BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050H15

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349497.1|  PREDICTED: ATP-dependent zinc metalloproteas...    191   1e-52   Solanum tuberosum [potatoes]
ref|XP_009611240.1|  PREDICTED: ATP-dependent zinc metalloproteas...    187   2e-51   Nicotiana tomentosiformis
ref|XP_006349498.1|  PREDICTED: ATP-dependent zinc metalloproteas...    186   5e-51   Solanum tuberosum [potatoes]
ref|XP_006341014.1|  PREDICTED: ATP-dependent zinc metalloproteas...    176   2e-47   Solanum tuberosum [potatoes]
ref|XP_010312354.1|  PREDICTED: ATP-dependent zinc metalloproteas...    175   5e-47   Solanum lycopersicum
ref|XP_009781386.1|  PREDICTED: ATP-dependent zinc metalloproteas...    175   6e-47   Nicotiana sylvestris
ref|XP_004249560.1|  PREDICTED: ATP-dependent zinc metalloproteas...    171   2e-45   Solanum lycopersicum
ref|XP_009598017.1|  PREDICTED: ATP-dependent zinc metalloproteas...    164   4e-43   Nicotiana tomentosiformis
ref|XP_009772661.1|  PREDICTED: ATP-dependent zinc metalloproteas...    164   5e-43   Nicotiana sylvestris
ref|XP_004246405.1|  PREDICTED: ATP-dependent zinc metalloproteas...    164   7e-43   Solanum lycopersicum
ref|XP_011094876.1|  PREDICTED: ATP-dependent zinc metalloproteas...    138   1e-33   Sesamum indicum [beniseed]
ref|XP_011094875.1|  PREDICTED: ATP-dependent zinc metalloproteas...    137   2e-33   Sesamum indicum [beniseed]
ref|XP_002283273.1|  PREDICTED: ATP-dependent zinc metalloproteas...    129   2e-30   Vitis vinifera
ref|XP_002323508.2|  hypothetical protein POPTR_0016s10620g             124   9e-29   
emb|CDP06599.1|  unnamed protein product                                124   9e-29   Coffea canephora [robusta coffee]
ref|XP_006429118.1|  hypothetical protein CICLE_v10011087mg             121   6e-28   Citrus clementina [clementine]
ref|XP_006480880.1|  PREDICTED: ATP-dependent zinc metalloproteas...    121   6e-28   
ref|XP_011007150.1|  PREDICTED: ATP-dependent zinc metalloproteas...    120   2e-27   Populus euphratica
gb|EYU41737.1|  hypothetical protein MIMGU_mgv1a001461mg                120   3e-27   Erythranthe guttata [common monkey flower]
ref|XP_009345397.1|  PREDICTED: ATP-dependent zinc metalloproteas...    116   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_009338598.1|  PREDICTED: ATP-dependent zinc metalloproteas...    115   7e-26   Pyrus x bretschneideri [bai li]
ref|XP_008240759.1|  PREDICTED: ATP-dependent zinc metalloproteas...    114   3e-25   Prunus mume [ume]
ref|XP_008369915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    113   5e-25   
ref|XP_007026989.1|  Cell division protease ftsH isoform 1              108   2e-23   
ref|XP_007026990.1|  Cell division protease ftsH isoform 2              107   4e-23   
ref|XP_009416148.1|  PREDICTED: ATP-dependent zinc metalloproteas...    106   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008777193.1|  PREDICTED: ATP-dependent zinc metalloproteas...    103   9e-22   Phoenix dactylifera
ref|XP_010043509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    103   1e-21   Eucalyptus grandis [rose gum]
ref|XP_004143122.1|  PREDICTED: ATP-dependent zinc metalloproteas...    102   4e-21   Cucumis sativus [cucumbers]
ref|XP_010256889.1|  PREDICTED: ATP-dependent zinc metalloproteas...    101   8e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010521865.1|  PREDICTED: ATP-dependent zinc metalloproteas...    101   8e-21   Tarenaya hassleriana [spider flower]
ref|XP_008464106.1|  PREDICTED: ATP-dependent zinc metalloproteas...  99.8    2e-20   Cucumis melo [Oriental melon]
ref|XP_010685724.1|  PREDICTED: ATP-dependent zinc metalloproteas...  99.8    3e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011089809.1|  PREDICTED: ATP-dependent zinc metalloproteas...  99.8    3e-20   Sesamum indicum [beniseed]
ref|XP_010920548.1|  PREDICTED: ATP-dependent zinc metalloproteas...  99.0    4e-20   Elaeis guineensis
ref|XP_010931243.1|  PREDICTED: ATP-dependent zinc metalloproteas...  98.6    6e-20   Elaeis guineensis
ref|XP_010043511.1|  PREDICTED: ATP-dependent zinc metalloproteas...  98.2    1e-19   Eucalyptus grandis [rose gum]
gb|KCW85528.1|  hypothetical protein EUGRSUZ_B02325                   97.8    1e-19   Eucalyptus grandis [rose gum]
gb|KJB55847.1|  hypothetical protein B456_009G097900                  96.3    3e-19   Gossypium raimondii
gb|KJB55846.1|  hypothetical protein B456_009G097900                  96.3    4e-19   Gossypium raimondii
ref|XP_010931244.1|  PREDICTED: ATP-dependent zinc metalloproteas...  95.9    5e-19   Elaeis guineensis
gb|KCW85527.1|  hypothetical protein EUGRSUZ_B02324                   95.1    9e-19   Eucalyptus grandis [rose gum]
ref|XP_007208082.1|  hypothetical protein PRUPE_ppa001525mg           95.1    1e-18   
ref|XP_010043510.1|  PREDICTED: ATP-dependent zinc metalloproteas...  95.1    1e-18   Eucalyptus grandis [rose gum]
ref|XP_010475511.1|  PREDICTED: ATP-dependent zinc metalloproteas...  94.7    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010475512.1|  PREDICTED: ATP-dependent zinc metalloproteas...  94.7    1e-18   Camelina sativa [gold-of-pleasure]
gb|KFK43073.1|  hypothetical protein AALP_AA1G075200                  94.4    2e-18   Arabis alpina [alpine rockcress]
gb|KHG20351.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...  94.0    2e-18   Gossypium arboreum [tree cotton]
gb|KJB16964.1|  hypothetical protein B456_002G257200                  94.0    3e-18   Gossypium raimondii
gb|KJB16965.1|  hypothetical protein B456_002G257200                  93.6    3e-18   Gossypium raimondii
ref|XP_007016370.1|  FTSH protease 10                                 93.6    3e-18   
gb|KHG12964.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...  92.4    7e-18   Gossypium arboreum [tree cotton]
ref|XP_010262544.1|  PREDICTED: ATP-dependent zinc metalloproteas...  92.4    8e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010487550.1|  PREDICTED: ATP-dependent zinc metalloproteas...  91.7    1e-17   
ref|XP_010487557.1|  PREDICTED: ATP-dependent zinc metalloproteas...  91.7    1e-17   
ref|XP_010487541.1|  PREDICTED: ATP-dependent zinc metalloproteas...  91.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008784613.1|  PREDICTED: ATP-dependent zinc metalloproteas...  91.7    1e-17   Phoenix dactylifera
ref|XP_004302718.2|  PREDICTED: ATP-dependent zinc metalloproteas...  91.7    2e-17   Fragaria vesca subsp. vesca
ref|XP_002889652.1|  FTSH10                                           91.3    2e-17   Arabidopsis lyrata subsp. lyrata
gb|KFK32242.1|  hypothetical protein AALP_AA6G216200                  90.5    3e-17   Arabis alpina [alpine rockcress]
ref|XP_010106514.1|  ATP-dependent zinc metalloprotease FTSH 10       89.7    6e-17   Morus notabilis
ref|XP_002530989.1|  Mitochondrial respiratory chain complexes as...  89.7    6e-17   
emb|CDP09082.1|  unnamed protein product                              89.7    7e-17   Coffea canephora [robusta coffee]
ref|XP_006484360.1|  PREDICTED: ATP-dependent zinc metalloproteas...  87.0    8e-17   Citrus sinensis [apfelsine]
