BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050H22

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACG70967.1|  translation elongation factor 1                         382   9e-132   Ziziphus jujuba [Chinese jujube]
gb|AFW87115.1|  putative translation elongation factor Tu family ...    383   1e-131   
gb|AEQ94148.1|  elongation factor 1                                     381   1e-131   Elaeis guineensis
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          389   2e-131   Sesamum indicum [beniseed]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    389   3e-131   Glycine max [soybeans]
emb|CDO98621.1|  unnamed protein product                                385   3e-131   Coffea canephora [robusta coffee]
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...    385   3e-131   
gb|AEG78681.1|  elongation factor 1 alpha                               380   4e-131   Erythroxylum coca [coca]
gb|KCW51623.1|  hypothetical protein EUGRSUZ_J01112                     384   4e-131   Eucalyptus grandis [rose gum]
gb|ADI24333.1|  elongation factor 1-alpha                               388   6e-131   Miscanthus sinensis
gb|ABU63160.1|  elongation factor                                       388   7e-131   Saccharum officinarum [noble cane]
ref|NP_001105587.1|  elongation factor 1-alpha                          388   7e-131   Zea mays [maize]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               388   7e-131   Vitis vinifera
ref|NP_001152668.1|  LOC100286309                                       388   7e-131   Zea mays [maize]
ref|XP_003604587.1|  Elongation factor 1-alpha                          388   8e-131   Medicago truncatula
emb|CDP08919.1|  unnamed protein product                                387   8e-131   Coffea canephora [robusta coffee]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    387   8e-131   Zea mays [maize]
gb|AFC88830.1|  putative elongation factor 1-alpha                      387   8e-131   Miscanthus sinensis
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    387   9e-131   
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          387   9e-131   Setaria italica
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               387   9e-131   Elaeis guineensis
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          387   9e-131   Solanum lycopersicum
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          387   1e-130   Solanum tuberosum [potatoes]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    387   1e-130   Theobroma cacao [chocolate]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    387   1e-130   Eucalyptus grandis [rose gum]
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha               385   1e-130   Nelumbo nucifera [Indian lotus]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          387   1e-130   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP07148.1|  unnamed protein product                                386   2e-130   Coffea canephora [robusta coffee]
gb|KHG28979.1|  Elongation factor 1-alpha                               387   2e-130   Gossypium arboreum [tree cotton]
gb|ABA12217.1|  translation elongation factor 1A-1                      387   2e-130   Gossypium hirsutum [American cotton]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          387   2e-130   Tarenaya hassleriana [spider flower]
gb|ABA12220.1|  translation elongation factor 1A-4                      387   2e-130   Gossypium hirsutum [American cotton]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               387   2e-130   Tarenaya hassleriana [spider flower]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          386   2e-130   Pyrus x bretschneideri [bai li]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    386   2e-130   
gb|ABF94275.1|  Elongation factor 1-alpha, putative, expressed          383   2e-130   Oryza sativa Japonica Group [Japonica rice]
gb|KHG01531.1|  Elongation factor 1-alpha                               386   2e-130   Gossypium arboreum [tree cotton]
gb|KHN42761.1|  Elongation factor 1-alpha                               386   3e-130   Glycine soja [wild soybean]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Tarenaya hassleriana [spider flower]
gb|ABA12219.1|  translation elongation factor 1A-3                      386   3e-130   Gossypium hirsutum [American cotton]
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    386   3e-130   
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Tarenaya hassleriana [spider flower]
ref|NP_001290506.1|  elongation factor 1-alpha                          386   3e-130   Elaeis guineensis
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     385   3e-130   Eucalyptus grandis [rose gum]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               386   3e-130   Phoenix dactylifera
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA12221.1|  translation elongation factor 1A-5                      386   3e-130   Gossypium hirsutum [American cotton]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               386   3e-130   Elaeis guineensis
gb|EPS66069.1|  elongation factor 1-alpha                               386   3e-130   Genlisea aurea
gb|KHG23927.1|  Elongation factor 1-alpha                               386   3e-130   Gossypium arboreum [tree cotton]
gb|ABA12225.1|  translation elongation factor 1A-9                      386   3e-130   Gossypium hirsutum [American cotton]
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Elaeis guineensis
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Phoenix dactylifera
gb|KHG26926.1|  Elongation factor 1-alpha                               386   3e-130   Gossypium arboreum [tree cotton]
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               386   3e-130   Vitis vinifera
gb|ABA12223.1|  translation elongation factor 1A-7                      386   3e-130   Gossypium hirsutum [American cotton]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    386   3e-130   Sesamum indicum [beniseed]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Phoenix dactylifera
gb|AGY80449.1|  elongation factor 1-alpha                               386   3e-130   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Eucalyptus grandis [rose gum]
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Nicotiana sylvestris
ref|XP_002528028.1|  elongation factor 1-alpha, putative                386   3e-130   
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               386   3e-130   Sesamum indicum [beniseed]
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Elaeis guineensis
dbj|BAA34348.1|  elongation factor-1 alpha                              386   3e-130   Nicotiana paniculata
gb|EPS66340.1|  elongation factor 1-alpha                               386   3e-130   Genlisea aurea
ref|XP_003604823.1|  Elongation factor 1-alpha                          386   3e-130   
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          386   3e-130   Nicotiana tomentosiformis
gb|AAX54511.1|  elongation factor 1 alpha                               386   4e-130   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          386   4e-130   Elaeis guineensis
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          386   4e-130   Nelumbo nucifera [Indian lotus]
ref|NP_001151074.1|  elongation factor 1-alpha                          386   4e-130   
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          386   4e-130   Cicer arietinum [garbanzo]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        386   4e-130   Hevea brasiliensis [jebe]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    386   4e-130   Manihot esculenta [manioc]
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          386   4e-130   Sorghum bicolor [broomcorn]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               386   4e-130   Nicotiana tomentosiformis
