VLQY+FL
Sbjct  39   SSLEQPLLKRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKHDWRRRSNVEVLQYIFL  98



>gb|EMT27070.1| Chloride channel protein CLC-b [Aegilops tauschii]
Length=537

 Score = 91.3 bits (225),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            G     E  G A D    +SL +PLLK++ TL++  +AM+GAKVS IESLDYEI ENDLF
Sbjct  20   GVNDPEEGPGSAGDG--ISSLEQPLLKKSNTLTANHLAMVGAKVSHIESLDYEIIENDLF  77

Query  382  KHDWRSRSKSHVLQYVFLN  438
            KHDWRSRS   VLQYVFL 
Sbjct  78   KHDWRSRSTVEVLQYVFLK  96


 Score = 31.6 bits (70),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENI+G K+L ++  + + RY  GF YF G
Sbjct  119  ENISGIKMLHMVQLVRDKRYWAGFFYFSG  147



>gb|AFW87644.1| hypothetical protein ZEAMMB73_318834, partial [Zea mays]
Length=252

 Score = 87.8 bits (216),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L +PLLKR+ TL+++ +A++GAKVS IESLDYEI ENDLFKHDWRSRS   VLQY+FL
Sbjct  55   LEQPLLKRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFL  112


 Score = 34.3 bits (77),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENI+G K+L ++N +   RY  GF YF G
Sbjct  136  ENISGLKMLQMVNLVRGKRYWAGFLYFAG  164



>gb|KEH22046.1| ClC chloride channel family protein [Medicago truncatula]
Length=796

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DPESNS-LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            DPESN+ L++ L+KR+RTLSS+P+A++G KVS IESLDYE NENDLFK  WRSRS+  VL
Sbjct  33   DPESNNPLNQRLIKRSRTLSSSPLALVGEKVSYIESLDYETNENDLFKDGWRSRSRIEVL  92

Query  421  QYVFL  435
            QY+F+
Sbjct  93   QYIFM  97



>ref|XP_004231786.1| PREDICTED: chloride channel protein CLC-a-like [Solanum lycopersicum]
Length=763

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 7/78 (9%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            G  + N+ME    ++ ES  ++     RNRTLSST VA+ GAKVS IESLDYEINENDLF
Sbjct  6    GFATINDME----EERESTDIN---YSRNRTLSSTSVALEGAKVSHIESLDYEINENDLF  58

Query  382  KHDWRSRSKSHVLQYVFL  435
            KHDWR RS+   LQYVF+
Sbjct  59   KHDWRKRSRVQTLQYVFI  76


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ++      F KWTLAFL+GL TG +ATLI+L+IENI+GYKL A +NYID+ RY MGFA+F
Sbjct  67   RVQTLQYVFIKWTLAFLVGLFTGGVATLISLSIENISGYKLRATVNYIDDKRYFMGFAFF  126

Query  585  VG  590
             G
Sbjct  127  AG  128



>ref|XP_009355373.1| PREDICTED: chloride channel protein CLC-c-like [Pyrus x bretschneideri]
Length=758

 Score = 83.6 bits (205),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +1

Query  220  EMEGQADDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWR  396
            E+E +   + E   L  PLL+RNR  ++T  +A++GA  SPIESLDYEI ENDLFK DWR
Sbjct  2    ELEEEKSIEIERGGLREPLLERNRRRNTTSQLAIVGANFSPIESLDYEIIENDLFKQDWR  61

Query  397  SRSKSHVLQYVFL  435
            SR+K  + QYV L
Sbjct  62   SRTKGEIFQYVCL  74


 Score = 30.0 bits (66),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFV  587
            ENIAG+KLL   N +  ++Y   FA FV
Sbjct  98   ENIAGFKLLLTNNLMLQDKYYQAFAAFV  125



>ref|NP_001268053.1| uncharacterized protein LOC100245380 [Vitis vinifera]
 gb|ADK66979.1| chloride channel ClC1 [Vitis vinifera]
Length=771

 Score = 83.6 bits (205),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHR-PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            G   EMEG   D  + ++  R PLL R R  S++ +A++GA V PIESLDYEI EN+LFK
Sbjct  17   GDWREMEGNGSDFSDKDTAMREPLLVRKRLNSTSQIAIVGASVCPIESLDYEIVENELFK  76

Query  385  HDWRSRSKSHVLQYVFL  435
             DWRSR +  + QY+ L
Sbjct  77   QDWRSRKRVQIFQYIVL  93


 Score = 29.6 bits (65),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +  ++Y + F  F G
Sbjct  117  ENIAGFKLLLASNLMLKDKYGLAFVTFAG  145



>ref|XP_010657885.1| PREDICTED: uncharacterized protein LOC100245380 isoform X1 [Vitis 
vinifera]
Length=777

 Score = 83.6 bits (205),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHR-PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            G   EMEG   D  + ++  R PLL R R  S++ +A++GA V PIESLDYEI EN+LFK
Sbjct  17   GDWREMEGNGSDFSDKDTAMREPLLVRKRLNSTSQIAIVGASVCPIESLDYEIVENELFK  76

Query  385  HDWRSRSKSHVLQYVFL  435
             DWRSR +  + QY+ L
Sbjct  77   QDWRSRKRVQIFQYIVL  93


 Score = 29.6 bits (65),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +  ++Y + F  F G
Sbjct  117  ENIAGFKLLLASNLMLKDKYGLAFVTFAG  145



>ref|XP_010930514.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=778

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEI  363
            SME  G G   E  G   +D +   + +PLL R RT+++T  +A++GA V PIESLDYEI
Sbjct  12   SME--GLGMDVERNGSGFEDEKEAGMRQPLLLRKRTMNTTSQIAIVGANVCPIESLDYEI  69

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
             ENDLFK DWRSR K  + QY+ L
Sbjct  70   VENDLFKQDWRSRKKVQIFQYIVL  93



>ref|XP_006389435.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP48349.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 4/77 (5%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLL--KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            +TN + G+A+DD ES ++  PLL  +R+   S++ VA++GA V PIESLDYEI ENDLFK
Sbjct  2    ATNSINGEANDDHESVTI--PLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFK  59

Query  385  HDWRSRSKSHVLQYVFL  435
             DWRS  K  + QYVF+
Sbjct  60   QDWRSGGKIQIFQYVFM  76



>ref|XP_011028391.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
 ref|XP_011028392.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score = 82.0 bits (201),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  190  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  369
            ME       N++E   D +   + L  P L RNR  +++ VA++GA   PIESLDYEI E
Sbjct  1    MEDYSNREKNDLEIDYDKEHSVSMLREPFLVRNRKNNTSQVAIVGANTCPIESLDYEIVE  60

Query  370  NDLFKHDWRSRSKSHVLQYVFL  435
            N+LFK DWRSR K+ + QYV L
Sbjct  61   NELFKQDWRSRKKAEIFQYVVL  82


 Score = 27.7 bits (60),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            EN+AG+KLL   N +  + Y   FA + G
Sbjct  106  ENLAGFKLLVTNNLMLKDMYYQAFATYAG  134



>ref|XP_011016274.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score = 82.0 bits (201),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  190  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  369
            ME       N++E   D +   + L  P L RNR  +++ VA++GA   PIESLDYEI E
Sbjct  1    MEDYSNREKNDLEIDYDKEHSVSMLREPFLVRNRKNNTSQVAIVGANTCPIESLDYEIVE  60

Query  370  NDLFKHDWRSRSKSHVLQYVFL  435
            N+LFK DWRSR K+ + QYV L
Sbjct  61   NELFKQDWRSRKKAEIFQYVVL  82


 Score = 27.7 bits (60),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            EN+AG+KLL   N +  + Y   FA + G
Sbjct  106  ENLAGFKLLVTNNLMLKDMYYQAFATYAG  134



>ref|XP_011020210.1| PREDICTED: putative chloride channel-like protein CLC-g [Populus 
euphratica]
Length=806

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFK  384
            STN ++G+A+ D ES  L  PLL   R+   S++ VA++GA V PIESLDYEI EN+ FK
Sbjct  33   STNSIDGEANTDQES--LIIPLLSPRRSFINSTSQVAIVGANVCPIESLDYEIAENEFFK  90

Query  385  HDWRSRSKSHVLQYVFL  435
             DWRSR K  + QYVF+
Sbjct  91   QDWRSRGKMQIFQYVFM  107



>ref|XP_009127371.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
 emb|CDY16376.1| BnaA02g11800D [Brassica napus]
Length=775

 Score = 80.9 bits (198),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            D  S    +PLL RNR  +++ +A++GA   PIESLDYEI ENDLFK DWRSR K  +LQ
Sbjct  28   DDGSVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQ  87

Query  424  YVFL  435
            Y  L
Sbjct  88   YTIL  91


 Score = 28.5 bits (62),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   F  F G
Sbjct  115  ENIAGFKLLLTGNLMLKEKYFQAFFAFAG  143



>emb|CDX91539.1| BnaC02g16210D [Brassica napus]
Length=775

 Score = 80.9 bits (198),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            D  S    +PLL RNR  +++ +A++GA   PIESLDYEI ENDLFK DWRSR K  +LQ
Sbjct  28   DDGSVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQ  87

Query  424  YVFL  435
            Y  L
Sbjct  88   YTIL  91


 Score = 28.5 bits (62),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   F  F G
Sbjct  115  ENIAGFKLLLTGNLMLKEKYFQAFFAFAG  143



>ref|XP_004952777.1| PREDICTED: chloride channel protein CLC-c-like [Setaria italica]
Length=950

 Score = 80.5 bits (197),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPES------------NSLHRPLLKRNRTLSSTPVAMIGAK  330
            SM+ +GAG       Q +   E+             S H PLL++    +++ +A++GA 
Sbjct  163  SMDGSGAGGVPPWRPQHNGSSEALLRYDDGGAGDRGSTHEPLLRKRTMNTTSQIAIVGAN  222

Query  331  VSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            V PIESLDYE+ ENDLFK DWRSR K  + QY+ L
Sbjct  223  VCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIVL  257


 Score = 28.5 bits (62),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + + N RY+  F  + G
Sbjct  281  ENIAGFKLLLTSDLMLNERYIKAFFVYGG  309



>ref|XP_010529978.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
 ref|XP_010529986.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
 ref|XP_010529994.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
Length=779