ref|XP_003539662.1|  PREDICTED: ATP-dependent zinc metalloproteas...  89.0    1e-16   Glycine max [soybeans]
gb|KHN32140.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...  89.0    1e-16   Glycine soja [wild soybean]
ref|NP_172231.2|  FTSH protease 10                                    89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222305.1|  PREDICTED: ATP-dependent zinc metalloproteas...  89.0    1e-16   Prunus mume [ume]
ref|XP_007207144.1|  hypothetical protein PRUPE_ppa001491mg           89.0    1e-16   Prunus persica
ref|XP_006306790.1|  hypothetical protein CARUB_v10008328mg           88.2    2e-16   Capsella rubella
gb|KDO72822.1|  hypothetical protein CISIN_1g047690mg                 88.2    2e-16   Citrus sinensis [apfelsine]
ref|XP_006424865.1|  hypothetical protein CICLE_v10027837mg           88.2    2e-16   Citrus clementina [clementine]
ref|XP_007133225.1|  hypothetical protein PHAVU_011G162000g           88.2    2e-16   Phaseolus vulgaris [French bean]
ref|XP_004164623.1|  PREDICTED: ATP-dependent zinc metalloproteas...  87.0    5e-16   
ref|XP_004142062.1|  PREDICTED: ATP-dependent zinc metalloproteas...  87.0    5e-16   Cucumis sativus [cucumbers]
ref|XP_008799731.1|  PREDICTED: ATP-dependent zinc metalloproteas...  86.7    7e-16   Phoenix dactylifera
ref|XP_008448063.1|  PREDICTED: ATP-dependent zinc metalloproteas...  86.3    9e-16   Cucumis melo [Oriental melon]
ref|XP_010542637.1|  PREDICTED: ATP-dependent zinc metalloproteas...  86.3    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_006488359.1|  PREDICTED: ATP-dependent zinc metalloproteas...  85.1    2e-15   Citrus sinensis [apfelsine]
gb|AAK77908.1|AF397903_1  AAA-metalloprotease FtsH                    84.7    3e-15   Pisum sativum [garden pea]
ref|XP_006409951.1|  hypothetical protein EUTSA_v10016261mg           84.7    3e-15   Eutrema salsugineum [saltwater cress]
ref|XP_008448079.1|  PREDICTED: ATP-dependent zinc metalloproteas...  84.3    4e-15   Cucumis melo [Oriental melon]
gb|KHN21936.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...  84.0    5e-15   Glycine soja [wild soybean]
ref|XP_003537985.1|  PREDICTED: ATP-dependent zinc metalloproteas...  84.0    5e-15   Glycine max [soybeans]
gb|KDP42240.1|  hypothetical protein JCGZ_02970                       84.0    5e-15   Jatropha curcas
ref|XP_010937593.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  83.6    7e-15   
emb|CDY09913.1|  BnaC08g45380D                                        83.2    8e-15   Brassica napus [oilseed rape]
ref|XP_003606687.1|  Cell division protease ftsH-like protein         83.2    1e-14   Medicago truncatula
ref|XP_008366731.1|  PREDICTED: uncharacterized protein LOC103430373  79.0    2e-14   
gb|AAF79577.1|AC022464_35  F22G5.10                                   80.5    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008356937.1|  PREDICTED: ATP-dependent zinc metalloproteas...  80.5    7e-14   Malus domestica [apple tree]
gb|AAL36270.1|  putative AAA-type ATPase                              80.1    9e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAC33234.1|  putative AAA-type ATPase                              80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850129.1|  FTSH protease 3                                     80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364366.1|  PREDICTED: ATP-dependent zinc metalloproteas...  79.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_009118433.1|  PREDICTED: ATP-dependent zinc metalloproteas...  78.2    4e-13   Brassica rapa
ref|XP_009387530.1|  PREDICTED: ATP-dependent zinc metalloproteas...  77.8    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004507174.1|  PREDICTED: ATP-dependent zinc metalloproteas...  77.0    1e-12   Cicer arietinum [garbanzo]
ref|XP_009384843.1|  PREDICTED: ATP-dependent zinc metalloproteas...  76.6    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003539663.1|  PREDICTED: ATP-dependent zinc metalloproteas...  75.9    2e-12   Glycine max [soybeans]
ref|XP_008384940.1|  PREDICTED: ATP-dependent zinc metalloproteas...  75.5    3e-12   
ref|XP_007132051.1|  hypothetical protein PHAVU_011G062800g           75.1    4e-12   Phaseolus vulgaris [French bean]
ref|XP_002881027.1|  hypothetical protein ARALYDRAFT_344684           75.1    4e-12   
ref|XP_009375915.1|  PREDICTED: ATP-dependent zinc metalloproteas...  74.3    6e-12   Pyrus x bretschneideri [bai li]
gb|KDP35648.1|  hypothetical protein JCGZ_09086                       73.9    1e-11   Jatropha curcas
ref|XP_006845226.1|  hypothetical protein AMTR_s00005p00256120        72.8    2e-11   Amborella trichopoda
ref|XP_009384842.1|  PREDICTED: ATP-dependent zinc metalloproteas...  72.8    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004294648.1|  PREDICTED: ATP-dependent zinc metalloproteas...  72.4    3e-11   Fragaria vesca subsp. vesca
ref|XP_006417796.1|  hypothetical protein EUTSA_v10006814mg           71.6    6e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009140963.1|  PREDICTED: ATP-dependent zinc metalloproteas...  70.9    9e-11   Brassica rapa
gb|EYU38460.1|  hypothetical protein MIMGU_mgv1a001496mg              70.1    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_010042847.1|  PREDICTED: ATP-dependent zinc metalloproteas...  65.9    2e-10   Eucalyptus grandis [rose gum]
ref|XP_006592193.1|  PREDICTED: ATP-dependent zinc metalloproteas...  68.2    2e-10   Glycine max [soybeans]
ref|XP_010469994.1|  PREDICTED: ATP-dependent zinc metalloproteas...  68.6    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008350440.1|  PREDICTED: uncharacterized protein LOC103413780  66.2    5e-10   
ref|XP_010414442.1|  PREDICTED: ATP-dependent zinc metalloproteas...  68.6    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006592191.1|  PREDICTED: ATP-dependent zinc metalloproteas...  67.8    9e-10   Glycine max [soybeans]
gb|KFK40664.1|  hypothetical protein AALP_AA2G026000                  62.8    4e-09   Arabis alpina [alpine rockcress]
emb|CDX77230.1|  BnaC04g40250D                                        64.7    1e-08   
gb|EPS71434.1|  hypothetical protein M569_03325                       62.0    7e-08   Genlisea aurea
ref|XP_010510537.1|  PREDICTED: ATP-dependent zinc metalloproteas...  61.6    1e-07   Camelina sativa [gold-of-pleasure]
gb|KHN32138.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...  61.2    1e-07   Glycine soja [wild soybean]
ref|XP_009125053.1|  PREDICTED: ATP-dependent zinc metalloproteas...  60.5    2e-07   Brassica rapa
emb|CDY31753.1|  BnaA04g16890D                                        58.9    6e-07   Brassica napus [oilseed rape]
gb|KJB36698.1|  hypothetical protein B456_006G171800                  58.2    1e-06   Gossypium raimondii
ref|XP_002313426.1|  FtsH protease family protein                     58.2    1e-06   
ref|XP_010688798.1|  PREDICTED: succinate dehydrogenase cytochrom...  56.6    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002439915.1|  hypothetical protein SORBIDRAFT_09g022490        52.8    8e-05   Sorghum bicolor [broomcorn]
gb|AFW82207.1|  hypothetical protein ZEAMMB73_958383                  50.1    7e-04   