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               386   4e-130   Eucalyptus grandis [rose gum]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             386   4e-130   Phaseolus vulgaris [French bean]
gb|AFJ04514.1|  elongation factor 1-alpha                               385   5e-130   Vernicia fordii [tung oil tree]
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   385   5e-130   Lilium longiflorum [Easter lily]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    386   5e-130   Theobroma cacao [chocolate]
gb|AHA84124.1|  elongation factor 1-alpha                               385   5e-130   Phaseolus vulgaris [French bean]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   385   5e-130   Lilium longiflorum [Easter lily]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          385   5e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               385   5e-130   Tarenaya hassleriana [spider flower]
gb|ABA12222.1|  translation elongation factor 1A-6                      385   5e-130   Gossypium hirsutum [American cotton]
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         385   6e-130   Medicago truncatula
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          385   6e-130   Fragaria vesca subsp. vesca
gb|EEE58429.1|  hypothetical protein OsJ_09630                          385   6e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               385   7e-130   Vitis vinifera
gb|AAY56337.1|  elongation factor-1 alpha                               385   7e-130   Musa acuminata [banana]
gb|AGI15328.1|  elongation factor 1                                     385   7e-130   Aegiceras corniculatum
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               385   7e-130   Prunus mume [ume]
gb|AEK98799.1|  translation elongation factor 1 alfa                    378   8e-130   Carthamus tinctorius
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               385   8e-130   Pyrus x bretschneideri [bai li]
gb|AFW90638.1|  elongation factor 1-alpha-like protein                  380   8e-130   Solanum tuberosum [potatoes]
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             385   8e-130   Prunus persica
gb|KHG15275.1|  Elongation factor 1-alpha                               384   8e-130   Gossypium arboreum [tree cotton]
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    385   9e-130   Populus euphratica
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             385   9e-130   Phaseolus vulgaris [French bean]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               385   9e-130   Nicotiana tomentosiformis
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                385   9e-130   Erythranthe guttata [common monkey flower]
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          385   1e-129   Elaeis guineensis
gb|AFO67216.1|  putative elongation factor 1-alpha                      379   1e-129   Aralia elata
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          385   1e-129   Cucumis sativus [cucumbers]
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             385   1e-129   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             385   1e-129   Populus trichocarpa [western balsam poplar]
gb|ABA12218.1|  translation elongation factor 1A-2                      385   1e-129   Gossypium hirsutum [American cotton]
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    385   1e-129   Eucalyptus grandis [rose gum]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               385   1e-129   Cucumis melo [Oriental melon]
gb|AGH32502.1|  translation elongation factor-1 alpha                   385   1e-129   Stylosanthes guianensis [stylo]
ref|NP_001049145.1|  Os03g0177400                                       385   1e-129   
gb|KJB09231.1|  hypothetical protein B456_001G130700                    385   1e-129   Gossypium raimondii
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          385   1e-129   Phoenix dactylifera
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          385   1e-129   
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               385   1e-129   Tarenaya hassleriana [spider flower]
gb|AAC15413.1|  translation elongation factor-1 alpha                   385   1e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          385   1e-129   Oryza brachyantha
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     385   1e-129   Glycine max [soybeans]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     385   1e-129   Glycine max [soybeans]
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               385   1e-129   Cucumis melo [Oriental melon]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          384   1e-129   Pyrus x bretschneideri [bai li]
dbj|BAA23658.1|  EF-1 alpha                                             384   1e-129   Oryza sativa [red rice]
ref|NP_001105565.1|  elongation factor alpha5                           384   1e-129   
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             384   1e-129   Citrus clementina [clementine]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    384   1e-129   Gossypium raimondii
gb|KHN14872.1|  Elongation factor 1-alpha                               384   1e-129   Glycine soja [wild soybean]
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         384   2e-129   Medicago truncatula
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         384   2e-129   Medicago truncatula
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             384   2e-129   Citrus clementina [clementine]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFP44110.1|  elongation factor 1-alpha                               384   2e-129   Lycoris longituba
ref|NP_001077483.1|  elongation factor 1-alpha 2                        382   2e-129   Arabidopsis thaliana [mouse-ear cress]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  384   2e-129   Citrus sinensis [apfelsine]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     384   2e-129   Zea mays [maize]
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   Cicer arietinum [garbanzo]
gb|KHG27341.1|  Elongation factor 1-alpha                               384   2e-129   Gossypium arboreum [tree cotton]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   384   2e-129   Lilium longiflorum [Easter lily]
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   Malus domestica [apple tree]
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   Nicotiana sylvestris
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               384   2e-129   Nicotiana sylvestris
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   
gb|AFW77593.1|  putative translation elongation factor Tu family ...    384   2e-129   
gb|AEQ75495.1|  elongation factor 1-alpha                               384   2e-129   Rosa multiflora [Japanese rose]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               384   2e-129   Malus domestica [apple tree]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    384   2e-129   Zea mays [maize]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             384   2e-129   Prunus persica
ref|XP_008349743.1|  PREDICTED: elongation factor 1-alpha isoform X2    382   2e-129   
gb|KHG20498.1|  Elongation factor 1-alpha                               384   2e-129   Gossypium arboreum [tree cotton]
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         384   2e-129   Jatropha curcas
ref|NP_001105617.1|  elongation factor alpha3                           384   2e-129   Zea mays [maize]
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   Cucumis sativus [cucumbers]
gb|ACR38047.1|  unknown                                                 384   2e-129   Zea mays [maize]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    384   2e-129   Setaria italica