 Score = 80.1 bits (196),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +1

Query  190  MEFAGAGS-TNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  366
            ++  GA S   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI 
Sbjct  15   IDVEGANSYERKISGILDDG--SVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIF  72

Query  367  ENDLFKHDWRSRSKSHVLQYVFL  435
            ENDLFK DWR+R K+ + QY  L
Sbjct  73   ENDLFKQDWRARKKTQIFQYTVL  95


 Score = 29.3 bits (64),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   F  F G
Sbjct  119  ENIAGFKLLITSNLMLKQKYFQAFFAFAG  147



>ref|XP_009134029.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
Length=775

 Score = 80.9 bits (198),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            D  S    +PLL RNR  +++ +A++GA   PIESLDYEI ENDLFK DWRSR K  +LQ
Sbjct  28   DDGSVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQ  87

Query  424  YVFL  435
            Y  L
Sbjct  88   YTIL  91


 Score = 28.5 bits (62),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   F  F G
Sbjct  115  ENIAGFKLLLTGNLMLKEKYFQAFFAFAG  143



>emb|CDX83179.1| BnaA03g23270D [Brassica napus]
Length=775

 Score = 80.9 bits (198),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            D  S    +PLL RNR  +++ +A++GA   PIESLDYEI ENDLFK DWRSR K  +LQ
Sbjct  28   DDGSVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQ  87

Query  424  YVFL  435
            Y  L
Sbjct  88   YTIL  91


 Score = 28.5 bits (62),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   F  F G
Sbjct  115  ENIAGFKLLLTGNLMLKEKYFQAFFAFAG  143



>emb|CDY21447.1| BnaC03g27500D [Brassica napus]
Length=775

 Score = 80.9 bits (198),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            D  S    +PLL RNR  +++ +A++GA   PIESLDYEI ENDLFK DWRSR K  +LQ
Sbjct  28   DDGSVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQ  87

Query  424  YVFL  435
            Y  L
Sbjct  88   YTIL  91


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   F  F G
Sbjct  115  ENIAGFKLLLTGNLMLKEKYFQAFFAFAG  143



>ref|XP_010442463.1| PREDICTED: chloride channel protein CLC-c [Camelina sativa]
Length=777

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +1

Query  190  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  369
            +E  G G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI E
Sbjct  13   IEVEGHGFERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANSCPIESLDYEIFE  70

Query  370  NDLFKHDWRSRSKSHVLQYVFL  435
            ND FK DWRSR K  +LQY FL
Sbjct  71   NDFFKQDWRSRKKIEILQYTFL  92



>gb|KDP42489.1| hypothetical protein JCGZ_00286 [Jatropha curcas]
Length=768

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +1

Query  190  MEFAGAGSTNEMEGQ---ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYE  360
            M+    G   E+EG     ++D E NS+  PLL RNR  +++ +A++GA V PIESLDYE
Sbjct  1    MDHTREGYDIEVEGSFAGMEEDKEFNSMREPLL-RNRKNTTSQIAIVGANVCPIESLDYE  59

Query  361  INENDLFKHDWRSRSKSHVLQYVFL  435
            I EN+L K DWRSR K  + QY+FL
Sbjct  60   IFENELIKQDWRSRKKIEIFQYIFL  84



>ref|XP_010682061.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=781

 Score = 69.3 bits (168),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +1

Query  256  NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            +   +PLL R RT  ++ +A++GA VSPIESLDYEI EN+L K DWRS     + QY+F 
Sbjct  39   DEFKQPLL-RKRTNQTSQLAIVGANVSPIESLDYEIMENELLKEDWRSMKNFEIFQYIFF  97


 Score = 39.7 bits (91),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+K L  +NY+   +Y+ GF YF G
Sbjct  121  ENIAGFKFLQTINYVRQEKYVKGFTYFAG  149



>ref|XP_009405902.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=780

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = +1

Query  208  GSTNEMEGQA----DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEND  375
            G+  EME  A    +++ ++ S+ +PLL++    +++ +A++GA V PIESLDYEI END
Sbjct  16   GARREMERNASGFYENENDAGSVRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVEND  75

Query  376  LFKHDWRSRSKSHVLQYVFL  435
            LFK DWRSR K  + QYV L
Sbjct  76   LFKQDWRSRKKVQIFQYVLL  95



>ref|XP_008786445.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=778

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEI  363
            SME  G G   E  G   +D +   + +PLL R RT+++T  +A++GA V  IESLDYEI
Sbjct  12   SME--GLGREVERNGSGFEDEKEAGMRQPLLLRKRTMNTTSQIAIVGANVCSIESLDYEI  69

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
             ENDLFK DWRSR K  + QY+ L
Sbjct  70   VENDLFKQDWRSRKKVQIFQYIVL  93



>gb|AFW58337.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58338.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58339.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
Length=795

 Score = 80.9 bits (198),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 14/86 (16%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHR--------PLLKRNRTLSSTPVAMIGAKVSPIESLDY  357
            GAG+  E       DP S +L R        PLL+R    +++ +A++GA + PIESLDY
Sbjct  31   GAGAWQE------QDPSSEALMRYDDDGPREPLLRRRTMNTTSQIAIVGANICPIESLDY  84

Query  358  EINENDLFKHDWRSRSKSHVLQYVFL  435
            EI ENDLFK DWRSR K  + QY+ L
Sbjct  85   EIVENDLFKQDWRSRKKQQIFQYIVL  110


 Score = 26.2 bits (56),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY   F  + G
Sbjct  134  ENIAGFKLLLTSDLMLKQRYFTAFLAYGG  162



>ref|XP_006385193.1| Chloride channel protein CLC-c [Populus trichocarpa]
 gb|ERP62990.1| Chloride channel protein CLC-c [Populus trichocarpa]
Length=769

 Score = 75.5 bits (184),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +1

Query  217  NEMEGQADDDPESN--SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            N  E + DDD E +   L  P L RN   +++ +A++GA   PIESLDYEI +N+LF+ D
Sbjct  11   NGFEIEDDDDKEHSVSMLREPFLVRNIKNNTSQIAIVGANTCPIESLDYEIADNELFRQD  70

Query  391  WRSRSKSHVLQYVFL  435
            WRSR K  + QYV L
Sbjct  71   WRSRKKVEIYQYVVL  85


 Score = 31.6 bits (70),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +  N+Y   FA + G
Sbjct  109  ENIAGFKLLLTNNLMLENKYYQAFATYAG  137



>ref|XP_006381102.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP58899.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 4/77 (5%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFK  384
            STN +  +A+ D ES  L  PLL   R+L  S++ VA++GA V PIESLDYEI EN+ FK
Sbjct  2    STNSINREANTDQES--LIIPLLSPRRSLINSTSQVAIVGANVCPIESLDYEIAENEFFK  59

Query  385  HDWRSRSKSHVLQYVFL  435
             DWRSR K  + QYVF+
Sbjct  60   QDWRSRGKMQIFQYVFM  76



>ref|XP_010674330.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = +1

Query  190  MEFAGAGSTNEMEGQADDDPESN--SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            +EF G     E E       E N  S+  PLL R RT +++ +A+IGA   PIESLDYEI
Sbjct  17   VEFLGELDGKEEERLWSSMSERNMSSMRMPLL-RKRTNTTSQIAVIGANSCPIESLDYEI  75

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
            NEN+LFK DWRSR K  + QYVFL
Sbjct  76   NENELFKQDWRSRKKVQIFQYVFL  99



>ref|XP_006280044.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
 gb|EOA12942.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
Length=776

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +1

Query  184  MSMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            + +E +  G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI
Sbjct  11   IEVEGSFRGFDRKISGILDDG--SVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEI  68

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
             END FK DWRSR K  +LQY FL
Sbjct  69   FENDFFKQDWRSRKKIEILQYTFL  92



>gb|KDP30234.1| hypothetical protein JCGZ_17016 [Jatropha curcas]
Length=773

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 6/77 (8%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFK  384
            STN + G AD +    SL  PLL  +R++  S++ VA++GA V PIESLDYE+ END FK
Sbjct  2    STNSINGAADQE----SLTVPLLTSSRSITNSTSQVAIVGANVCPIESLDYEVAENDFFK  57

Query  385  HDWRSRSKSHVLQYVFL  435
             DWR+R K  + QY+F+
Sbjct  58   QDWRTRGKIQIFQYLFM  74



>ref|XP_011047852.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=768

 Score = 74.7 bits (182),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 6/79 (8%)
 Frame = +1

Query  217  NEMEG---QADDDPESNS---LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
            N  EG   + +DD + +S   L  P L RN   +++ +A++GA   PIESLDYEI +N+L
Sbjct  6    NSREGNGFEIEDDEKEHSVSMLREPFLVRNIKNNTSQIAIVGANTCPIESLDYEITDNEL  65

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FK DWRSR K  + QYV L
Sbjct  66   FKQDWRSRKKVEIYQYVVL  84


 Score = 31.2 bits (69),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +  N+Y   FA + G
Sbjct  108  ENIAGFKLLLTNNLMLENKYYQAFATYAG  136



>ref|NP_199800.1| chloride channel protein CLC-c [Arabidopsis thaliana]
 sp|Q96282.1|CLCC_ARATH RecName: Full=Chloride channel protein CLC-c; Short=AtCLC-c; 
AltName: Full=CBS domain-containing protein CBSCLC4 [Arabidopsis 
thaliana]
 emb|CAA70310.1| chloride channel [Arabidopsis thaliana]
 emb|CAA96059.1| CLC-c chloride channel protein [Arabidopsis thaliana]
 dbj|BAA97010.1| chloride channel [Arabidopsis thaliana]
 gb|AAM53312.1| chloride channel [Arabidopsis thaliana]
 gb|AAN65098.1| chloride channel [Arabidopsis thaliana]
 gb|AED95868.1| chloride channel protein CLC-c [Arabidopsis thaliana]
Length=779

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI END FK 
Sbjct  21   GFERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDFFKQ  78

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSR K  +LQY FL
Sbjct  79   DWRSRKKIEILQYTFL  94



>ref|XP_008674757.1| PREDICTED: chloride channel protein CLC-c [Zea mays]
 ref|XP_008674758.1| PREDICTED: chloride channel protein CLC-c [Zea mays]
Length=794