>ref|XP_006349497.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=816

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 145/183 (79%), Gaps = 11/183 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+LSR+ RS S     ++N+ LISGG+GVR  +LDE+A+ + CI RV GG+GFVRSYLTS
Sbjct  1    MILSRVNRSRS-----SINKALISGGHGVRYAILDEVASSNACITRVNGGLGFVRSYLTS  55

Query  283  VGAGKGIIN-----RAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
            +GAGK  +N     RAYLS++D + TNPRLRR FCSQ  KK NYENYYPKNKKE+PK NN
Sbjct  56   IGAGKHGVNKAALQRAYLSEIDKLCTNPRLRRFFCSQGSKKSNYENYYPKNKKEVPKGNN  115

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QK+ESG+E+ S+G+QG+PQ+NF+KQYQN++T LLFIGF+LSS + SPR Q EISFQ  K 
Sbjct  116  QKAESGKEE-STGEQGNPQENFMKQYQNILTPLLFIGFILSSTLFSPREQKEISFQEFKN  174

Query  628  SCL  636
            + L
Sbjct  175  NLL  177



>ref|XP_009611240.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=811

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 145/178 (81%), Gaps = 8/178 (4%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+LSRI RS+SKSS   +N+ L+SG   VR  +LDE+A+++ CI RV GG+GFVRSYLTS
Sbjct  1    MILSRINRSLSKSS---INKKLVSG---VRRVILDEVASRNACITRVNGGLGFVRSYLTS  54

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            +GAGK  +N+AYLS++DS+F NPRLRR FCSQ  K KNYENYYPKNKKE+PK NNQK+ES
Sbjct  55   IGAGKQGVNKAYLSELDSLFANPRLRRFFCSQGSKNKNYENYYPKNKKEVPKGNNQKAES  114

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            G+E+ S+G+QG+PQD FLKQYQN++T LLFIGF+LSS +L PR Q EISFQ  K   L
Sbjct  115  GKEE-STGEQGNPQD-FLKQYQNILTPLLFIGFILSSTLLGPREQKEISFQEFKNKLL  170



>ref|XP_006349498.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=815

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 145/183 (79%), Gaps = 12/183 (7%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+LSR+ RS S     ++N+ LISGG+GVR  +LDE+A+ + CI RV GG+GFVRSYLTS
Sbjct  1    MILSRVNRSRS-----SINKALISGGHGVRYAILDEVASSNACITRVNGGLGFVRSYLTS  55

Query  283  VGAGKGIIN-----RAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
            +GAGK  +N     RAYLS++D + TNPRLRR FCSQ   KKNYENYYPKNKKE+PK NN
Sbjct  56   IGAGKHGVNKAALQRAYLSEIDKLCTNPRLRRFFCSQG-SKKNYENYYPKNKKEVPKGNN  114

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QK+ESG+E+ S+G+QG+PQ+NF+KQYQN++T LLFIGF+LSS + SPR Q EISFQ  K 
Sbjct  115  QKAESGKEE-STGEQGNPQENFMKQYQNILTPLLFIGFILSSTLFSPREQKEISFQEFKN  173

Query  628  SCL  636
            + L
Sbjct  174  NLL  176



>ref|XP_006341014.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum tuberosum]
Length=817

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 144/179 (80%), Gaps = 5/179 (3%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            MMLSRI+RS+SK+S S++++G+   GYGVR+ VLDE+A    CI RV+GGIGFVR+YLT 
Sbjct  1    MMLSRISRSISKASRSSIHKGV---GYGVRSAVLDEVATGGACITRVDGGIGFVRTYLTL  57

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT-NNQKSE  459
            +G G+  +++AYLS++DS+  +PRLRR FCS+ PK++NYENYYPKNK EIPK  NNQK+E
Sbjct  58   IGGGRKGLSKAYLSELDSVLASPRLRRFFCSEGPKRRNYENYYPKNKIEIPKANNNQKAE  117

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            SG+E+  SG+QG+PQ+NF+K   N++  LLFIGF+LSS+++SPR Q EISFQ  K   L
Sbjct  118  SGKEE-GSGEQGNPQENFIKLNYNILAPLLFIGFILSSILMSPREQQEISFQEFKNKLL  175



>ref|XP_010312354.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Solanum lycopersicum]
Length=813

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 133/183 (73%), Gaps = 14/183 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+LSRI R  S     T+N+ LISG   VR  +LDE+A+ + CI R  GG+GFVRSYLTS
Sbjct  1    MILSRINRCRS-----TINKALISG---VRYAILDEVASSNACITRANGGLGFVRSYLTS  52

Query  283  VGAGK-----GIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
            +GAGK       + RAYLS++D +  NPRLRR FCSQ  KK NYENYYPKNKKE+PK NN
Sbjct  53   IGAGKHGVSKAALQRAYLSEIDKLCANPRLRRFFCSQGSKKSNYENYYPKNKKEVPKGNN  112