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             384   2e-129   Citrus clementina [clementine]
gb|ACI96243.1|  elongation factor 1-alpha                               384   2e-129   Prunus persica
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             384   2e-129   Prunus persica
gb|ABB16977.1|  elongation factor 1-alpha-like protein                  379   2e-129   Solanum tuberosum [potatoes]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               384   2e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   Zea mays [maize]
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          384   2e-129   Eucalyptus grandis [rose gum]
gb|AGT16893.1|  elongation factor 1-alpha                               384   2e-129   Saccharum hybrid cultivar R570
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               384   2e-129   Prunus mume [ume]
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    384   2e-129   Theobroma cacao [chocolate]
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          384   2e-129   Amborella trichopoda
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               384   2e-129   Fragaria vesca subsp. vesca
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    384   2e-129   Populus euphratica
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    384   2e-129   
dbj|BAO57272.1|  elongation factor 1-alpha                              384   2e-129   Ipomoea nil [qian niu]
gb|ACG31866.1|  elongation factor 1-alpha                               384   2e-129   Zea mays [maize]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    384   2e-129   Nicotiana tabacum [American tobacco]
gb|AHZ58493.1|  translation elongation factor alpha                     384   3e-129   Syntrichia caninervis
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               384   3e-129   Brachypodium distachyon [annual false brome]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         384   3e-129   Jatropha curcas
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          384   3e-129   Amborella trichopoda
ref|NP_001280807.1|  elongation factor 1-alpha-like                     384   3e-129   Malus domestica [apple tree]
gb|AIZ74328.1|  translation elongation factor 1-alpha                   384   3e-129   Pinus massoniana [Chinese red pine]
gb|ABR17675.1|  unknown                                                 384   3e-129   Picea sitchensis
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    384   3e-129   Populus euphratica
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          384   3e-129   Tarenaya hassleriana [spider flower]
gb|ABA12224.1|  translation elongation factor 1A-8                      384   3e-129   Gossypium hirsutum [American cotton]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               384   3e-129   Fragaria vesca subsp. vesca
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          384   4e-129   Populus euphratica
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          383   4e-129   Eucalyptus grandis [rose gum]
gb|ACN40740.1|  unknown                                                 384   4e-129   Picea sitchensis
dbj|BAH19898.1|  AT1G07930                                              384   4e-129   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32631.1|  putative elongation factor 1-a                          384   4e-129   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    383   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200847.1|  elongation factor 1-alpha 4                           383   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             383   4e-129   Capsella rubella
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             383   4e-129   Prunus persica
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        383   4e-129   Brassica rapa
gb|ACS68200.1|  elongation factor 1 alpha                               383   4e-129   Brassica napus [oilseed rape]
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        383   4e-129   Brassica rapa
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             383   4e-129   Brassica rapa
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             383   5e-129   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        383   5e-129   Brassica rapa
gb|ABB86283.1|  elongation factor-1 alpha-like                          383   5e-129   Solanum tuberosum [potatoes]
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  383   5e-129   Solanum tuberosum [potatoes]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          383   5e-129   Prunus mume [ume]
ref|NP_001032107.1|  elongation factor 1-alpha 4                        381   5e-129   
dbj|BAC23049.1|  Elongation factor 1-alpha                              383   5e-129   Solanum tuberosum [potatoes]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             383   5e-129   Solanum tuberosum [potatoes]
ref|NP_001234035.1|  elongation factor 1-alpha                          383   5e-129   Solanum lycopersicum
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             383   6e-129   Phaseolus vulgaris [French bean]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   383   6e-129   Ornithogalum longebracteatum [sea-onion]
ref|NP_001105935.1|  elongation factor alpha8                           383   6e-129   
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    383   6e-129   Glycine max [soybeans]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                383   6e-129   Ricinus communis
gb|KHN18669.1|  Elongation factor 1-alpha                               383   6e-129   Glycine soja [wild soybean]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         383   6e-129   
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          383   6e-129   Populus euphratica
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    383   6e-129   Daucus carota [carrots]
ref|XP_010456376.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    381   6e-129   
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          383   6e-129   Solanum tuberosum [potatoes]
ref|NP_001237425.1|  elongation factor-1A                               383   7e-129   
gb|AGV54713.1|  elongation factor 1-alpha                               383   7e-129   Phaseolus vulgaris [French bean]
ref|NP_001288465.1|  elongation factor 1-alpha-like                     382   8e-129   Zea mays [maize]
dbj|BAM13874.1|  elongation factor 1 alpha                              382   8e-129   Symplocarpus renifolius
ref|NP_001105933.1|  elongation factor alpha2                           382   8e-129   
gb|EMS52529.1|  Elongation factor 1-alpha                               382   9e-129   Triticum urartu
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             382   1e-128   Populus trichocarpa [western balsam poplar]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          382   1e-128   Malus domestica [apple tree]
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 382   1e-128   Larix kaempferi [karamatsu]
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    382   1e-128   Triticum aestivum [Canadian hard winter wheat]
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        382   1e-128   Hevea brasiliensis [jebe]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             382   1e-128   Arabidopsis thaliana [mouse-ear cress]
gb|AGI78242.1|  elongation factor 1 alpha                               382   1e-128   Caragana korshinskii
emb|CDX95108.1|  BnaC05g05630D                                          384   1e-128   
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    382   1e-128   
dbj|BAM13877.1|  elongation factor 1 alpha                              382   1e-128   Arum maculatum [cuckoo-pint]
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     382   1e-128   Saccharum hybrid cultivar CP65-357