 Score = 72.8 bits (177),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            +D  + +L RPLL +  T +++ +A++GA   PIESLDYEI END++  DWRSR K  + 
Sbjct  46   EDAAAGALQRPLLYKRGTNTTSQMAIVGANTCPIESLDYEIVENDVYNQDWRSRGKLQIF  105

Query  421  QYVFL  435
            QY  L
Sbjct  106  QYQVL  110


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +  NRYL  F  ++G
Sbjct  134  ENIAGFKLLLTGDLMLQNRYLAAFELYIG  162



>tpg|DAA56573.1| TPA: chloride channel protein [Zea mays]
Length=793

 Score = 72.8 bits (177),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            +D  + +L RPLL +  T +++ +A++GA   PIESLDYEI END++  DWRSR K  + 
Sbjct  45   EDAAAGALQRPLLYKRGTNTTSQMAIVGANTCPIESLDYEIVENDVYNQDWRSRGKLQIF  104

Query  421  QYVFL  435
            QY  L
Sbjct  105  QYQVL  109


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +  NRYL  F  ++G
Sbjct  133  ENIAGFKLLLTGDLMLQNRYLAAFELYIG  161



>gb|ADF78069.1| chloride channel protein [Zea mays]
Length=766

 Score = 72.8 bits (177),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            +D  + +L RPLL +  T +++ +A++GA   PIESLDYEI END++  DWRSR K  + 
Sbjct  46   EDAAAGALQRPLLYKRGTNTTSQMAIVGANTCPIESLDYEIVENDVYNQDWRSRGKLQIF  105

Query  421  QYVFL  435
            QY  L
Sbjct  106  QYQVL  110


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +  NRYL  F  ++G
Sbjct  134  ENIAGFKLLLTGDLMLQNRYLAAFELYIG  162



>emb|CBI29647.3| unnamed protein product [Vitis vinifera]
Length=742

 Score = 75.9 bits (185),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            +  PLL R R  S++ +A++GA V PIESLDYEI EN+LFK DWRSR +  + QY+ L
Sbjct  1    MREPLLVRKRLNSTSQIAIVGASVCPIESLDYEIVENELFKQDWRSRKRVQIFQYIVL  58


 Score = 29.6 bits (65),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +  ++Y + F  F G
Sbjct  82   ENIAGFKLLLASNLMLKDKYGLAFVTFAG  110



>ref|XP_002865761.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42020.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI END FK 
Sbjct  20   GYERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQ  77

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSR K  +LQY FL
Sbjct  78   DWRSRKKIEILQYTFL  93



>ref|XP_004499372.1| PREDICTED: chloride channel protein CLC-c-like [Cicer arietinum]
Length=779

 Score = 76.3 bits (186),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 11/92 (12%)
 Frame = +1

Query  184  MSMEFAGAGSTNEMEGQADDDP----------ESNSLHRPLL-KRNRTLSSTPVAMIGAK  330
            M ME        +M G+ +DD           E   L  PLL K NR  +++ +A++GA 
Sbjct  1    MEMEEESLRDVEQMLGKEEDDIGGMSRSISEYEGLRLRDPLLLKNNRLNTTSQIAIVGAN  60

Query  331  VSPIESLDYEINENDLFKHDWRSRSKSHVLQY  426
            V PIESLDYEI ENDLFK DWRSR++  + QY
Sbjct  61   VCPIESLDYEIIENDLFKQDWRSRARGEIRQY  92


 Score = 29.3 bits (64),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + + N++Y   FA + G
Sbjct  119  ENIAGFKLLLTNDLMLNHKYHQAFAVYAG  147



>ref|NP_001105216.1| LOC542114 [Zea mays]
 gb|AAP04392.2| chloride channel [Zea mays]
Length=786

 Score = 79.3 bits (194),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            GS+  +    D   +  S  +PLL++    +++ +A++GA V PIESLDYE+ ENDLFK 
Sbjct  18   GSSEALLRYDDGGADHGSTQQPLLRKRTVNTTSQIAIVGANVCPIESLDYEVVENDLFKQ  77

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSR K  + QY+ L
Sbjct  78   DWRSRKKKQIFQYIVL  93


 Score = 25.8 bits (55),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY+  F  + G
Sbjct  117  ENIAGFKLLLTSDLMLKGRYIRAFFVYGG  145



>ref|XP_006647383.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=804

 Score = 76.3 bits (186),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  271  PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            PLL++    +++ +A++GA V PIESLDYE+ ENDLFK DWRSR K+ + QYV L
Sbjct  57   PLLRKRTMNTTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKTQIFQYVIL  111


 Score = 28.9 bits (63),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   RYL  F  + G
Sbjct  135  ENIAGFKLLLTGNLMLKERYLTAFFVYGG  163



>ref|XP_008644266.1| PREDICTED: LOC542114 isoform X1 [Zea mays]
 gb|AFW71856.1| chloride channel [Zea mays]
Length=813

 Score = 79.3 bits (194),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            GS+  +    D   +  S  +PLL++    +++ +A++GA V PIESLDYE+ ENDLFK 
Sbjct  45   GSSEALLRYDDGGADRGSTQQPLLRKRTVNTTSQIAIVGANVCPIESLDYEVVENDLFKQ  104

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSR K  + QY+ L
Sbjct  105  DWRSRKKKQIFQYIVL  120


 Score = 25.8 bits (55),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY+  F  + G
Sbjct  144  ENIAGFKLLLTSDLMLKGRYIRAFFVYGG  172



>ref|XP_010482284.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=778

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI END FK 
Sbjct  20   GFERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQ  77

Query  388  DWRSRSKSHVLQYVFL  435
            DWRSR K  +LQY FL
Sbjct  78   DWRSRKKIEILQYTFL  93



>ref|XP_010441249.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=779

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  423
            D  S    +PLL RNR  +++ +A++GA   PIESLDYEI END FK DWRSR K  +LQ
Sbjct  31   DDGSVGFRQPLLARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQDWRSRKKIEILQ  90

Query  424  YVFL  435
            Y FL
Sbjct  91   YTFL  94



>ref|XP_002530769.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF31629.1| chloride channel clc, putative [Ricinus communis]
Length=775

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +1

Query  214  TNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKH  387
            TN + G+ + + ES +L  PLL   R+L  S++ VA++GA V PIESLDYEI END FK 
Sbjct  4    TNSINGEQEQEHESLTL--PLLTSQRSLINSTSQVAIVGANVCPIESLDYEIAENDFFKQ  61

Query  388  DWRSRSKSHVLQYVFL  435
            DWR+  K  + QYVF+
Sbjct  62   DWRTHKKIQIFQYVFM  77



>gb|ADD09861.1| chloride channel C [Eutrema halophilum]
Length=775

 Score = 76.6 bits (187),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +1

Query  220  EMEGQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  396
            ++ G  DD    + +++PLL  RNR  +++ +A++GA   PIESLDYEI ENDLFK DWR
Sbjct  22   KISGITDD---GSVVYQPLLASRNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWR  78

Query  397  SRSKSHVLQYVFL  435
            SR K  +LQY  L
Sbjct  79   SRKKIEILQYTIL  91


 Score = 27.7 bits (60),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   F  F G
Sbjct  115  ENIAGFKLLLTGNLMLKEKYFQAFFAFSG  143



>ref|XP_006402220.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
 gb|ESQ43673.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
Length=775

 Score = 76.6 bits (187),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +1

Query  220  EMEGQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  396
            ++ G  DD    + +++PLL  RNR  +++ +A++GA   PIESLDYEI ENDLFK DWR
Sbjct  22   KISGITDD---GSVVYQPLLASRNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWR  78

Query  397  SRSKSHVLQYVFL  435
            SR K  +LQY  L
Sbjct  79   SRKKIEILQYTIL  91


 Score = 27.7 bits (60),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   F  F G
Sbjct  115  ENIAGFKLLLTGNLMLKEKYFQAFFAFSG  143



>ref|XP_008378937.1| PREDICTED: chloride channel protein CLC-c-like isoform X2 [Malus 
domestica]
Length=181

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  271  PLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            PLL+RNR  ++T  +A++GA +SPIESLDYEI ENDLFK +WRSR+K+ + QYV L
Sbjct  19   PLLERNRRRNTTSQLAIVGAXLSPIESLDYEIIENDLFKQBWRSRTKAEIFQYVCL  74



>ref|XP_009393492.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393493.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
Length=780

 Score = 78.2 bits (191),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            DD E+  +  PLL+R    +++ +A++GA V PIESLDYEI ENDL+K DWRSR K+ + 
Sbjct  32   DDKEA-GMREPLLRRRTMNTTSQLAVVGANVCPIESLDYEIVENDLYKEDWRSRKKAQIF  90

Query  421  QYVFL  435
            QYV L
Sbjct  91   QYVVL  95


 Score = 25.8 bits (55),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +  + Y   F  + G
Sbjct  119  ENIAGFKLLLTSNLMLKHSYHKAFVVYAG  147



>gb|EEC71893.1| hypothetical protein OsI_04638 [Oryza sativa Indica Group]
Length=793

 Score = 71.6 bits (174),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L RPLL+R  T +++ +A++GA V PIESLDYE+ EN+++K DWRSR K  +  Y  L
Sbjct  50   LERPLLRRRGTNTTSQMAIVGANVCPIESLDYELVENEVYKQDWRSRGKLQIFHYQIL  107


 Score = 32.7 bits (73),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFV  587
            ENIAG+KLL   N +  NRY   F +F+
Sbjct  131  ENIAGFKLLLTTNLMLQNRYKAAFLWFI  158



>dbj|BAD82092.1| putative chloride channel [Oryza sativa Japonica Group]
Length=793

 Score = 71.6 bits (174),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L RPLL+R  T +++ +A++GA V PIESLDYE+ EN+++K DWRSR K  +  Y  L
Sbjct  50   LERPLLRRRGTNTTSQMAIVGANVCPIESLDYELVENEVYKQDWRSRGKLQIFHYQIL  107


 Score = 32.7 bits (73),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFV  587
            ENIAG+KLL   N +  NRY   F +F+
Sbjct  131  ENIAGFKLLLTTNLMLQNRYKAAFLWFI  158



>ref|XP_011003711.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=768

 Score = 72.8 bits (177),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 6/79 (8%)
 Frame = +1

Query  217  NEMEG---QADDDPESNS---LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  378
            N  EG   + +DD + +S   L  P L RN   +++ +A++G    PIESLDYEI +N+L
Sbjct  6    NSREGNGFEIEDDEKEHSVSMLREPFLVRNIKNNTSQIAIVGVNTCPIESLDYEITDNEL  65