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QK+ESG+E+S+  Q   PQ+NF+KQYQN++T LLFIGF+LSS + SPR Q EISFQ  K 
Sbjct  113  QKAESGKEESTGEQGN-PQENFMKQYQNILTPLLFIGFILSSTLFSPREQKEISFQEFKN  171

Query  628  SCL  636
              L
Sbjct  172  KLL  174



>ref|XP_009781386.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=808

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 141/178 (79%), Gaps = 10/178 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+LSRI RS++KSS   +N+ L+SG   VR  +LDE+A++  CI RV GG+GFVRSYLTS
Sbjct  1    MILSRINRSLAKSS---INKRLVSG---VRGVILDEVASRDACITRVNGGLGFVRSYLTS  54

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            +GAGK  +N+AYLS++DS+F  PRLRR FCSQ  K KNYENYYPKNKKE+PK NNQK  +
Sbjct  55   IGAGKQGVNKAYLSELDSLFAKPRLRRFFCSQGSKNKNYENYYPKNKKEVPKGNNQK--A  112

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            G+E+ S+G+QG+PQD FLKQYQN++T LLFIGF+LSS +L PR Q EISFQ  K   L
Sbjct  113  GKEE-STGEQGNPQD-FLKQYQNILTPLLFIGFILSSTLLGPREQKEISFQEFKNKLL  168



>ref|XP_004249560.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum lycopersicum]
Length=812

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 124/183 (68%), Gaps = 15/183 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+LSRI R  S     T+N+ LISG   VR  +LDE+A+ + CI R  GG+GFVRSYLTS
Sbjct  1    MILSRINRCRS-----TINKALISG---VRYAILDEVASSNACITRANGGLGFVRSYLTS  52

Query  283  VGAGK-----GIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
            +GAGK       + RAYLS++D +  NPRLRR FCSQ  KK     Y    K+ +PK NN
Sbjct  53   IGAGKHGVSKAALQRAYLSEIDKLCANPRLRRFFCSQGSKKNYENYYPKNKKE-VPKGNN  111

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QK+ESG+E+S+  Q   PQ+NF+KQYQN++T LLFIGF+LSS + SPR Q EISFQ  K 
Sbjct  112  QKAESGKEESTGEQGN-PQENFMKQYQNILTPLLFIGFILSSTLFSPREQKEISFQEFKN  170

Query  628  SCL  636
              L
Sbjct  171  KLL  173



>ref|XP_009598017.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=821

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGV-RTKVLDELAAQSTCIARVEGGIGFVRSYLT  279
            MMLSRI RS+SKSS S +++GL+ GG    R+ VLDE+A +  CI RV+GG+ FVR+YLT
Sbjct  1    MMLSRIGRSLSKSSRSNIHKGLVYGGGYGVRSAVLDEVATRGACITRVDGGLRFVRTYLT  60

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
            S+G+GK  +++A LS++DS+F N RLRR FCS+ PK++NYENYYPK++KE+PK NNQK+E
Sbjct  61   SIGSGKQGLSKANLSELDSVFANHRLRRFFCSEGPKRRNYENYYPKDRKEVPKGNNQKAE  120

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            SG+E+  +G+QG+PQ+NF+K   NL+T LLFIGF+LSS++LSPR Q EISFQ  K   L
Sbjct  121  SGKEE-GAGEQGNPQENFVKLNYNLLTPLLFIGFILSSILLSPREQQEISFQEFKNKLL  178



>ref|XP_009772661.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=820

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGV-RTKVLDELAAQSTCIARVEGGIGFVRSYLT  279
            MMLSRI RS+SKSS S +++GL+ GG    R+  LDE+A +  CI RV+G + FVR+YLT
Sbjct  1    MMLSRIGRSLSKSSHSNIHKGLVYGGGYGVRSAALDEVAVRGACITRVDGELWFVRTYLT  60

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
            S+G+GK  +++AYLS++DS+F N RLRR FCS+ PK++NYENYYPK++KE+PK NNQK+E
Sbjct  61   SIGSGKQGLSKAYLSELDSVFANHRLRRFFCSEGPKRRNYENYYPKDRKEVPKGNNQKAE  120

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            SG+E+  +G+QG+PQ+NF+K   NL+T LLFIGF+LSS++LSPR Q EISFQ  K
Sbjct  121  SGKEE-GAGEQGNPQENFVKLNYNLLTPLLFIGFILSSILLSPREQQEISFQEFK  174



>ref|XP_004246405.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum lycopersicum]
Length=813

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 135/179 (75%), Gaps = 9/179 (5%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            MMLSRI+RS+SK+S S++++G+   GYGVR+ VLDE+A    CI RV+GG+GFVR+YLT 
Sbjct  1    MMLSRISRSISKASRSSIHKGV---GYGVRSTVLDEVATGGACITRVDGGLGFVRTYLTL  57

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN-QKSE  459
            +G G+    R    ++DS+  +PRLRR FCS+ PK++NYENYYPKNKKEIPK NN QK+E
Sbjct  58   IGGGR----RGLSKELDSVLASPRLRRFFCSEGPKRRNYENYYPKNKKEIPKANNNQKAE  113

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            SG+E+ S  Q   PQ+NF+K   NL+  LLFIGF+LSS+++SPR Q EISFQ  K   L
Sbjct  114  SGKEEGSGEQGN-PQENFIKLNYNLLAPLLFIGFILSSILMSPREQQEISFQEFKNKLL  171



>ref|XP_011094876.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=815

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 114/173 (66%), Gaps = 2/173 (1%)
 Frame = +1

Query  106  MLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSV  285
            M SRI  SV +SS +++N+G  SG YGVR+  L E ++     +   G +GF+RSYLT +
Sbjct  1    MFSRIGSSVCRSSRASLNKGAASGSYGVRSATLTEFSSGKAFTSCENGELGFLRSYLTCI  60

Query  286  GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESG  465
            GAGK       L +++S+FTNPRLRRLFC+QAPKK  YENYYPKNK   PK +NQKSE+ 
Sbjct  61   GAGKQAAKSHVLKELNSVFTNPRLRRLFCNQAPKKGRYENYYPKNKTRTPKGSNQKSEAK  120

Query  466  REDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
             +  S  Q  +P  +  KQ QN +T LL IGFVL+SM + P  Q +ISFQ  K
Sbjct  121  EDSGSGEQWNNP--DMAKQLQNFVTPLLLIGFVLTSMFMRPHDQKQISFQEFK  171



>ref|XP_011094875.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=817

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  106  MLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSV  285
            M SRI  SV +SS +++N+G  SG YGVR+  L E ++     +   G +GF+RSYLT +
Sbjct  1    MFSRIGSSVCRSSRASLNKGAASGSYGVRSATLTEFSSGKAFTSCENGELGFLRSYLTCI  60

Query  286  GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESG  465
            GAGK       L +++S+FTNPRLRRLFC+QAPKK  YENYYPKNK   PK +NQKSE+ 
Sbjct  61   GAGKQAAKSHVLKELNSVFTNPRLRRLFCNQAPKKGRYENYYPKNKTRTPKGSNQKSEAK  120