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          382   1e-128   
ref|XP_002311107.1|  ADR12-2 family protein                             382   1e-128   Populus trichocarpa [western balsam poplar]
emb|CAA34456.1|  elongation factor 1-alpha                              382   1e-128   Arabidopsis thaliana [mouse-ear cress]
gb|AEN79476.1|  elongation factor 1-alpha                               382   1e-128   Ziziphus jujuba [Chinese jujube]
ref|XP_002312029.1|  ADR12-2 family protein                             382   2e-128   Populus trichocarpa [western balsam poplar]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        382   2e-128   Brassica rapa
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    382   2e-128   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        382   2e-128   Bruguiera sexangula
ref|XP_002311106.1|  ADR12-2 family protein                             382   2e-128   Populus trichocarpa [western balsam poplar]
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    382   2e-128   Vicia faba [broad bean]
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          382   2e-128   Beta vulgaris subsp. vulgaris [field beet]
gb|AHB86963.1|  elongation factor 1-alpha                               382   2e-128   Sedum alfredii
dbj|BAC66180.1|  elongation factor 1A                                   381   2e-128   Avicennia marina
gb|AAN77897.1|  elongation factor 1 alpha                               381   2e-128   Stevia rebaudiana
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             381   2e-128   Selaginella moellendorffii
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    385   3e-128   
ref|NP_001105934.1|  elongation factor alpha7                           381   3e-128   
ref|XP_001766482.1|  predicted protein                                  381   3e-128   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        381   4e-128   Suaeda japonica
gb|AGC94754.1|  elongation factor 1 alpha                               380   4e-128   Euphorbia lathyris
ref|XP_001763201.1|  predicted protein                                  380   5e-128   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                380   5e-128   Erythranthe guttata [common monkey flower]
gb|EMS49772.1|  Elongation factor 1-alpha                               380   5e-128   Triticum urartu
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             380   5e-128   Eutrema salsugineum [saltwater cress]
dbj|BAF02151.1|  elongation factor 1-alpha                              380   6e-128   Arabidopsis thaliana [mouse-ear cress]
gb|ACN41180.1|  unknown                                                 380   6e-128   Picea sitchensis
gb|ABK24265.1|  unknown                                                 380   6e-128   Picea sitchensis
gb|ABK25072.1|  unknown                                                 380   6e-128   Picea sitchensis
gb|AID52924.1|  elongation factor 1-alpha                               380   6e-128   Carthamus tinctorius
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          380   6e-128   Amborella trichopoda
gb|ABD66517.1|  EF-1 alpha                                              380   6e-128   Gymnadenia conopsea
gb|EYU18869.1|  hypothetical protein MIMGU_mgv1a010191mg                375   6e-128   Erythranthe guttata [common monkey flower]
gb|ABK24843.1|  unknown                                                 380   7e-128   Picea sitchensis
gb|ABV26710.1|  elongation factor 1 alpha                               380   8e-128   Gerbera hybrid cultivar
gb|AAL57653.1|  At1g07930/T6D22_3                                       380   8e-128   Arabidopsis thaliana [mouse-ear cress]
gb|ACG34498.1|  elongation factor 1-alpha                               380   8e-128   Zea mays [maize]
gb|EMS59091.1|  Elongation factor 1-alpha                               382   8e-128   Triticum urartu
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          380   9e-128   Oryza sativa Japonica Group [Japonica rice]
gb|AHE76183.1|  elongation factor 1-alpha                               380   1e-127   Chrysanthemum indicum
gb|AIX10769.1|  elongation factor 1 alpha                               380   1e-127   Panax notoginseng [san-qi]
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             379   1e-127   Selaginella moellendorffii
gb|AGJ50595.1|  EF1alpha                                                379   1e-127   Pericallis cruenta
gb|AER42621.1|  elongation factor 1 alpha                               379   2e-127   Hordeum brevisubulatum
gb|AAL69396.1|  elongation factor 1-alpha                               379   2e-127   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             379   2e-127   
gb|AAR82894.1|  elongation factor 1-alpha                               379   2e-127   
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    379   2e-127   
ref|XP_001753059.1|  predicted protein                                  379   2e-127   
ref|NP_001104939.1|  elongation factor alpha6                           379   2e-127   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 379   2e-127   
gb|ADD71925.1|  translation elongation factor 1 alpha                   377   2e-127   
ref|XP_001753167.1|  predicted protein                                  379   2e-127   
ref|XP_001753181.1|  predicted protein                                  379   2e-127   
gb|EMT12343.1|  Elongation factor 1-alpha                               379   3e-127   
gb|AGV54654.1|  elongation factor 1-alpha                               379   3e-127   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               379   3e-127   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          379   3e-127   
gb|AAF99703.1|  elongation factor                                       378   4e-127   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             378   4e-127   
gb|AAL79775.1|  elongation factor 1 alpha                               378   4e-127   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        378   5e-127   
ref|XP_001763194.1|  predicted protein                                  377   1e-126   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         377   1e-126   
dbj|BAL14665.1|  elongation factor 1-alpha                              377   1e-126   
gb|AAK82537.1|  At1g07930/T6D22_3                                       377   2e-126   
gb|ACN40081.1|  unknown                                                 376   3e-126   
gb|EMS65134.1|  Elongation factor 1-alpha                               382   4e-126   
gb|ABX82323.1|  elongation factor 1 subunit alpha                       367   5e-126   
gb|AGF25313.1|  elongation factor 1-alpha                               366   5e-126   
dbj|BAG80668.1|  elongation factor 1 alpha                              373   7e-126   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    375   9e-126   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    375   1e-125   
ref|XP_003618775.1|  Elongation factor 1-alpha                          389   3e-125   
gb|AEE98364.1|  elongation factor 1-alpha                               374   3e-125   
emb|CAC27139.1|  translation elongation factor-1 alpha                  371   2e-124   
gb|AAQ15280.1|  elongation factor 1 alpha                               363   2e-124   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    385   5e-124   
gb|AAQ15281.1|  elongation factor 1 alpha                               362   7e-124   
emb|CAA65798.1|  EF1-alpha                                              360   8e-124   
gb|EMT09703.1|  Elongation factor 1-alpha                               378   2e-123   
gb|AAR89627.1|  elongation factor 1 alpha                               361   2e-123   
emb|CAA68246.1|  factor 1-alpha                                         360   4e-123   