Query  379  FKHDWRSRSKSHVLQYVFL  435
            FK DWRSR K  + QYV L
Sbjct  66   FKQDWRSRKKVEIYQYVVL  84


 Score = 31.6 bits (70),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +  N+Y   FA + G
Sbjct  108  ENIAGFKLLLTNNLMLENKYYQAFATYAG  136



>ref|XP_002456727.1| hypothetical protein SORBIDRAFT_03g041480 [Sorghum bicolor]
 gb|EES01847.1| hypothetical protein SORBIDRAFT_03g041480 [Sorghum bicolor]
Length=795

 Score = 70.9 bits (172),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            ST  ++ + D +  + +LHRPLL    T +++ +A++GA   PIESLDYEI EN+++  D
Sbjct  35   STRSVKWEKDIEDAAGALHRPLLYHG-TNTTSQMAIVGANTCPIESLDYEIVENEVYNQD  93

Query  391  WRSRSKSHVLQYVFL  435
            WRSR K  + QY  L
Sbjct  94   WRSRGKLQIFQYQVL  108


 Score = 33.1 bits (74),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +  NRYL  F  ++G
Sbjct  132  ENIAGFKLLLTGDLMLENRYLAAFVLYIG  160



>gb|EEE55755.1| hypothetical protein OsJ_04269 [Oryza sativa Japonica Group]
Length=863

 Score = 71.6 bits (174),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L RPLL+R  T +++ +A++GA V PIESLDYE+ EN+++K DWRSR K  +  Y  L
Sbjct  50   LERPLLRRRGTNTTSQMAIVGANVCPIESLDYELVENEVYKQDWRSRGKLQIFHYQIL  107


 Score = 32.7 bits (73),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFV  587
            ENIAG+KLL   N +  NRY   F +F+
Sbjct  131  ENIAGFKLLLTTNLMLQNRYKAAFLWFI  158



>ref|XP_007013577.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31196.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
Length=773

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  238  DDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            D + +  SL  PLL   R+L+ST  VA++GA V PIES DYEI END FK DWR+R+K  
Sbjct  8    DQNQDHESLTIPLLSHERSLNSTSQVAIVGANVCPIESFDYEIAENDFFKQDWRTRAKIQ  67

Query  415  VLQYVFL  435
            + QY+F+
Sbjct  68   IFQYIFM  74



>ref|XP_007013578.1| Voltage-gated chloride channel family protein isoform 2 [Theobroma 
cacao]
 gb|EOY31197.1| Voltage-gated chloride channel family protein isoform 2 [Theobroma 
cacao]
Length=788

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  238  DDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            D + +  SL  PLL   R+L+ST  VA++GA V PIES DYEI END FK DWR+R+K  
Sbjct  8    DQNQDHESLTIPLLSHERSLNSTSQVAIVGANVCPIESFDYEIAENDFFKQDWRTRAKIQ  67

Query  415  VLQYVFL  435
            + QY+F+
Sbjct  68   IFQYIFM  74



>ref|XP_009411882.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score = 75.1 bits (183),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +1

Query  202  GAGSTNEMEGQADD--DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEND  375
            G  +  +ME  A    D E   +  PLL+     +++ +A++GA V PIESLDYE+ END
Sbjct  15   GGVAPRDMENNASSFFDDEEMGIRDPLLRWQTGNTTSQLAVVGANVCPIESLDYEVVEND  74

Query  376  LFKHDWRSRSKSHVLQYVFL  435
            ++K DWRSR K  + QYV L
Sbjct  75   IYKEDWRSRKKEQIFQYVLL  94


 Score = 28.9 bits (63),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+K L   N +  +RY   FA F G
Sbjct  118  ENIAGFKWLLTSNLMLKHRYHEAFAVFAG  146



>ref|XP_008336976.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=778

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLF  381
            G+TN     A +DPES  +  PL+ R R    S++ VA++GA V PIESLDYEI E++ F
Sbjct  5    GNTNA-SLNAAEDPES--ITAPLISRQRYAPNSTSQVALVGANVRPIESLDYEILEBEFF  61

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRS  K+HVLQY+F+
Sbjct  62   KQDWRSCGKAHVLQYIFM  79



>ref|XP_004288642.1| PREDICTED: chloride channel protein CLC-c [Fragaria vesca subsp. 
vesca]
Length=782

 Score = 76.3 bits (186),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            ++S   PLL R  T +++ +A++G+ V PIESLDYEI ENDLFK DWRS  KS +L+YV 
Sbjct  37   THSYKEPLLTRRITNTTSQIAIVGSNVCPIESLDYEIFENDLFKQDWRSAKKSRILKYVV  96

Query  433  L  435
            L
Sbjct  97   L  97


 Score = 27.3 bits (59),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ENIAGYKLL   +++    Y   FA +
Sbjct  121  ENIAGYKLLLTSSFMAKEEYYKAFAVY  147



>ref|XP_006385076.1| Chloride channel protein CLC-c [Populus trichocarpa]
 gb|ERP62873.1| Chloride channel protein CLC-c [Populus trichocarpa]
Length=743

 Score = 75.5 bits (184),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L  P L RNR  +++ +A++GA   PIESLDYEI EN+L K DWRSR K+ + QYV L
Sbjct  2    LREPFLVRNRKNNTSQIAIVGANTCPIESLDYEIAENELLKQDWRSRKKAEIFQYVVL  59


 Score = 28.1 bits (61),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +    Y   FA + G
Sbjct  83   ENIAGFKLLVTNNLMLKEMYYQAFATYAG  111



>ref|XP_011017858.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Populus euphratica]
Length=751

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLL--KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            +T+ + G+A+DD ES ++  PLL  +R+   S++ VA++GA V PIESLDYEI ENDLFK
Sbjct  2    ATHSINGEANDDQESVTI--PLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFK  59

Query  385  HDWRSRSKSHVLQYVFL  435
             DWRS  +  + QYV +
Sbjct  60   QDWRSGGRIQIFQYVLV  76



>ref|XP_011017857.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Populus euphratica]
 ref|XP_011017859.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Populus euphratica]
Length=775

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLL--KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            +T+ + G+A+DD ES ++  PLL  +R+   S++ VA++GA V PIESLDYEI ENDLFK
Sbjct  2    ATHSINGEANDDQESVTI--PLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFK  59

Query  385  HDWRSRSKSHVLQYVFL  435
             DWRS  +  + QYV +
Sbjct  60   QDWRSGGRIQIFQYVLV  76



>ref|XP_008385147.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g, partial [Malus domestica]
Length=719

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLF  381
            GS N  E     DPES  +  PL+ R R+   S++ VA++GA V PIESLDYEI EN+ F
Sbjct  4    GSLNTAE-----DPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENEFF  56

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRSR K H  QY+F+
Sbjct  57   KQDWRSRGKVHAFQYLFM  74



>ref|XP_008365341.1| PREDICTED: chloride channel protein CLC-c-like [Malus domestica]
Length=216

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  271  PLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            PLL+RNR  ++T  +A++GA +SPIESLDYEI ENDLFK +WRSR+K+ + QYV L
Sbjct  19   PLLERNRRRNTTSQLAIVGAXLSPIESLDYEIIENDLFKQBWRSRTKAEIFQYVCL  74



>gb|EMT06377.1| Putative chloride channel-like protein CLC-g [Aegilops tauschii]
Length=816

 Score = 75.5 bits (184),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  238  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  417
            +D+ +   L RPLL R+ T + + VAM+G+K  PIESLDYEI ENDLF  +WR+R+K+  
Sbjct  14   EDEEQRPPLTRPLLHRSATNNISQVAMVGSKACPIESLDYEIIENDLFDQNWRTRAKADQ  73

Query  418  LQYVFL  435
            ++YV L
Sbjct  74   VRYVVL  79


 Score = 28.1 bits (61),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            EN+AG+K  AV + +D++ Y   F  F G
Sbjct  103  ENVAGFKHAAVSSLMDSSSYWTAFWVFAG  131



>ref|XP_008354360.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=773

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLF  381
            GS N  E     DPES  +  PL+ R R+   S++ VA++GA V PIESLDYEI EN+ F
Sbjct  4    GSLNTAE-----DPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENEFF  56

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRSR K H  QY+F+
Sbjct  57   KQDWRSRGKVHAFQYLFM  74



>gb|KHN47107.1| Putative chloride channel-like protein CLC-g [Glycine soja]
Length=765

 Score = 77.8 bits (190),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +1

Query  262  LHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L RPLL   R++  S++ VA++G+ VSPIESLDYEI EN+ FKHDWRSR K+ + Q++ +
Sbjct  15   LRRPLLSSQRSIVNSTSQVAIVGSNVSPIESLDYEIFENEFFKHDWRSRGKAQIFQFMIM  74


 Score = 25.8 bits (55),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            EN+AG K +   N +   R+LM F  F
Sbjct  98   ENLAGIKFVVTSNMMLERRFLMAFLVF  124



>ref|XP_003542650.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Glycine max]
Length=765

 Score = 77.8 bits (190),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +1

Query  262  LHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L RPLL   R++  S++ VA++G+ VSPIESLDYEI EN+ FKHDWRSR K+ + Q++ +
Sbjct  15   LRRPLLSSQRSIVNSTSQVAIVGSNVSPIESLDYEIFENEFFKHDWRSRGKAQIFQFMIM  74


 Score = 25.8 bits (55),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            EN+AG K +   N +   R+LM F  F
Sbjct  98   ENLAGIKFVVTSNMMLERRFLMAFLVF  124



>ref|XP_007225226.1| hypothetical protein PRUPE_ppa001898mg [Prunus persica]
 gb|EMJ26425.1| hypothetical protein PRUPE_ppa001898mg [Prunus persica]
Length=745

 Score = 76.6 bits (187),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L +PLL +NR   ++  A++GA + PIESLDYEI ENDLFK DWRSR++  +LQYV L
Sbjct  3    LRQPLLVKNRRNHTSQHAIVGANICPIESLDYEIIENDLFKQDWRSRTRVEILQYVSL  60


 Score = 26.6 bits (57),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ENIAG+KL    N +   +Y   FA F
Sbjct  84   ENIAGFKLFLTNNLMLQEKYYQAFAAF  110