Query  466  REDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
              + S   +     +  KQ QN +T LL IGFVL+SM + P  Q +ISFQ  K
Sbjct  121  DAEDSGSGEQWNNPDMAKQLQNFVTPLLLIGFVLTSMFMRPHDQKQISFQEFK  173



>ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Vitis vinifera]
 emb|CBI16104.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 127/182 (70%), Gaps = 6/182 (3%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQ----STCIARVEGGIGFVRS  270
            M+LSR+ RS+S+SS +   R ++SGG   R+  L+E  ++    ST + +++GG+GF+R 
Sbjct  1    MILSRLGRSLSRSS-TAKPRNVLSGGNVGRSAFLNEALSRAPHYSTDLGQLDGGLGFLRG  59

Query  271  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ  450
            YLTS+GA +G + ++YLSD++ +  NPR+RR   S+APKKKNYEN+YPKNKKE PK   Q
Sbjct  60   YLTSIGASRGFVGKSYLSDLNFVLANPRIRRFLSSEAPKKKNYENFYPKNKKETPKGEEQ  119

Query  451  KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKIS  630
            KSES +EDS++   G+ Q+ F+KQ QN++T LL IG  LSS    PR Q +ISFQ  K  
Sbjct  120  KSES-KEDSNTDDHGNFQETFMKQLQNVLTPLLVIGLFLSSFSFGPREQKQISFQEFKNK  178

Query  631  CL  636
             L
Sbjct  179  LL  180



>ref|XP_002323508.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
 gb|EEF05269.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
Length=814

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 124/185 (67%), Gaps = 12/185 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGG---YGVRTKVLDELAAQSTCIARVEG----GIGF  261
            M+LSRI RS+S+S+ ST+ R +I+ G   +  RT ++DEL ++    A +E     G+G 
Sbjct  1    MILSRIGRSLSRSARSTLQRNVITTGNYLFNARTVLVDELTSR---FAALESNGIRGLGI  57

Query  262  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  441
            VR YL+  GAGK I++   LS+++SI  NPR+RR FCS+APKK+ YENYYPK+KKEIPK 
Sbjct  58   VRGYLSYSGAGKQIVSSTQLSNLNSILANPRVRRFFCSEAPKKRKYENYYPKDKKEIPKA  117

Query  442  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXX  621
            N  KSES +EDS     G  Q N LK +QN+IT LLF+ FV SSM  + + Q +ISFQ  
Sbjct  118  NESKSES-KEDSGGAGGGDSQ-NTLKLFQNIITPLLFLAFVYSSMFFNTQEQKQISFQEF  175

Query  622  KISCL  636
            K   L
Sbjct  176  KNKLL  180



>emb|CDP06599.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 130/185 (70%), Gaps = 8/185 (4%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQ--STCIARVEGG-IGFVRSY  273
            M+ SRI RS+  SS S  +  LISG +GVR      + +   + CI RV+   +G VRSY
Sbjct  1    MIFSRIGRSLLSSSRSAYSNKLISG-FGVRGMRSPSVTSTDLNACIPRVDAPTLGPVRSY  59

Query  274  LTSVGAGKG----IINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  441
            LTS+ AG G    I    +LS+ +S+F NPRLRRLFCS+APK++NYENYYPK+KKEIPK 
Sbjct  60   LTSIRAGAGGGTKIAGTTFLSEFNSVFANPRLRRLFCSEAPKQRNYENYYPKDKKEIPKG  119

Query  442  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXX  621
            +N++S   +++SS+G Q + QD+  KQ+QNLI  LLFIG+VLSS++LSPR QN+ISFQ  
Sbjct  120  DNKRSSEAKDESSAGDQANGQDSSSKQFQNLIMPLLFIGYVLSSILLSPREQNQISFQEF  179

Query  622  KISCL  636
            K   L
Sbjct  180  KTKLL  184



>ref|XP_006429118.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
 gb|ESR42358.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
Length=818

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 117/181 (65%), Gaps = 9/181 (5%)
 Frame = +1

Query  103  MMLSRIARSVSKSS-PSTVNRGLISGGYGVRTKVLDELAAQST-CIARVEGGIGFVRSYL  276
            M+ SRI RS+ +S+  ST  + +++G Y  R  +L E    +T CI+RV+GG+GFVRS+L
Sbjct  1    MIFSRIGRSLCRSARSSTFQKNVVAGDYNARADLLIEPIFPTTPCISRVDGGVGFVRSFL  60

Query  277  TSVGAGKGIIN-RAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  453
            TS GAGK +++     S+ +SI  NPR R+    Q+PKK  YENYYPKNKKEIPK N QK
Sbjct  61   TSAGAGKQLVSLNKCSSNFNSIVANPRARKFCSGQSPKKSKYENYYPKNKKEIPKANEQK  120

Query  454  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISC  633
            SES  +  +         NF +Q+ N ++ LL  GFVLSS++LSP+ Q EISFQ  K   
Sbjct  121  SESKGDSGAG------DQNFTRQFSNFLSHLLLFGFVLSSVLLSPKQQKEISFQEFKNKL  174

Query  634  L  636
            L
Sbjct  175  L  175



>ref|XP_006480880.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006480881.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=818

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 117/181 (65%), Gaps = 9/181 (5%)
 Frame = +1

Query  103  MMLSRIARSVSKSS-PSTVNRGLISGGYGVRTKVLDELAAQST-CIARVEGGIGFVRSYL  276
            M+ SRI RS+ +S+  ST  + +++G Y  R  +L E    +T CI+RV+GG+GFVRS+L
Sbjct  1    MIFSRIGRSLCRSARSSTFQKNVVAGDYNARADLLIEPIFPTTPCISRVDGGVGFVRSFL  60

Query  277  TSVGAGKGIIN-RAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  453
            TS GAGK +++     S+ +SI  NPR R+    Q+PKK  YENYYPKNKKEIPK N QK
Sbjct  61   TSAGAGKQLVSLNKCSSNFNSIVANPRARKFCSGQSPKKSKYENYYPKNKKEIPKANEQK  120

Query  454  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISC  633
            SES  +  +         NF +Q+ N ++ LL  GFVLSS++LSP+ Q EISFQ  K   
Sbjct  121  SESKGDSGAG------DQNFTRQFSNFLSHLLLFGFVLSSVLLSPKQQKEISFQEFKNKL  174

Query  634  L  636
            L
Sbjct  175  L  175



>ref|XP_011007150.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Populus euphratica]
Length=815

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 122/185 (66%), Gaps = 12/185 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGG---YGVRTKVLDELAAQSTCIARVEG----GIGF  261
            M+LSRI RS+S+S+ ST+ R +I+        RT ++DEL ++    A +E     G+G 
Sbjct  1    MILSRIGRSLSRSARSTLQRNVITKSNYLLNARTVLVDELTSR---FAALESNGLRGLGI  57