gb|ABC74971.1|  elongation factor 1 alpha                               360   4e-123   
ref|XP_002892424.1|  T6D22.2                                            382   5e-123   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    384   7e-123   
gb|AIM48895.1|  elongation factor 1-alpha                               366   1e-122   
gb|AAF79822.1|AC026875_2  T6D22.2                                       382   1e-122   
dbj|BAK08744.1|  elongation factor 1-alpha                              366   3e-122   
gb|AAV71174.1|  elongation factor 1-alpha                               358   3e-122   
dbj|BAK08818.1|  elongation factor 1-alpha                              366   3e-122   
dbj|BAK08819.1|  elongation factor 1-alpha                              365   5e-122   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    364   2e-121   
ref|NP_001104938.1|  elongation factor 1 alpha                          363   5e-121   
gb|AHL28542.1|  elongation factor 1-alpha                               353   1e-120   
gb|ABF00115.1|  elongation factor 1-alpha                               360   3e-120   
ref|NP_001275481.1|  elongation factor 1-alpha-like                     359   9e-120   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         359   2e-119   
ref|XP_003588821.1|  Elongation factor 1-alpha                          357   8e-119   
gb|AAX81595.1|  elongation factor elF1-alpha                            348   9e-119   
ref|XP_005650451.1|  translation elongation factor                      357   1e-118   
gb|ABE01138.1|  elongation factor 1-alpha                               349   1e-117   
gb|AHL28535.1|  elongation factor 1-alpha                               345   1e-117   
gb|ACN59918.1|  translation elongation factor-1 alpha                   343   6e-117   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    351   7e-117   
gb|ACA24136.1|  eukaryotic elongation factor 1-alpha                    350   8e-117   
gb|ABQ81941.1|  elongation factor 1-alpha                               343   6e-116   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       347   4e-115   
gb|ABW20463.1|  elongation factor 1-alpha                               344   9e-115   
gb|AFB18314.1|  translation elongation factor-1 alpha                   344   1e-114   
emb|CAD60652.1|  elongation factor                                      345   4e-114   
gb|AGH70141.1|  eukaryotic translation elongation factor 1 alpha        327   3e-110   
emb|CAF89665.1|  unnamed protein product                                329   4e-110   
gb|ABQ81936.1|  elongation factor 1-alpha                               334   5e-110   
ref|XP_009490089.1|  PREDICTED: elongation factor 1-alpha 2-like        326   6e-110   
gb|ELK00147.1|  Elongation factor 1-alpha 1                             325   6e-110   
emb|CDY06289.1|  BnaA09g49140D                                          327   1e-109   
emb|CAF89666.1|  unnamed protein product                                330   1e-109   
ref|XP_009435907.1|  PREDICTED: elongation factor 1-alpha 2             326   2e-109   
gb|EDL77726.1|  rCG25445, isoform CRA_g                                 325   2e-109   
gb|KJB48747.1|  hypothetical protein B456_008G084000                    332   2e-109   
emb|CDY06287.1|  BnaA09g49160D                                          325   2e-109   
gb|ACN59909.1|  translation elongation factor-1 alpha                   325   2e-109   
emb|CDY67375.1|  BnaC03g71520D                                          326   5e-109   
ref|XP_003781883.1|  PREDICTED: elongation factor 1-alpha 1-like        322   7e-109   
gb|ELW50063.1|  Putative elongation factor 1-alpha-like 3               324   1e-108   
gb|EDL26406.1|  mCG15232, isoform CRA_g                                 324   1e-108   
dbj|BAE48211.1|  elongation factor 1 alpha                              323   1e-108   
emb|CDX88757.1|  BnaA03g08920D                                          329   2e-108   
gb|EDL77722.1|  rCG25445, isoform CRA_c                                 325   2e-108   
ref|XP_002117044.1|  elongation factor 1 alpha                          331   2e-108   
gb|KEH43146.1|  elongation factor Tu (EF-Tu) GTP-binding family p...    330   2e-108   
gb|EDL26403.1|  mCG15232, isoform CRA_d                                 325   2e-108   
gb|EDL77725.1|  rCG25445, isoform CRA_f                                 325   2e-108   
emb|CDY61938.1|  BnaCnng38780D                                          329   3e-108   
gb|KFQ31255.1|  Elongation factor 1-alpha 2                             330   4e-108   
ref|XP_008072606.1|  PREDICTED: putative elongation factor 1-alph...    322   4e-108   
emb|CDX93604.1|  BnaA06g04440D                                          330   4e-108   
gb|ELR44723.1|  Elongation factor 1-alpha 2                             330   5e-108   
ref|XP_003968867.1|  PREDICTED: elongation factor 1-alpha-like          330   5e-108   
ref|XP_011213301.1|  PREDICTED: elongation factor 1-alpha 1             330   6e-108   
ref|XP_007104009.1|  PREDICTED: elongation factor 1-alpha 2             335   7e-108   
ref|XP_006235797.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    330   7e-108   
gb|EDL77724.1|  rCG25445, isoform CRA_e                                 325   8e-108   
gb|AAB48401.1|  elongation factor EF-1a                                 320   8e-108   
ref|XP_006639575.1|  PREDICTED: elongation factor 1-alpha 2-like        329   8e-108   
ref|XP_011194365.1|  PREDICTED: elongation factor 1-alpha 1             329   9e-108   
ref|XP_006078264.1|  PREDICTED: elongation factor 1-alpha 1-like        322   1e-107   
gb|EDL26401.1|  mCG15232, isoform CRA_b                                 325   1e-107   
ref|XP_004520688.1|  PREDICTED: elongation factor 1-alpha 1-like        329   1e-107   
gb|AIL54058.1|  elongation factor 1 alpha                               329   1e-107   
ref|XP_004360206.1|  elongation factor 1 alpha                          328   1e-107   
ref|NP_001032962.1|  elongation factor 1 alpha                          329   1e-107   
gb|AAT91089.1|  elongation factor 1-alpha                               329   1e-107   
gb|ABO28827.1|  elongation factor 1-alpha                               319   1e-107   
gb|AGM32286.1|  elongation factor 1-alpha                               322   1e-107   
emb|CCJ09439.1|  elongation factor 1 alpha                              329   1e-107   
ref|NP_524611.1|  elongation factor 1alpha100E, isoform A               328   2e-107   
ref|XP_004074126.1|  PREDICTED: elongation factor 1-alpha               328   2e-107   
ref|NP_477375.1|  elongation factor 1alpha48D, isoform A                328   2e-107   
ref|XP_004716095.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   2e-107   
ref|XP_002091158.1|  GE12389                                            328   2e-107   
ref|XP_008329250.1|  PREDICTED: elongation factor 1-alpha-like          328   2e-107   
ref|XP_002026026.1|  GL10091                                            326   2e-107   
ref|XP_001085675.2|  PREDICTED: elongation factor 1-alpha 2-like ...    327   2e-107   
gb|KFP28483.1|  Elongation factor 1-alpha 2                             328   2e-107   
gb|EFB18810.1|  hypothetical protein PANDA_015263                       327   2e-107   
emb|CAG00281.1|  unnamed protein product                                328   2e-107   
gb|EHB17794.1|  Elongation factor 1-alpha 2                             327   2e-107   
gb|EHH19518.1|  hypothetical protein EGK_02189                          327   2e-107   
ref|XP_011231232.1|  PREDICTED: elongation factor 1-alpha 2             327   2e-107   
ref|XP_005325458.1|  PREDICTED: elongation factor 1-alpha 2             327   2e-107   
gb|KFP67571.1|  Elongation factor 1-alpha 2                             328   2e-107   
ref|XP_006872109.1|  PREDICTED: elongation factor 1-alpha 1-like        322   2e-107   