>ref|XP_009363967.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 4/69 (6%)
 Frame = +1

Query  235  ADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  408
            A +DPES  +  PL+ R R+   S++ VA++GA V PIESLDYEI EN+ FK DWRSR K
Sbjct  13   AAEDPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENECFKQDWRSRGK  70

Query  409  SHVLQYVFL  435
             H  QY+F+
Sbjct  71   VHAFQYLFM  79



>ref|NP_001275140.1| chloride channel protein CLC-c-like [Solanum tuberosum]
 emb|CAA71369.1| chloride channel Stclc1 [Solanum tuberosum]
Length=764

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +1

Query  250  ESNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQY  426
            ES S+  PLLK ++R  +++ +A++GA V PIESLDY+I ENDLFK DWRSR K  + QY
Sbjct  18   ESGSIRVPLLKSKSRVNNTSQIAIVGANVYPIESLDYDIVENDLFKQDWRSRKKVEIFQY  77

Query  427  VFL  435
            +FL
Sbjct  78   IFL  80



>ref|XP_010050093.1| PREDICTED: putative chloride channel-like protein CLC-g [Eucalyptus 
grandis]
 gb|KCW82982.1| hypothetical protein EUGRSUZ_C04372 [Eucalyptus grandis]
Length=770

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +1

Query  223  MEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  396
            M  + + DPES  L +P L   R+   S++ VA++GA V PIESLDYEI END FK DWR
Sbjct  1    MAAEPNGDPES--LTQPFLALQRSTINSTSQVAIVGANVCPIESLDYEIAENDFFKQDWR  58

Query  397  SRSKSHVLQYVFL  435
            +R K  + QY+F+
Sbjct  59   TRGKMQIFQYIFM  71



>ref|XP_004248849.1| PREDICTED: chloride channel protein CLC-c-like [Solanum lycopersicum]
Length=778

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +1

Query  250  ESNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQY  426
            E+ S+  PLLK ++R  +++ +A++GA V PIESLDY+I ENDLFK DWRSR K  + QY
Sbjct  32   ETGSIREPLLKSKSRVNNTSQIAIVGANVYPIESLDYDIVENDLFKQDWRSRKKVEIFQY  91

Query  427  VFL  435
            +FL
Sbjct  92   IFL  94



>gb|EEE60792.1| hypothetical protein OsJ_14377 [Oryza sativa Japonica Group]
Length=773

 Score = 78.6 bits (192),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  220  EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  399
            E +G  + D       +PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRS
Sbjct  17   ERDGSFNYDEAGGGPRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRS  76

Query  400  RSKSHVLQYVFL  435
            R K  + QY+ L
Sbjct  77   RKKKQIFQYIVL  88


 Score = 24.6 bits (52),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG KLL   + +   RY   F  + G
Sbjct  112  ENIAGLKLLLTSDLMLKQRYFTAFLAYGG  140



>ref|XP_008218680.1| PREDICTED: chloride channel protein CLC-c [Prunus mume]
Length=743

 Score = 76.6 bits (187),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L +PLL +NR   ++  A++GA + PIESLDYEI ENDLFK DWRSR++  +LQYV L
Sbjct  7    LRQPLLVKNRRNHTSQHAIVGANICPIESLDYEIIENDLFKQDWRSRTRVEILQYVSL  64


 Score = 26.6 bits (57),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ENIAG+KL    N +   +Y   FA F
Sbjct  88   ENIAGFKLFLTNNLMLQEKYYRAFAAF  114



>dbj|BAD16425.1| chloride channel [Oryza sativa Japonica Group]
 gb|EEE57198.1| hypothetical protein OsJ_07147 [Oryza sativa Japonica Group]
Length=804

 Score = 74.7 bits (182),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  271  PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            PLL++    +++ +A++GA V PIESLDYE+ ENDLFK DWRSR K  + QY+ L
Sbjct  57   PLLRKRTMNTTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIVL  111


 Score = 28.1 bits (61),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   RYL  F  + G
Sbjct  135  ENIAGFKLLLTGNLMLKERYLTAFFAYGG  163



>ref|XP_006652320.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=803

 Score = 78.6 bits (192),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            G   ++E   Q DD+ +     +PLL++    +++ +A++GA V PIESLDYEI ENDLF
Sbjct  42   GRNGSSEALLQYDDEGDGGP-RQPLLRKRTINTTSQIAIVGANVCPIESLDYEIVENDLF  100

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRSR K  + QY+ L
Sbjct  101  KQDWRSRKKKQIFQYIVL  118


 Score = 24.6 bits (52),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG KLL   + +   RY   F  + G
Sbjct  142  ENIAGLKLLLTSDLMLKQRYFTAFLAYGG  170



>ref|XP_003592890.1| Chloride channel protein CLC-c [Medicago truncatula]
 gb|ABE91957.1| CBS; Cl- channel, voltage gated; Twin-arginine translocation 
pathway signal [Medicago truncatula]
 gb|AES63141.1| chloride channel ClC1 protein [Medicago truncatula]
Length=761

 Score = 73.9 bits (180),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +1

Query  223  MEGQADDDPESNSLHR-PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  399
            ME   ++  E    H+ PLL R+R  +S+ +A++GA + PI+SLDYE+ ENDL K DWRS
Sbjct  1    MESLTEERIEIRDDHKQPLLIRSRINNSSQLAIVGANICPIQSLDYELIENDLLKQDWRS  60

Query  400  RSKSHVLQYVFL  435
            R+K  + QYV L
Sbjct  61   RTKVEIYQYVVL  72


 Score = 29.3 bits (64),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   +Y   FA +VG
Sbjct  96   ENIAGFKLLLTNNLMLKQKYHEAFAVYVG  124



>dbj|BAJ92873.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=805

 Score = 76.3 bits (186),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  ESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            +  S+H PL+++    +++ +A++GA + PIESLDYE+ EN+LFK DWRSR K  + QY+
Sbjct  51   DRQSVHEPLMRKRTINTASQIAIVGANICPIESLDYEVVENNLFKQDWRSRKKKQIFQYI  110

Query  430  FL  435
             +
Sbjct  111  VM  112


 Score = 26.9 bits (58),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG KLL   + + N RY   F  + G
Sbjct  136  ENIAGLKLLITSDLMLNQRYFTAFLAYGG  164



>gb|EEC77341.1| hypothetical protein OsI_16021 [Oryza sativa Indica Group]
Length=350

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            DD       +PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + 
Sbjct  50   DDEAGGGPRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  109

Query  421  QYVFL  435
            QY+ L
Sbjct  110  QYIVL  114



>gb|EAY94258.1| hypothetical protein OsI_16029 [Oryza sativa Indica Group]
Length=803

 Score = 78.2 bits (191),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            DD       +PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + 
Sbjct  54   DDEAGGGPRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  113

Query  421  QYVFL  435
            QY+ L
Sbjct  114  QYIVL  118


 Score = 24.6 bits (52),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG KLL   + +   RY   F  + G
Sbjct  142  ENIAGLKLLLTSDLMLKQRYFTAFLAYGG  170



>gb|ADF30876.1| chloride channel protein [Citrus trifoliata]
Length=789

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  ESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            E ++L  PLL + RT +++ +A++GA +SPIESLDYEI EN+LFK DWR+R K  + QYV
Sbjct  42   EDHNLREPLLLKCRTNTTSQIAIVGANISPIESLDYEIVENELFKQDWRARRKVEIFQYV  101

Query  430  FL  435
             L
Sbjct  102  VL  103



>ref|XP_004975700.1| PREDICTED: chloride channel protein CLC-c-like isoform X3 [Setaria 
italica]
Length=844

 Score = 75.1 bits (183),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            GA + +E   + DDD        PLL++    +++ +A++GA V PIESLDYEI ENDL 
Sbjct  86   GAHTASEALLRYDDD----GPREPLLRKRTRNTTSQIAIVGANVCPIESLDYEIVENDLI  141

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRSR K  + QY+ L
Sbjct  142  KQDWRSRKKQQIFQYIVL  159


 Score = 27.3 bits (59),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY+  F  + G
Sbjct  183  ENIAGFKLLLTGDLMLKQRYITAFLAYAG  211



>dbj|BAJ97961.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=739

 Score = 76.3 bits (186),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  ESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            +  S+H PL+++    +++ +A++GA + PIESLDYE+ EN+LFK DWRSR K  + QY+
Sbjct  51   DRQSVHEPLMRKRTINTASQIAIVGANICPIESLDYEVVENNLFKQDWRSRKKKQIFQYI  110

Query  430  FL  435
             +
Sbjct  111  VM  112


 Score = 26.6 bits (57),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG KLL   + + N RY   F  + G
Sbjct  136  ENIAGLKLLITSDLMLNQRYFTAFLAYGG  164



>gb|EEC73409.1| hypothetical protein OsI_07665 [Oryza sativa Indica Group]
Length=708

 Score = 74.7 bits (182),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  271  PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            PLL++    +++ +A++GA V PIESLDYE+ ENDLFK DWRSR K  + QY+ L
Sbjct  57   PLLRKRTMNTTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIVL  111


 Score = 27.7 bits (60),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   N +   RYL  F  + G
Sbjct  135  ENIAGFKLLLTGNLMLKERYLTAFFAYGG  163



>ref|XP_004975698.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Setaria 
italica]
Length=875

 Score = 75.1 bits (183),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            GA + +E   + DDD        PLL++    +++ +A++GA V PIESLDYEI ENDL 
Sbjct  86   GAHTASEALLRYDDD----GPREPLLRKRTRNTTSQIAIVGANVCPIESLDYEIVENDLI  141

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRSR K  + QY+ L
Sbjct  142  KQDWRSRKKQQIFQYIVL  159


 Score = 27.3 bits (59),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY+  F  + G
Sbjct  183  ENIAGFKLLLTGDLMLKQRYITAFLAYAG  211



>ref|XP_004975699.1| PREDICTED: chloride channel protein CLC-c-like isoform X2 [Setaria 
italica]
Length=853

 Score = 75.1 bits (183),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            GA + +E   + DDD        PLL++    +++ +A++GA V PIESLDYEI ENDL 
Sbjct  86   GAHTASEALLRYDDD----GPREPLLRKRTRNTTSQIAIVGANVCPIESLDYEIVENDLI  141

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRSR K  + QY+ L
Sbjct  142  KQDWRSRKKQQIFQYIVL  159