Query  262  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  441
            VR Y+   GAGK I++   LS+++SI  NPR+RR FCS+APKK+ YENYYPK+KKEIPK 
Sbjct  58   VRGYVWYSGAGKQIVSSTQLSNLNSILANPRVRRFFCSEAPKKRKYENYYPKDKKEIPKA  117

Query  442  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXX  621
            N  KSES +EDS     G  Q N LKQ+QN+IT LLF+ FV SSM  + + Q +ISFQ  
Sbjct  118  NESKSES-KEDSGGAGGGDSQ-NTLKQFQNIITPLLFLAFVYSSMFFNTQEQKQISFQEF  175

Query  622  KISCL  636
            K   L
Sbjct  176  KNKLL  180



>gb|EYU41737.1| hypothetical protein MIMGU_mgv1a001461mg [Erythranthe guttata]
Length=815

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 117/178 (66%), Gaps = 4/178 (2%)
 Frame = +1

Query  106  MLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSV  285
            MLSRI R +++SS +++N+G   G YGVR+ +L E    +       GG+G +RSYLTS+
Sbjct  1    MLSRIGRCLNQSSRASLNKGGFPGSYGVRSAILTEFYTGNALTKSENGGLGLLRSYLTSI  60

Query  286  GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESG  465
            GA K +     L +  S+  +PRLRRLFCSQAPKKK+YE YY KNK EIPK NNQKSE G
Sbjct  61   GACKQVTKSHVLEEFHSVMASPRLRRLFCSQAPKKKSYEKYYVKNKSEIPKGNNQKSE-G  119

Query  466  REDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSP-RTQNEISFQXXKISCL  636
            +E+S SG Q +  +  + Q+ N +T LL +GFVL SM ++P   Q +ISFQ  K   L
Sbjct  120  KEESGSGGQWNKTETTI-QF-NFLTPLLLLGFVLMSMYMTPGGDQKQISFQEFKNKLL  175



>ref|XP_009345397.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVL-DELAAQSTCI--ARVEGGIGFVRSY  273
            M+ S I RS+++S+ S   R +ISG Y  R+ +L D     ST +  A V+ G+G +R Y
Sbjct  1    MIFSSIGRSITRSARSKFKRNVISGTYNRRSTLLHDSFPQLSTLLGNACVDCGVGILRRY  60

Query  274  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  453
            +   GAGK +I++AY+S+V S+F  PR+RRLF SQ P+KKNYENYYPKNKKEIPK   QK
Sbjct  61   IADNGAGKQLISKAYMSNVKSVFGIPRIRRLFSSQGPEKKNYENYYPKNKKEIPKGGEQK  120

Query  454  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISC  633
            +ES +E SS+G QG+ Q  F KQ Q+LI  L+FI F+++S+ L+P    EISFQ  K   
Sbjct  121  TES-KEGSSAGGQGNAQGQFSKQIQDLIAPLMFICFIVTSLFLNPHQAKEISFQEFKNKL  179

Query  634  L  636
            L
Sbjct  180  L  180



>ref|XP_009338598.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009338599.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 121/181 (67%), Gaps = 4/181 (2%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVL-DELAAQSTCI--ARVEGGIGFVRSY  273
            M+ S I RS++ S+ S   R +ISG Y  R  +L D     ST +  A V+ G+G +R Y
Sbjct  1    MIFSSIGRSITHSARSKFKRNVISGTYNRRNTLLPDSFPQLSTLLGNACVDCGVGILRGY  60

Query  274  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  453
            +   GAGK +I++AY+S+V S+F  PR+RRLF SQ P+KKNYENYYPKNKKEIPK   QK
Sbjct  61   IADNGAGKQLISKAYMSNVKSVFGIPRIRRLFSSQGPEKKNYENYYPKNKKEIPKGGEQK  120

Query  454  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISC  633
            +ES +E SS+G QG+ Q  F KQ Q+LI  L+FI F+++S+ L+P    EISFQ  K   
Sbjct  121  TES-KEGSSAGGQGNAQGQFSKQIQDLIAPLMFICFIVTSLFLNPHQAKEISFQEFKNKL  179

Query  634  L  636
            L
Sbjct  180  L  180



>ref|XP_008240759.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Prunus mume]
Length=816

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 120/179 (67%), Gaps = 3/179 (2%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE-LAAQSTCIARVEGGIGFVRSYLT  279
            M+ S I RS+S S+ S   R +ISG Y  RT  L E +   + CI+ V+G +G +R YLT
Sbjct  1    MVFSSIGRSLSHSARSKFKRNVISGTYNGRTTFLHETVPLGNACISGVDGELGLLRGYLT  60

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
              GAGK +++  YLS+  S  TNPR+RR F SQ  +KKNYENYYPKNKKEIPK + QKS 
Sbjct  61   YNGAGKQLVSNTYLSNFKSFLTNPRIRRFFSSQGHEKKNYENYYPKNKKEIPKGDGQKSG  120

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            S +  S++G QG+P++ F+  +Q +I  ++F+GFV +S++L+P+   EISFQ  K   L
Sbjct  121  S-KGGSNAGDQGNPRELFIPWHQ-IIGPIMFLGFVFTSLLLNPQQAKEISFQEFKNKLL  177



>ref|XP_008369915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=815

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 120/181 (66%), Gaps = 4/181 (2%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVL-DELAAQSTCIAR--VEGGIGFVRSY  273
            M+ S I R ++ S+ S   R +ISG Y  R  +L D     ST +    V+GG+G ++ Y
Sbjct  1    MIFSSIGRWITHSARSKFKRNVISGTYNRRNTLLHDSFPQLSTLLGNECVDGGVGILKGY  60

Query  274  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  453
            +   GAGK +I++AY+S+V S+F  PR+RRLF SQ P+KKNYENYYPKNKKEIPK   QK
Sbjct  61   IAYNGAGKRLISKAYMSNVKSVFGIPRIRRLFSSQGPEKKNYENYYPKNKKEIPKGGEQK  120

Query  454  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISC  633
            +ES +E SS+G QG+ Q  F KQ Q+L+  L+FI F+++S+ L+P    EISFQ  K   
Sbjct  121  TES-KEGSSAGGQGNAQGQFSKQIQDLLAPLMFICFIVTSLFLNPHQAKEISFQEFKNKL  179

Query  634  L  636
            L
Sbjct  180  L  180



>ref|XP_007026989.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOY07491.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=817

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 111/183 (61%), Gaps = 13/183 (7%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPST-----VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVR  267
            M+ SRI R+VS+SS S      ++R L+S    V T V       + CI+RV  G+G VR
Sbjct  1    MIFSRIGRTVSRSSRSAFRTNVISRNLLSNESHVSTPV------GNACISRVNQGLGIVR  54

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             Y    G GK +++ A LS++DSI  NPR+RR F S+  KK  YENYYPKNKKEIPK N 
Sbjct  55   GYFAPAGTGKHLVSNARLSNLDSILANPRIRRFFSSEGSKKSRYENYYPKNKKEIPKANE  114