gb|AAA41967.1|  statin-related protein                                  328   2e-107   
ref|XP_003963863.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    328   2e-107   
ref|NP_001107835.1|  elongation factor 1-alpha                          328   2e-107   
ref|XP_002081092.1|  GD10821                                            328   2e-107   
ref|XP_011217823.1|  PREDICTED: putative elongation factor 1-alph...    323   2e-107   
ref|XP_010208031.1|  PREDICTED: elongation factor 1-alpha 2             328   3e-107   
ref|XP_002053872.1|  GJ23103                                            328   3e-107   
ref|XP_005885616.1|  PREDICTED: elongation factor 1-alpha 2             327   3e-107   
ref|XP_006167177.1|  PREDICTED: elongation factor 1-alpha 2             327   3e-107   
ref|XP_006896948.1|  PREDICTED: elongation factor 1-alpha 2             328   3e-107   
dbj|BAD35019.1|  elongation factor 1 alpha                              328   3e-107   
ref|XP_004620338.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   3e-107   
gb|ADN94290.1|  elongation factor 1                                     325   3e-107   
ref|XP_002059330.1|  GJ17887                                            328   3e-107   
ref|NP_001166227.1|  elongation factor 1-alpha                          328   3e-107   
gb|ABV08874.1|  elongation factor 1 alpha                               322   3e-107   
gb|KFO53270.1|  Elongation factor 1-alpha 2                             328   3e-107   
gb|EMC83487.1|  Elongation factor 1-alpha 2                             328   3e-107   
ref|XP_007059884.1|  PREDICTED: elongation factor 1-alpha 2             328   3e-107   
ref|XP_001507891.1|  PREDICTED: elongation factor 1-alpha 2             328   3e-107   
gb|KFO77542.1|  Elongation factor 1-alpha 2                             328   3e-107   
emb|CAD70273.1|  elongation factor 1 alpha                              328   3e-107   
emb|CDQ86379.1|  unnamed protein product                                323   3e-107   
gb|KFR06778.1|  Elongation factor 1-alpha 2                             328   3e-107   
ref|XP_008155341.1|  PREDICTED: elongation factor 1-alpha 2             328   3e-107   
ref|XP_002004478.1|  GI19955                                            328   3e-107   
ref|XP_001959909.1|  GF13105                                            328   3e-107   
ref|XP_003284439.1|  elongation factor 1 alpha                          327   3e-107   
ref|XP_002070544.1|  GK12116                                            328   3e-107   
gb|AAV38607.1|  eukaryotic translation elongation factor 1 alpha 2      328   3e-107   
ref|XP_006994680.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   3e-107   
gb|AIY54298.1|  elongation factor 1-alpha                               328   3e-107   
ref|XP_004785941.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   3e-107   
gb|KFO87544.1|  Elongation factor 1-alpha 2                             328   3e-107   
ref|XP_001964572.1|  GF22982                                            328   3e-107   
ref|XP_004586009.1|  PREDICTED: elongation factor 1-alpha 2             328   3e-107   
ref|NP_001002371.1|  elongation factor 1-alpha 2                        328   3e-107   
gb|KGL80348.1|  Elongation factor 1-alpha 2                             327   3e-107   
gb|KFV74107.1|  Elongation factor 1-alpha 2                             328   3e-107   
gb|AAX43357.1|  eukaryotic translation elongation factor 1 alpha 2      328   3e-107   
gb|KFV47908.1|  Elongation factor 1-alpha 2                             328   3e-107   
ref|XP_001358993.1|  GA15055                                            328   3e-107   
ref|XP_004370231.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   3e-107   
ref|XP_003873868.1|  elongation factor 1-alpha                          319   3e-107   
ref|NP_031932.1|  elongation factor 1-alpha 2                           328   3e-107   
ref|XP_004410177.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   3e-107   
ref|NP_001949.1|  elongation factor 1-alpha 2                           328   3e-107   
ref|XP_008505851.1|  PREDICTED: elongation factor 1-alpha 2-like        328   3e-107   
ref|XP_006220477.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    328   4e-107   
ref|NP_001080856.1|  eukaryotic translation elongation factor 1 a...    328   4e-107   
ref|XP_006132553.1|  PREDICTED: elongation factor 1-alpha 2             328   4e-107   
ref|XP_009818875.1|  PREDICTED: elongation factor 1-alpha 2             328   4e-107   
ref|XP_001986652.1|  GH21478                                            328   4e-107   
ref|XP_009703605.1|  PREDICTED: elongation factor 1-alpha 2             328   4e-107   
ref|XP_002747797.1|  PREDICTED: elongation factor 1-alpha 2             328   4e-107   
gb|AEE61578.1|  unknown                                                 328   4e-107   
gb|AAL78750.1|  elongation factor-1 alpha                               328   4e-107   
ref|XP_005604935.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    328   4e-107   
ref|XP_007462304.1|  PREDICTED: elongation factor 1-alpha 2             328   4e-107   
ref|XP_006021708.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   4e-107   
ref|XP_001951287.3|  PREDICTED: elongation factor 1-alpha 2-like        325   4e-107   
ref|NP_571338.1|  elongation factor 1-alpha                             328   4e-107   
ref|XP_002538495.1|  elongation factor 1-alpha, putative                317   4e-107   
ref|XP_005185335.1|  PREDICTED: elongation factor 1-alpha 2             328   4e-107   
ref|XP_004716094.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   4e-107   
gb|AAO49408.1|AF485331_1  elongation factor 1-alpha                     328   4e-107   
ref|NP_001266576.1|  elongation factor 1a                               328   4e-107   
gb|KFV72900.1|  Elongation factor 1-alpha 2                             327   4e-107   
ref|XP_010779184.1|  PREDICTED: elongation factor 1-alpha               327   4e-107   
ref|NP_001098132.1|  elongation factor 1-alpha                          327   4e-107   
ref|XP_007245773.1|  PREDICTED: elongation factor 1-alpha-like          327   5e-107   
ref|NP_001027570.1|  eukaryotic translation elongation factor 1 a...    327   5e-107   
ref|XP_009669292.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    327   5e-107   
ref|XP_005739861.1|  PREDICTED: elongation factor 1-alpha-like          327   5e-107   
ref|XP_005181516.1|  PREDICTED: elongation factor 1-alpha 1             327   5e-107   
ref|XP_004458296.1|  PREDICTED: elongation factor 1-alpha 2             328   5e-107   
dbj|BAO56800.1|  elongation factor 1-alpha                              327   5e-107   
dbj|BAB64567.1|  elongation factor-1 alpha                              327   5e-107   
ref|XP_645839.1|  elongation factor 1 alpha                             327   5e-107   
ref|XP_004311146.1|  PREDICTED: elongation factor 1-alpha 2             327   5e-107   
gb|EAY88762.1|  hypothetical protein OsI_10238                          316   5e-107   
ref|XP_007910103.1|  PREDICTED: elongation factor 1-alpha 2             327   5e-107   
tpg|DAA05867.1|  TPA: eukaryotic translation elongation factor 1A       327   5e-107   
tpg|DAA16277.1|  TPA: EF1a-like protein-like                            322   6e-107   
gb|EPQ04746.1|  Elongation factor 1-alpha 1                             326   6e-107   
gb|AAP20169.1|  elongation factor 1-alpha                               327   6e-107   
ref|XP_004370230.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    328   6e-107   
ref|XP_004410176.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    327   6e-107   
gb|AAV84215.1|  elongation factor 1 alpha                               327   6e-107   
ref|XP_004014458.1|  PREDICTED: elongation factor 1-alpha 2             327   6e-107   
ref|XP_004430250.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    327   6e-107   