 Score = 27.3 bits (59),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY+  F  + G
Sbjct  183  ENIAGFKLLLTGDLMLKQRYITAFLAYAG  211



>ref|XP_004975701.1| PREDICTED: chloride channel protein CLC-c-like isoform X4 [Setaria 
italica]
 ref|XP_004975702.1| PREDICTED: chloride channel protein CLC-c-like isoform X5 [Setaria 
italica]
Length=834

 Score = 75.1 bits (183),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = +1

Query  202  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  381
            GA + +E   + DDD        PLL++    +++ +A++GA V PIESLDYEI ENDL 
Sbjct  36   GAHTASEALLRYDDD----GPREPLLRKRTRNTTSQIAIVGANVCPIESLDYEIVENDLI  91

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRSR K  + QY+ L
Sbjct  92   KQDWRSRKKQQIFQYIVL  109


 Score = 27.3 bits (59),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY+  F  + G
Sbjct  133  ENIAGFKLLLTGDLMLKQRYITAFLAYAG  161



>ref|XP_008378936.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Malus 
domestica]
Length=204

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  271  PLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            PLL+RNR  ++T  +A++GA +SPIESLDYEI ENDLFK +WRSR+K+ + QYV L
Sbjct  19   PLLERNRRRNTTSQLAIVGAXLSPIESLDYEIIENDLFKQBWRSRTKAEIFQYVCL  74



>ref|XP_002454002.1| hypothetical protein SORBIDRAFT_04g022890 [Sorghum bicolor]
 gb|EES06978.1| hypothetical protein SORBIDRAFT_04g022890 [Sorghum bicolor]
Length=817

 Score = 77.0 bits (188),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  226  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  405
            +G AD   E+    +PLL++    +++ +A++GA V PIESLDYE+ ENDLFK DWRSR 
Sbjct  58   DGGADRGSEA---RQPLLRKRTMNTTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRK  114

Query  406  KSHVLQYVFL  435
            K  + QY+ L
Sbjct  115  KKQIFQYIVL  124


 Score = 25.4 bits (54),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY+  F  + G
Sbjct  148  ENIAGFKLLLTSDLMLKGRYIGAFFVYGG  176



>ref|XP_007152471.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
 gb|ESW24465.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
Length=807

 Score = 70.1 bits (170),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 37/83 (45%), Positives = 52/83 (63%), Gaps = 12/83 (14%)
 Frame = +1

Query  220  EMEGQADDDPE-----------SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  366
            E+EG  D + E           S +  +PLL + R  +++ +A++GA +SPIESLDYEI 
Sbjct  22   EIEGLLDGNEENGRYLSGLSDRSMAHTKPLLVK-RINTTSQIAIVGANLSPIESLDYEIF  80

Query  367  ENDLFKHDWRSRSKSHVLQYVFL  435
             N++ KHDWRSR KS  +QYV L
Sbjct  81   YNEILKHDWRSRKKSQTIQYVVL  103


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL     +  NRYL  F  + G
Sbjct  127  ENIAGFKLLMTTTLMSKNRYLEAFLAYAG  155



>ref|XP_009358559.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 5/78 (6%)
 Frame = +1

Query  208  GSTNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLF  381
            G+TN     A +DPES  +  PL+   R    S++ VA++GA V PIESLDYEI EN+ F
Sbjct  5    GNTNA-SLNAAEDPES--ITAPLISHQRYAPNSTSQVALVGANVRPIESLDYEILENEFF  61

Query  382  KHDWRSRSKSHVLQYVFL  435
            K DWRS  K+HVLQY+F+
Sbjct  62   KQDWRSCGKAHVLQYIFM  79



>ref|XP_010541946.1| PREDICTED: putative chloride channel-like protein CLC-g [Tarenaya 
hassleriana]
Length=775

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +1

Query  253  SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            S S+  PLL R+ T S++ VA++G+ VSPIESLDYEI END FK DWR+R K+ + QYVF
Sbjct  14   SYSVSVPLL-RSATNSTSQVAIVGSDVSPIESLDYEIAENDFFKQDWRARGKAQIFQYVF  72

Query  433  L  435
            +
Sbjct  73   M  73



>emb|CDO97645.1| unnamed protein product [Coffea canephora]
Length=816

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  262  LHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            L  PLLK ++R  +++ +A++GA VSPIESLDYEI EN+LFK DWRSR K  + QYVFL
Sbjct  67   LREPLLKSKSRINTTSQIAIVGANVSPIESLDYEIIENELFKQDWRSRKKVEIYQYVFL  125



>ref|XP_010274995.1| PREDICTED: chloride channel protein CLC-c [Nelumbo nucifera]
Length=773

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  184  MSMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            + +E  G  S   +E       +   +  PLLK+ RT +++ +A++GA V PIESLDYEI
Sbjct  7    IDIESDGMFSKGRLERNGSGISDDMIIREPLLKK-RTNTTSQIAIVGANVCPIESLDYEI  65

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
             ENDLFK DWRSR K  + QYV L
Sbjct  66   VENDLFKQDWRSRKKIQIFQYVVL  89



>ref|XP_004970759.1| PREDICTED: chloride channel protein CLC-c-like [Setaria italica]
Length=788

 Score = 68.9 bits (167),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  211  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  390
            ST  ++ + D    + +L RPLL +    +++ +A++GA   PIESLDYE+ EN+++  D
Sbjct  30   STRSVKWEKDVQEAAGTLDRPLLHKRCANTTSQMAVVGANTCPIESLDYEVVENEVYNQD  89

Query  391  WRSRSKSHVLQYVFL  435
            WRSR K  + QY  L
Sbjct  90   WRSRGKLQIFQYQVL  104


 Score = 32.7 bits (73),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFV  587
            ENIAG+KLL   N + +NRY+  F  ++
Sbjct  128  ENIAGFKLLLTSNLMLHNRYMAAFVVYI  155



>ref|XP_009108066.1| PREDICTED: putative chloride channel-like protein CLC-g [Brassica 
rapa]
Length=764

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = +1

Query  241  DDPESNSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            D    +S+  PLL   R+ T SS+ VA++G+ + P+ESLDYEI END FK DWR+RSK+ 
Sbjct  3    DSTREDSVAVPLLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQ  62

Query  415  VLQYVFL  435
            + QYVF+
Sbjct  63   IFQYVFM  69



>emb|CDY47559.1| BnaA08g07280D [Brassica napus]
Length=764

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = +1

Query  241  DDPESNSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            D    +S+  PLL   R+ T SS+ VA++G+ + P+ESLDYEI END FK DWR+RSK+ 
Sbjct  3    DSTREDSVAVPLLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQ  62

Query  415  VLQYVFL  435
            + QYVF+
Sbjct  63   IFQYVFM  69



>dbj|BAB97267.1| chloride channel [Oryza sativa Japonica Group]
Length=801

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            DD       +PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + 
Sbjct  50   DDEAGGGPRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  109

Query  421  QYVFL  435
            QY+ L
Sbjct  110  QYIVL  114



>ref|XP_008801913.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801914.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=778

 Score = 75.9 bits (185),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  265  HRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            HR  L+R+ + +++ VA++GA V PIESLDYE+ END FK DWRSR +SH+ +YV L
Sbjct  19   HRVDLRRSASNTTSQVAIVGAHVCPIESLDYELIENDFFKQDWRSRGRSHIFRYVTL  75


 Score = 25.4 bits (54),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG K +   N +   +Y   FA F G
Sbjct  99   ENIAGVKFVVTSNMMLARKYGWAFAVFAG  127



>gb|EMS55037.1| Chloride channel protein CLC-c [Triticum urartu]
Length=778

 Score = 70.9 bits (172),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +1

Query  235  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
             D +  +  L RPLL++  + +++ +A++G  V PIESLDYEI END++K DWRSR +  
Sbjct  45   GDLEDAAGGLERPLLRQRGSNTTSQMAVVGTNVCPIESLDYEIVENDVYKQDWRSRGRIQ  104

Query  415  VLQYVFL  435
            + QY  L
Sbjct  105  IFQYQVL  111


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLL   N +  NR L  F  ++ 
Sbjct  135  ENIAGYKLLLTSNLMRQNRNLEAFLLYMA  163



>ref|XP_008801915.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Phoenix dactylifera]
Length=773

 Score = 75.9 bits (185),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  265  HRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            HR  L+R+ + +++ VA++GA V PIESLDYE+ END FK DWRSR +SH+ +YV L
Sbjct  19   HRVDLRRSASNTTSQVAIVGAHVCPIESLDYELIENDFFKQDWRSRGRSHIFRYVTL  75


 Score = 25.4 bits (54),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG K +   N +   +Y   FA F G
Sbjct  99   ENIAGVKFVVTSNMMLARKYGWAFAVFAG  127



>ref|XP_008806106.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
 ref|XP_008806107.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=765

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  238  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  417
            +++ +   +  PLL+R    +++ +A++GA VSPIESLDYEI ENDL+K DWRSR K  +
Sbjct  16   EEEDKEMGMREPLLRRRTMNTTSQLAIVGANVSPIESLDYEIVENDLYKQDWRSRRKVQI  75

Query  418  LQYVFL  435
             QYV L
Sbjct  76   FQYVVL  81



>ref|XP_010030223.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW57159.1| hypothetical protein EUGRSUZ_I02790 [Eucalyptus grandis]
Length=778

 Score = 75.9 bits (185),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +1

Query  220  EMEGQADDDPESNSLHRPLLKR-----NRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  384
            E+EG+   +     + +PLL R     +R   ++ +A++GA + PIESLDYEI ENDLFK
Sbjct  21   EIEGK---ESSPKGMRQPLLSRKHDSGSRINRTSQIAIVGANLCPIESLDYEIVENDLFK  77

Query  385  HDWRSRSKSHVLQYVFL  435
             DWRSR+KS + QYV L
Sbjct  78   QDWRSRTKSEIYQYVVL  94


 Score = 25.4 bits (54),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 14/27 (52%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ENIAG+K L   N +   RY   F  +
Sbjct  118  ENIAGFKFLLANNLMLKERYYQAFVAY  144



>ref|XP_006395982.1| hypothetical protein EUTSA_v10003685mg [Eutrema salsugineum]
 gb|ESQ33268.1| hypothetical protein EUTSA_v10003685mg [Eutrema salsugineum]
Length=765