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QKS+S +EDS +G  G+ Q N  K  QN+IT LL  G + +S+   P  Q +ISFQ  K 
Sbjct  115  QKSQS-KEDSGAGDPGNSQ-NIAKLMQNVITPLLLFGILYTSIFSGPHEQKQISFQEFKN  172

Query  628  SCL  636
              L
Sbjct  173  KLL  175



>ref|XP_007026990.1| Cell division protease ftsH isoform 2 [Theobroma cacao]
 gb|EOY07492.1| Cell division protease ftsH isoform 2 [Theobroma cacao]
Length=637

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 110/179 (61%), Gaps = 13/179 (7%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPST-----VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVR  267
            M+ SRI R+VS+SS S      ++R L+S    V T V       + CI+RV  G+G VR
Sbjct  1    MIFSRIGRTVSRSSRSAFRTNVISRNLLSNESHVSTPV------GNACISRVNQGLGIVR  54

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             Y    G GK +++ A LS++DSI  NPR+RR F S+  KK  YENYYPKNKKEIPK N 
Sbjct  55   GYFAPAGTGKHLVSNARLSNLDSILANPRIRRFFSSEGSKKSRYENYYPKNKKEIPKANE  114

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            QKS+S +EDS +G  G+ Q N  K  QN+IT LL  G + +S+   P  Q +ISFQ  K
Sbjct  115  QKSQS-KEDSGAGDPGNSQ-NIAKLMQNVITPLLLFGILYTSIFSGPHEQKQISFQEFK  171



>ref|XP_009416148.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=809

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 111/179 (62%), Gaps = 2/179 (1%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIAR-VEGGIGFVRSYLT  279
            M  S + RS+ +S+ S   +G +SGGYG R  +  E+  Q  CI R +  G+G +R Y T
Sbjct  1    MNFSGLGRSLLRSARSRSPKGALSGGYGARPVISSEVLLQKPCIGRDITAGVGLLRGYFT  60

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
            SVGA K I   ++LS    +  NP  RR F S +PKKKNYENYYP++KKEIPK ++ KS+
Sbjct  61   SVGANKAIGVGSHLSHWRFLLANPNFRRFFSSGSPKKKNYENYYPRDKKEIPKDSSNKSD  120

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            S + DSS+   G+ Q+NF+KQ QN I  L+FIG +LSS       Q EISFQ  +   L
Sbjct  121  S-KGDSSTEDHGNFQENFMKQLQNYIAPLIFIGLLLSSFSAGTSDQKEISFQEFRNKLL  178



>ref|XP_008777193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=822

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 106/178 (60%), Gaps = 0/178 (0%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M  S + RS+ +S+ S   R  + GG+G R+ VL+E   QS C     GG+ F+R YLTS
Sbjct  1    MSFSSLGRSLVRSARSRSQRAALLGGFGARSGVLNETLLQSPCFRGGNGGLEFLRGYLTS  60

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            +GA K +     L D   +  NP  +R F S++P+KKNYENYYPKNKKEIPK +      
Sbjct  61   IGASKAVGAGNRLCDWRFLLANPSFKRFFSSESPRKKNYENYYPKNKKEIPKGDGNNKSD  120

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
             +EDSS+   G+ Q+NF+KQ Q+ +  L+FIG +LSS       Q EISFQ  +   L
Sbjct  121  SKEDSSADDHGNFQENFMKQLQSFLAPLIFIGLLLSSFSTGSFDQKEISFQEFRNKLL  178



>ref|XP_010043509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW85526.1| hypothetical protein EUGRSUZ_B02323 [Eucalyptus grandis]
Length=816

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 4/128 (3%)
 Frame = +1

Query  241  VEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypkn  420
            ++G +GFVR YL S GA KG   ++YLSD++ +  NPR+ R F S+APKKKNYENY PK 
Sbjct  47   LDGKLGFVREYLASAGAIKGFSAKSYLSDLNRVLANPRVHRFFSSEAPKKKNYENYCPKG  106

Query  421  kkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQN  600
            +KE+PK N QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    PR Q 
Sbjct  107  RKEVPKGNEQKSESKGDSNTDDN----QETFMKQFQNLITPLIVIGLFLSSFSFGPREQQ  162

Query  601  EISFQXXK  624
            +ISFQ  K
Sbjct  163  QISFQEFK  170



>ref|XP_004143122.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004163225.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 10, mitochondrial-like [Cucumis sativus]
 gb|KGN47136.1| hypothetical protein Csa_6G190270 [Cucumis sativus]
Length=818

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQ--STCIARVEGGIGFVRS  270
            M+ SR+ RS+ +SS +   + L  GG     K ++E   AA    +C+   +G +GF+R 
Sbjct  1    MIFSRLTRSLPRSSRT---QNLFYGGGRSAIKTINEPIFAAPRVDSCVGERDGMLGFLRG  57

Query  271  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ  450
            Y    G+   +I +  LSD + +  NP+LRR F S+APKKKNY+N+YPK KKEIPK N Q
Sbjct  58   YFAFSGSRTKLIPKEILSDFNFLIANPKLRRFFSSEAPKKKNYQNFYPKEKKEIPKGNEQ  117

Query  451  KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            KSES + DS++  QGS Q+ F+KQ+QN++T L+ IG + SS    PR Q +ISFQ  K
Sbjct  118  KSES-KGDSNTEDQGSFQEAFIKQFQNIVTPLIVIGLLFSSFSFGPREQQQISFQEFK  174



>ref|XP_010256889.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=820

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 115/182 (63%), Gaps = 8/182 (4%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGG----IGFVRS  270
            M+ S++ RS+S+S+ S   R  + G YG R+  L+E   +S       GG    +G +R 
Sbjct  1    MIFSKLGRSLSRSAAS---RNGLLGAYGRRSAFLNESLLRSPHGDAFPGGEHSRLGSLRC  57

Query  271  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ  450
            YL S+G  K   ++ Y  D +++  +PRL R F ++APKKKNYEN+YPKNKKEIPK NNQ
Sbjct  58   YLISIGTNKEFASKRYSLDFNALLASPRLHRFFSNEAPKKKNYENFYPKNKKEIPKGNNQ  117

Query  451  KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKIS  630
            K+ES +E+S++  QG+ Q+NF+KQ QN +T L+FI  VLSS       Q +ISFQ  K  
Sbjct  118  KTES-KEESNTENQGNFQENFMKQLQNYLTPLMFIALVLSSFSFGSHDQKQISFQEFKNK  176