>gb|ACG70967.1| translation elongation factor 1, partial [Ziziphus jujuba]
Length=227

 Score =   382 bits (981),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPEKISF  190



>gb|AFW87115.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW87116.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW87117.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
 gb|AFW87118.1| putative translation elongation factor Tu family protein isoform 
4 [Zea mays]
 gb|AFW87119.1| putative translation elongation factor Tu family protein isoform 
5 [Zea mays]
Length=255

 Score =   383 bits (983),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>gb|AEQ94148.1| elongation factor 1 [Elaeis guineensis]
Length=221

 Score =   381 bits (979),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   389 bits (999),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   389 bits (999),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>emb|CDO98621.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   385 bits (990),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I+ 
Sbjct  181  VGYNPDKINF  190



>ref|XP_007009762.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY18572.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
Length=367

 Score =   385 bits (990),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AEG78681.1| elongation factor 1 alpha [Erythroxylum coca]
Length=211

 Score =   380 bits (975),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV+SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVASYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|KCW51623.1| hypothetical protein EUGRSUZ_J01112 [Eucalyptus grandis]
Length=330

 Score =   384 bits (986),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   388 bits (996),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   388 bits (996),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   388 bits (996),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   388 bits (996),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   388 bits (996),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>ref|XP_003604587.1| Elongation factor 1-alpha [Medicago truncatula]
 gb|AES86784.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   388 bits (996),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSK+RYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYMKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>emb|CDP08919.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   387 bits (994),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I+ 
Sbjct  181  VGYNPDKINF  190



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   387 bits (995),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   387 bits (995),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   387 bits (995),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   387 bits (995),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   387 bits (995),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   387 bits (995),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   387 bits (995),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   387 bits (995),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   387 bits (995),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010248287.1| PREDICTED: elongation factor 1-alpha, partial [Nelumbo nucifera]
Length=382

 Score =   385 bits (988),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPXKI  188



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   387 bits (994),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>emb|CDP07148.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I+ 
Sbjct  181  VGYNPDKINF  190



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   387 bits (994),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|ABF94275.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=347

 Score =   383 bits (983),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score =   385 bits (990),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSK+RYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+RYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYDEIVKEVSSYMKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001151074.1| elongation factor 1-alpha [Zea mays]
 gb|ACG41520.1| elongation factor 1-alpha [Zea mays]
 tpg|DAA63136.1| TPA: putative translation elongation factor Tu family protein 
[Zea mays]
Length=447

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEV SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVGSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_002460859.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
 gb|EER97380.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
Length=447