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  259  SLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            S+  PLL   R+ T SS+ VA++G+ V PIESLDYEI END FK DWR+RSK+ + QYVF
Sbjct  9    SVTVPLLPSLRHATNSSSQVAIVGSNVCPIESLDYEIAENDFFKQDWRARSKTQIFQYVF  68

Query  433  L  435
            +
Sbjct  69   M  69



>ref|XP_010927804.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=761

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 6/82 (7%)
 Frame = +1

Query  190  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  369
            ME  G+G   E     ++D E   +  PLL+R    +++ +A++GAKV PIESLDYEI E
Sbjct  1    MERNGSGFFYE-----EEDKEM-GMREPLLRRRTMNTTSQLAIVGAKVCPIESLDYEIVE  54

Query  370  NDLFKHDWRSRSKSHVLQYVFL  435
            NDL+K DWRSR K  + QY+ L
Sbjct  55   NDLYKQDWRSRKKVQIFQYIVL  76



>gb|EMS56861.1| Putative chloride channel-like protein CLC-g [Triticum urartu]
Length=700

 Score = 75.5 bits (184),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  238  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  417
            +D+ +   L RPLL+R+ T + + VAM+G+K  PIESLDYEI ENDLF  +WR+R+K+  
Sbjct  14   EDEEQRPPLTRPLLRRSATNNISQVAMVGSKACPIESLDYEIIENDLFDQNWRTRAKADQ  73

Query  418  LQYVFL  435
            + YV L
Sbjct  74   VWYVVL  79


 Score = 25.4 bits (54),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            EN+AG+K  AV + +D+  Y   F  F
Sbjct  103  ENVAGFKHAAVSSLMDSTSYWTAFWVF  129



>ref|NP_001267998.1| uncharacterized protein LOC100255837 [Vitis vinifera]
 gb|ADK66983.1| chloride channel ClC5 [Vitis vinifera]
Length=770

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  235  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            AD++ ++  L  P L R+ +  ++ VA++G+ V PIESLDYEI END FK DWRSR K  
Sbjct  7    ADEESQAQPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKVQ  66

Query  415  VLQYVFL  435
            + QY+F+
Sbjct  67   IFQYIFV  73



>ref|XP_010656505.1| PREDICTED: uncharacterized protein LOC100255837 isoform X1 [Vitis 
vinifera]
 emb|CBI25542.3| unnamed protein product [Vitis vinifera]
Length=772

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  235  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            AD++ ++  L  P L R+ +  ++ VA++G+ V PIESLDYEI END FK DWRSR K  
Sbjct  7    ADEESQAQPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKVQ  66

Query  415  VLQYVFL  435
            + QY+F+
Sbjct  67   IFQYIFV  73



>ref|XP_009599120.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=775

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  256  NSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            + +  PLLK ++R  +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + QY+F
Sbjct  31   SGIREPLLKSKSRVNNTSQIAIVGANVYPIESLDYEIVENDLFKQDWRSRKKVQIFQYIF  90

Query  433  L  435
            L
Sbjct  91   L  91



>gb|EMT28663.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=792

 Score = 70.9 bits (172),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +1

Query  235  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
             D +  +  L RPLL++  + +++ +A++G  V PIESLDYEI END++K DWRSR +  
Sbjct  42   GDLEDAAGGLERPLLRQRGSNTTSQMAVVGTNVCPIESLDYEIVENDVYKQDWRSRGRIQ  101

Query  415  VLQYVFL  435
            + QY  L
Sbjct  102  IFQYQVL  108


 Score = 30.0 bits (66),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYKLL   N +  NR L  F  ++ 
Sbjct  132  ENIAGYKLLLTSNLMRQNRNLEAFLLYMA  160



>ref|XP_002447895.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
 gb|EES12223.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
Length=798

 Score = 73.9 bits (180),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  268  RPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            +PLL++    +++ +A++GA V PIESLDYEI EN+LFK DWRSR K  + QY+ L
Sbjct  58   QPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENELFKQDWRSRKKKQIFQYIVL  113


 Score = 26.6 bits (57),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +  +RY   F  + G
Sbjct  137  ENIAGFKLLLTSDLMLKHRYFTAFLAYGG  165



>emb|CAN62616.1| hypothetical protein VITISV_036165 [Vitis vinifera]
Length=805

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  235  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            AD++ ++  L  P L R+ +  ++ VA++G+ V PIESLDYEI END FK DWRSR K  
Sbjct  7    ADEESQAQPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKVQ  66

Query  415  VLQYVFL  435
            + QY+F+
Sbjct  67   IFQYIFV  73



>ref|XP_006470992.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Citrus 
sinensis]
Length=789

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  ESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            E ++L  PLL + RT +++ +A++GA + PIESLDYEI EN+LFK DWR+R K  + QYV
Sbjct  42   EDHNLREPLLLKCRTNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQYV  101

Query  430  FL  435
             L
Sbjct  102  VL  103



>gb|KDO42564.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=789

 Score = 76.3 bits (186),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  250  ESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            E ++L  PLL + RT +++ +A++GA + PIESLDYEI EN+LFK DWR+R K  + QYV
Sbjct  42   EDHNLREPLLLKCRTNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQYV  101


 Score = 24.3 bits (51),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  575
            K+  F     KWTLA LIG+LTGL A   N  +ENIAG+KLL + N + N+R+ MGF
Sbjct  94   KVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGF  150



>ref|XP_006431490.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44730.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=789

 Score = 76.3 bits (186),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  250  ESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            E ++L  PLL + RT +++ +A++GA + PIESLDYEI EN+LFK DWR+R K  + QYV
Sbjct  42   EDHNLREPLLLKCRTNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQYV  101


 Score = 24.3 bits (51),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  405  KISCFAICFPKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  575
            K+  F     KWTLA LIG+LTGL A   N  +ENIAG+KLL + N + N+R+ MGF
Sbjct  94   KVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGF  150



>gb|AIY56605.1| CLC [Arachis hypogaea]
Length=788

 Score = 71.6 bits (174),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +1

Query  220  EMEGQADDDPESN-SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  396
            E+     +  E N S   PLL + RT +++ +A+IGA +SPIESLDYEI EN++F  DWR
Sbjct  31   EIRRNWSESSERNMSYAEPLLVK-RTNTTSQIAIIGANLSPIESLDYEIFENEIFNQDWR  89

Query  397  SRSKSHVLQYVFL  435
            SR K  ++QYV L
Sbjct  90   SRKKIQIIQYVIL  102


 Score = 28.9 bits (63),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL     +  +RY+  F  + G
Sbjct  126  ENIAGFKLLMTTTLMTQHRYVEAFVAYAG  154



>ref|XP_003581281.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
 ref|XP_010239959.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=795

 Score = 74.7 bits (182),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  271  PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + QY+ L
Sbjct  56   PLLRKRTMNTTSQIAIVGANVFPIESLDYEIVENDLFKQDWRSRKKKQIFQYIVL  110


 Score = 25.4 bits (54),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KLL   + +   RY   F  + G
Sbjct  134  ENIAGFKLLLTGDLMLQERYFTAFLAYGG  162



>gb|EMT13398.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=624

 Score = 73.2 bits (178),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 13/84 (15%)
 Frame = +1

Query  223  MEGQADDD----PESNSLHR---------PLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  363
            M+G A+ D      SN+L R         PL+++    +++ +A++GA + PIESLDYE+
Sbjct  73   MDGAAEGDWWQNSSSNALLRYDDRGSACEPLMRKRTINTTSQIAIVGANICPIESLDYEV  132

Query  364  NENDLFKHDWRSRSKSHVLQYVFL  435
             EN+LFK DWRSR K  + QY+ +
Sbjct  133  VENNLFKQDWRSRKKKQIFQYIVI  156


 Score = 26.6 bits (57),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            ENIAG KLL   + + N RY   F  +
Sbjct  180  ENIAGLKLLITSDLMLNQRYFTAFLVY  206



>ref|XP_009791971.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
 emb|CAA64829.1| C1C-Nt1 [Nicotiana tabacum]
Length=780

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  256  NSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            + + +PLL  ++R  +++ +A+IGA V PIESLDYEI ENDLFK DWRSR K  + QY+F
Sbjct  35   SGVRQPLLSSKSRVNNTSQIAIIGANVCPIESLDYEIIENDLFKQDWRSRKKVQIFQYIF  94

Query  433  L  435
            L
Sbjct  95   L  95



>ref|XP_009618449.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=782

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  256  NSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            + + +PLL  ++R  +++ +A+IGA V PIESLDYEI ENDLFK DWRSR K  + QY+F
Sbjct  37   SGVRQPLLSSKSRVNNTSQIAIIGANVCPIESLDYEIIENDLFKQDWRSRKKVQIFQYIF  96

Query  433  L  435
            L
Sbjct  97   L  97



>dbj|BAB97268.1| chloride channel [Oryza sativa Japonica Group]
Length=756

 Score = 76.3 bits (186),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            S S   PLL++    +++ +A++GA V PIESLDYE+ ENDLFK DWRSR K  + QY+ 
Sbjct  1    SGSAGEPLLRKRTMNTTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIV  60

Query  433  L  435
            L
Sbjct  61   L  61


 Score = 23.1 bits (48),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 17/31 (55%), Gaps = 2/31 (6%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYI--DNNRYLMGFAYFVG  590
            ENIAG+KLL   N +     RYL  F  + G
Sbjct  85   ENIAGFKLLLTGNLMLKGKCRYLTAFFAYGG  115



>ref|XP_006349289.1| PREDICTED: chloride channel protein CLC-c-like [Solanum tuberosum]
Length=776

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  253  SNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            ++    PLLK ++R  +++ +A+IGA V PIESLDY+I ENDLFK DWRSR K  + QY+
Sbjct  31   ASGFREPLLKSKSRVNNTSQIAIIGANVCPIESLDYDIVENDLFKQDWRSRKKVQIYQYI  90

Query  430  FL  435
            FL
Sbjct  91   FL  92



>ref|XP_001756485.1| predicted protein [Physcomitrella patens]
 gb|EDQ78881.1| predicted protein [Physcomitrella patens]
Length=801

 Score = 69.3 bits (168),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 15/88 (17%)
 Frame = +1