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEV SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVGSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKY+KARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYAKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   386 bits (991),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKAR+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARFDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|AES74993.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH25376.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   385 bits (990),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   385 bits (990),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   385 bits (988),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   385 bits (989),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   385 bits (989),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTA  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   385 bits (989),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV+SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVASYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   385 bits (989),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|AEK98799.1| translation elongation factor 1 alfa [Carthamus tinctorius]
Length=248

 Score =   378 bits (970),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDS T
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSAT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEI+KEV+SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIIKEVASYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   385 bits (989),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AFW90638.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=309

 Score =   380 bits (976),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   385 bits (989),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|KHG15275.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=431

 Score =   384 bits (987),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   385 bits (989),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007143679.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
 gb|ESW15673.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
Length=448

 Score =   385 bits (989),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTP YSKARYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPNYSKARYDEIVKEVSSYMKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   385 bits (989),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score =   385 bits (989),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGK KVHINIV+IGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKAKVHINIVIIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AFO67216.1| putative elongation factor 1-alpha, partial [Aralia elata]
Length=287

 Score =   379 bits (973),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_004162426.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006378755.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
 gb|ERP56552.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
Length=449

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006387491.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 ref|XP_006387492.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ABK94386.1| unknown [Populus trichocarpa]
 gb|ERP46405.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ERP46406.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
Length=449

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK H+NIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHLNIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPEKIPF  190



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEV+SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVASYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/185 (98%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP  612
            VGYNP
Sbjct  181  VGYNP  185



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/185 (98%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP  612
            VGYNP
Sbjct  181  VGYNP  185



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|NP_001077483.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 gb|AEE28214.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=372

 Score =   382 bits (980),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008380544.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSK+RYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008349743.1| PREDICTED: elongation factor 1-alpha isoform X2 [Malus domestica]
Length=397

 Score =   382 bits (982),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYS+ARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSRARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVCSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABB16977.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=319

 Score =   379 bits (974),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIMKEVSSYIKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AHZ58493.1| translation elongation factor alpha [Syntrichia caninervis]
Length=447

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EI KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEITKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/185 (98%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP  612
            VGYNP
Sbjct  181  VGYNP  185



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHIHIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EI KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEITKEVSSYIKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYS+ARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSRARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AIZ74328.1| translation elongation factor 1-alpha [Pinus massoniana]
Length=448

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDAT+PKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            +GYNP +I
Sbjct  181  IGYNPDKI  188



>gb|ABR17675.1| unknown [Picea sitchensis]
Length=448

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_011040946.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Populus 
euphratica]
Length=449

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKAR DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARSDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVYSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDAT+PKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            +GYNP +I
Sbjct  181  IGYNPDKI  188



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   384 bits (985),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+R+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ACN40740.1| unknown [Picea sitchensis]
 gb|ACN41072.1| unknown [Picea sitchensis]
Length=448

 Score =   384 bits (985),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   384 bits (985),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   384 bits (985),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   383 bits (984),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_002315287.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 ref|XP_002315285.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 ref|XP_002316351.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|ABK95341.1| unknown [Populus trichocarpa]
 gb|ABK95876.1| unknown [Populus trichocarpa]
 gb|EEF01458.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|EEF01456.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 gb|EEF02522.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
Length=449

 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009131916.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001032107.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97319.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
Length=400

 Score =   381 bits (979),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   383 bits (983),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   383 bits (983),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 181/185 (98%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKAR+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARFDEIVKEVSSYLKK  180

Query  598  VGYNP  612
            VGYNP
Sbjct  181  VGYNP  185



>ref|NP_001105935.1| elongation factor alpha8 [Zea mays]
 gb|AAF42982.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAA+MNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAADMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKAR+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARFDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPEKIPF  190



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDPTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_010456376.1| PREDICTED: elongation factor 1-alpha 1 isoform X7 [Camelina sativa]
Length=400

 Score =   381 bits (979),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   383 bits (983),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   383 bits (983),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   382 bits (982),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   382 bits (982),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   382 bits (982),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|EMS52529.1| Elongation factor 1-alpha [Triticum urartu]
 gb|EMS55225.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score =   382 bits (982),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 181/185 (98%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP  612
            VGYNP
Sbjct  181  VGYNP  185



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+R+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AFQ37422.1| translation elongation factor-1 alpha 1 [Larix kaempferi]
Length=447

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSK+RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>sp|Q03033.1|EF1A_WHEAT RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Triticum 
aestivum]
 gb|AAA34306.1| translation elongation factor 1 alpha-subunit [Triticum aestivum]
 emb|CAA90651.1| elongation factor 1-alpha [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85443.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT04563.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT21642.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT30905.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/185 (98%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP  612
            VGYNP
Sbjct  181  VGYNP  185



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV+ Y+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVALYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKR+IERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRLIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AGI78242.1| elongation factor 1 alpha [Caragana korshinskii]
Length=447

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/185 (98%), Positives = 183/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIY LGGIDKRV ERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYNLGGIDKRVFERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP  612
            VGYNP
Sbjct  181  VGYNP  185



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  22   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  81

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  82   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  141

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  142  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  201

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  202  VGYNPDKI  209



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+ K
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLXK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDFTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGI KDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGIFKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +IH 
Sbjct  181  VGYNPDKIHF  190



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_002311107.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93463.1| unknown [Populus trichocarpa]
 gb|EEE88474.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAER+RGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERDRGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITI IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIGIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY++K
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLEK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_002312029.1| ADR12-2 family protein [Populus trichocarpa]
 gb|EEE89396.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   382 bits (981),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVI+RFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIDRFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHA LAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHAFLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QIHL  627
            VGYNP +I  
Sbjct  181  VGYNPDKIPF  190



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATT KYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTSKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>ref|XP_002311106.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93897.1| unknown [Populus trichocarpa]
 gb|EEE88473.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>ref|XP_010669658.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNK+DATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   381 bits (979),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYIKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPEKI  188



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   381 bits (979),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  417
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  418  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  597
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  598  VGYNP*QI  621
            VGYNP +I
Sbjct  181  VGYNPDKI  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875