Query  208  GSTNEMEGQADDD---PESNSLHRPLLKRNRTLSSTP-----------VAMIGAKVSPIE  345
            G  +EM G  +++   P    L+ PLL++ +  ++              AMIG +V+PIE
Sbjct  2    GGNDEM-GNVEEESLPPPHLDLYEPLLEKEKVATAGNANGNVINGTHHTAMIGTRVAPIE  60

Query  346  SLDYEINENDLFKHDWRSRSKSHVLQYV  429
            SLDYE+ EN+LF+ DWRSR K  +LQYV
Sbjct  61   SLDYELVENELFRQDWRSRKKREILQYV  88


 Score = 30.0 bits (66),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG K L  + ++++NR++  F  + G
Sbjct  114  ENIAGVKFLLTVKFMESNRFVWAFLVYAG  142



>ref|XP_003575152.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=808

 Score = 75.1 bits (183),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 8/90 (9%)
 Frame = +1

Query  187  SMEFAGAGSTNEMEGQAD----DDPESN--SLHRPLLKRNRTLSSTP-VAMIGAKVSPIE  345
            SM+  G G   +    A     DD  S   S+  PLL R RTL++T  +A++GA V PIE
Sbjct  27   SMDGGGGGDWRQNGSAAALLRYDDSGSGRGSVREPLL-RKRTLNTTSQIAIVGANVCPIE  85

Query  346  SLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            SLDYE+ EN+LFK DWRSR K  + QY+ +
Sbjct  86   SLDYEVVENNLFKQDWRSRKKKQIFQYIVM  115


 Score = 24.3 bits (51),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG KLL   + +   RY   F  + G
Sbjct  139  ENIAGLKLLLTSDLMLKQRYFTAFFAYGG  167



>gb|EYU35026.1| hypothetical protein MIMGU_mgv1a001577mg [Erythranthe guttata]
Length=791

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DPESNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  420
            D E  ++  PLL  R+R  +++ +A++GAKV PIESLDYEI EN+L K DWR+R +  + 
Sbjct  43   DREGGAVREPLLNLRSRVNTTSQIAIVGAKVYPIESLDYEIFENELIKQDWRTRKRIEIF  102

Query  421  QYVFL  435
            QYVFL
Sbjct  103  QYVFL  107



>ref|XP_007204268.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
 gb|EMJ05467.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
Length=777

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            +DPES  +  PL+   R+   S++ VA++GA V PIESLDYEI EN+ FK DWRSR K  
Sbjct  14   EDPES--ITAPLISGQRSAPNSTSQVALVGANVCPIESLDYEILENEFFKQDWRSRGKMQ  71

Query  415  VLQYVFL  435
            V QY+F+
Sbjct  72   VFQYIFM  78



>ref|XP_002870407.1| hypothetical protein ARALYDRAFT_493576 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46666.1| hypothetical protein ARALYDRAFT_493576 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +1

Query  256  NSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            +S+  PLL   R  T S++ VA++GA V PIESLDYEI END FK DWR RSK  + QYV
Sbjct  8    DSVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  430  FL  435
            F+
Sbjct  68   FM  69



>ref|NP_198313.2| putative chloride channel-like protein CLC-g [Arabidopsis thaliana]
 sp|P60300.2|CLCG_ARATH RecName: Full=Putative chloride channel-like protein CLC-g; AltName: 
Full=CBS domain-containing protein CBSCLC6 [Arabidopsis 
thaliana]
 gb|AED93891.1| putative chloride channel-like protein CLC-g [Arabidopsis thaliana]
Length=765

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +1

Query  256  NSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  429
            +S+  PLL   R  T S++ VA++GA V PIESLDYEI END FK DWR RSK  + QYV
Sbjct  8    DSVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  430  FL  435
            F+
Sbjct  68   FM  69



>ref|XP_004230422.1| PREDICTED: chloride channel protein CLC-c [Solanum lycopersicum]
Length=776

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +1

Query  262  LHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
               PLLK ++R  +++ +A+IGA V PIESLDY+I ENDLFK DWRSR K  + QY+FL
Sbjct  34   FREPLLKSKSRVNNTSQIAIIGANVCPIESLDYDIVENDLFKQDWRSRKKVQIYQYIFL  92



>ref|XP_009586704.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana tomentosiformis]
Length=788

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 8/74 (11%)
 Frame = +1

Query  226  EGQADDDPESNSLHRPLL----KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDW  393
            E +AD++    SL +PLL    +R+ + +++ VA++G+ V PIESLDYEI+END FK DW
Sbjct  20   ETEADEE----SLTQPLLLNGLRRSASNTTSQVAIVGSNVCPIESLDYEISENDYFKQDW  75

Query  394  RSRSKSHVLQYVFL  435
            R R K   LQYVF+
Sbjct  76   RRREKIQTLQYVFM  89



>ref|XP_009392132.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=806

 Score = 69.3 bits (168),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +1

Query  265  HRPL-LKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            H P+ L+R+   +++ +A++G+ + PIESLDYE+ ENDLF  DWRSR ++ +L+YVFL
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFL  101


 Score = 29.3 bits (64),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYK   V + +  N+Y   F  F G
Sbjct  125  ENIAGYKFFTVSDLMLANKYWTAFWVFAG  153



>ref|XP_009768532.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
Length=775

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  256  NSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  432
            + +  PLL  ++R  +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + QY+F
Sbjct  31   SGIREPLLNSKSRVNNTSQIAIVGANVYPIESLDYEIVENDLFKQDWRSRKKVQIFQYIF  90

Query  433  L  435
            L
Sbjct  91   L  91



>ref|XP_010909770.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=737

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  262  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            +  P L+R    +++ +A++GA VSPIESLDYEI ENDL+K DWRSR K  + QYV L
Sbjct  1    MREPFLRRRTMNTASQLAVVGADVSPIESLDYEIVENDLYKQDWRSRKKVQIFQYVVL  58



>ref|XP_009392134.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=784

 Score = 69.3 bits (168),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +1

Query  265  HRPL-LKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            H P+ L+R+   +++ +A++G+ + PIESLDYE+ ENDLF  DWRSR ++ +L+YVFL
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFL  101


 Score = 28.9 bits (63),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYK   V + +  N+Y   F  F G
Sbjct  125  ENIAGYKFFTVSDLMLANKYWTAFWVFAG  153



>ref|XP_009392135.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=757

 Score = 69.3 bits (168),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +1

Query  265  HRPL-LKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  435
            H P+ L+R+   +++ +A++G+ + PIESLDYE+ ENDLF  DWRSR ++ +L+YVFL
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFL  101


 Score = 28.9 bits (63),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAGYK   V + +  N+Y   F  F G
Sbjct  125  ENIAGYKFFTVSDLMLANKYWTAFWVFAG  153



>ref|XP_008242835.1| PREDICTED: putative chloride channel-like protein CLC-g [Prunus 
mume]
Length=775

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  241  DDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  414
            +DPES  +  PL+   R+   S++ VA++GA V P+ESLDYEI EN+ FK DWRSR K  
Sbjct  14   EDPES--ITAPLISGQRSAPNSTSQVALVGANVCPVESLDYEILENEFFKQDWRSRGKMQ  71

Query  415  VLQYVFL  435
            V QY+F+
Sbjct  72   VFQYIFM  78



>ref|XP_004133730.1| PREDICTED: chloride channel protein CLC-c-like isoform 1 [Cucumis 
sativus]
 gb|KGN56276.1| hypothetical protein Csa_3G111220 [Cucumis sativus]
Length=789

 Score = 71.2 bits (173),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +1

Query  238  DDDPESNSLHRPLLKRN--RTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  411
            D D  S +   PLL+ +  R  +++ +A++G+ + PIESLDYEI EN+LFK DWRSR K 
Sbjct  38   DRDSVSLTFGEPLLRTSTARISTTSQLAIVGSNICPIESLDYEIIENELFKQDWRSRKKK  97

Query  412  HVLQYVFL  435
             + QY+ L
Sbjct  98   EIFQYIIL  105


 Score = 26.9 bits (58),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KL    N +   +Y   F  +VG
Sbjct  129  ENIAGHKLRLTNNLMLKEKYFQAFVVYVG  157



>ref|XP_008788814.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=790

 Score = 72.4 bits (176),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +1

Query  232  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  411
            QA  +P    LH   L+R+   S++ +A+IG+   PIESLDYE+ E+DLF  DWRSR ++
Sbjct  18   QALREPLLGHLHSINLRRHARNSTSQIAIIGSNPCPIESLDYEMIESDLFNQDWRSRGRA  77

Query  412  HVLQYVFL  435
             +LQY+FL
Sbjct  78   AILQYIFL  85


 Score = 26.2 bits (56),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            EN+AG K +A    +  NRY + F  F
Sbjct  109  ENLAGIKFVAFYELMLANRYWLAFGMF  135



>ref|XP_008788815.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Phoenix dactylifera]
Length=757

 Score = 72.4 bits (176),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +1

Query  232  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  411
            QA  +P    LH   L+R+   S++ +A+IG+   PIESLDYE+ E+DLF  DWRSR ++
Sbjct  18   QALREPLLGHLHSINLRRHARNSTSQIAIIGSNPCPIESLDYEMIESDLFNQDWRSRGRA  77

Query  412  HVLQYVFL  435
             +LQY+FL
Sbjct  78   AILQYIFL  85


 Score = 25.8 bits (55),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYF  584
            EN+AG K +A    +  NRY + F  F
Sbjct  109  ENLAGIKFVAFYELMLANRYWLAFGMF  135



>gb|EMT27046.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=768

 Score = 73.9 bits (180),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 51/81 (63%), Gaps = 8/81 (10%)
 Frame = +1

Query  202  GAG---STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEN  372
            GAG   S++ +    DD P       PLL++    +++ +A++GA V  IESLDYEI EN
Sbjct  45   GAGRYASSDALLRYDDDGPR-----EPLLRKRTMNTTSQIAIVGANVFAIESLDYEIVEN  99

Query  373  DLFKHDWRSRSKSHVLQYVFL  435
            DLFK DWRSR K+ + QYV L
Sbjct  100  DLFKQDWRSRKKNQIFQYVVL  120


 Score = 23.9 bits (50),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = +3

Query  504  ENIAGYKLLAVLNYIDNNRYLMGFAYFVG  590
            ENIAG+KL+   + +   RY   F  + G
Sbjct  144  ENIAGFKLVLTGDLMLQKRYFTAFLAYGG  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925