Query  631  CL  636
             L
Sbjct  177  LL  178



>ref|XP_010521865.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=809

 Score =   101 bits (251),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 77/176 (44%), Positives = 111/176 (63%), Gaps = 15/176 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQS-----TCIARVEGGIGFVR  267
            M+ S++ARS ++SSPS   RG +  G GVR+ +L+E+  Q        + +V+GG+ F+R
Sbjct  1    MIFSKLARSAARSSPS---RGSLYSG-GVRSAILNEVKLQQLPGLEVAVNQVDGGLVFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
                S+ + KG+I     SD+  +  NPR+RRLF S+APKKKNYENYY K  K+ PK N 
Sbjct  57   QQFASLASRKGLIT----SDLSGVLANPRIRRLFSSEAPKKKNYENYYAKEAKQTPK-NE  111

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQ  615
            QKSES +EDS   +  +  D F+K++QN++  LL IG +LSS       + +ISFQ
Sbjct  112  QKSES-KEDSKKTEHENFGDMFMKKFQNMLIPLLAIGLILSSFSFDSVERQKISFQ  166



>ref|XP_008464106.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Cucumis melo]
Length=818

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +1

Query  226  TCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyen  405
            +C+A  EG +GF R Y   VG+    I +  LSD++ +  NP+LRR F S+APKKKNY+N
Sbjct  43   SCVAEREGLLGFFRGYFAFVGSRTKFIPKETLSDLNFLIANPKLRRFFSSEAPKKKNYQN  102

Query  406  yypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS  585
            +YPK KKEIPK N QKSES + DS++  QGS Q+ F+KQ+QNL+T L+ IG + SS    
Sbjct  103  FYPKEKKEIPKGNEQKSES-KGDSNTEDQGSFQEAFIKQFQNLVTPLIVIGLLFSSFSFG  161

Query  586  PRTQNEISFQXXK  624
            PR Q +ISFQ  K
Sbjct  162  PREQQQISFQEFK  174



>ref|XP_010685724.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=819

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 102/160 (64%), Gaps = 9/160 (6%)
 Frame = +1

Query  160  RGLISGGYGVRTKVLDELAAQSTCIA----RVEGGIGFVRSYLTSVGAGKGIINRAYLSD  327
            R LI+G Y  R  +LDE   +++ +     + +  +GF+RSYL S+GA     N+ YLSD
Sbjct  17   RNLINGCYKGRPVLLDESLLRASYVNSSANQFDSNLGFLRSYLGSIGAQ----NKDYLSD  72

Query  328  VDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsP-Q  504
            V     NP   R F S+APKKKNYEN+YPK KKEIPKT+ QKSES  E +S+ +     Q
Sbjct  73   VKYALANPGFCRFFSSEAPKKKNYENFYPKEKKEIPKTDEQKSESKEESNSNTEDQGNFQ  132

Query  505  DNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            + F+KQ+Q+L+T LL IG  LS+   SPR Q +ISFQ  K
Sbjct  133  ETFMKQFQSLLTPLLMIGLFLSTFSFSPREQQQISFQEFK  172



>ref|XP_011089809.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Sesamum indicum]
Length=826

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 113/185 (61%), Gaps = 11/185 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE-------LAAQSTCIARVEGGIGF  261
            M+ SRI  S+++SS    N   I+G    R+   ++       + + S  + + EG +GF
Sbjct  1    MIFSRIRTSLTRSSRFRNN---INGASKGRSFAWNKENIGSPNVNSTSGSVNQFEGNLGF  57

Query  262  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  441
            +R YLTSVG GKG + R YLSD      NPR+RR + S+APKKKNYEN+YPK+KKE P  
Sbjct  58   LRGYLTSVGGGKGSVPRGYLSDFSYFAANPRIRRFYSSEAPKKKNYENFYPKDKKENPNK  117

Query  442  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXX  621
            N+QKS S +E+ ++   G+  + F+K  QN++T LL IG  LS+   SPR + +ISFQ  
Sbjct  118  NDQKSGS-KEEGNTDDHGNFHETFIKNLQNIVTPLLVIGLFLSAFSSSPREEKQISFQEF  176

Query  622  KISCL  636
            K   L
Sbjct  177  KNKLL  181



>ref|XP_010920548.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Elaeis guineensis]
Length=819

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 107/178 (60%), Gaps = 0/178 (0%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+ SR+ +S+S+SS S    G   GG  VR+    E   QS       GG+GF+RSYLTS
Sbjct  1    MIFSRLGQSLSRSSRSLYEAGAFLGGSVVRSGCSKEAVLQSPSFRGGSGGLGFLRSYLTS  60

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            +GA K I  + Y +D   +  NP  RRLF S++P KKNYENY+PK++KEIPK N      
Sbjct  61   IGANKAIGAKKYQADWRFLLANPSFRRLFSSESPDKKNYENYHPKDRKEIPKGNENNKSD  120

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
             +E+S++  Q + Q+NF+KQ Q+ +  +LF+G +LSS       Q EISFQ  K   L
Sbjct  121  SKENSNTEDQANFQENFMKQLQSYLAPILFMGLLLSSFSFGSFDQKEISFQEFKNKLL  178



>ref|XP_010931243.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=821

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 106/178 (60%), Gaps = 0/178 (0%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M  S + RS+ +S+ S   R  + GG+G R++VL+E   QS C     GG+ F+R YLTS
Sbjct  1    MNFSSLGRSLVRSARSRSQRVALLGGFGARSRVLNETLLQSPCFRGDNGGLEFLRGYLTS  60

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            +GA K +     L D   +  NP  +R F S++P+KKNYENYYPKNKKE PK +      
Sbjct  61   IGASKAVGAGNRLYDWRFLLANPSFKRFFSSESPRKKNYENYYPKNKKENPKGDGNNKSD  120

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
             +E+S++   G+ Q+NF+KQ Q+ +  L+FIG +LSS       Q EISFQ  +   L
Sbjct  121  SKENSNADDHGNFQENFMKQLQSFLAPLIFIGLLLSSFSTGSFDQKEISFQEFRNKLL  178



>ref|XP_010043511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Eucalyptus grandis]
Length=847

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  259  FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPK  438
            FVR YL S GA KG   ++YLSD++ +  NPR+ R F S+APKKKNYENYYPK +KE+PK
Sbjct  84   FVREYLASAGAIKGFSAKSYLSDLNRVLANPRVHRFFSSEAPKKKNYENYYPKGRKEVPK  143

Query  439  TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQX  618
             N QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    PR Q +ISFQ 
Sbjct  144  GNEQKSESKGDSNTDDN----QETFMKQFQNLITPLVVIGLFLSSFSFGPREQQQISFQE  199

Query  619  XKISCL  636
             K   L
Sbjct  200  FKNKLL  205



>gb|KCW85528.1| hypothetical protein EUGRSUZ_B02325 [Eucalyptus grandis]
Length=816

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 83/122 (68%), Gaps = 4/122 (3%)
 Frame = +1

Query  259  FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPK  438
            FVR YL S GA KG   ++YLSD++ +  NPR+ R F S+APKKKNYENYYPK +KE+PK
Sbjct  53   FVREYLASAGAIKGFSAKSYLSDLNRVLANPRVHRFFSSEAPKKKNYENYYPKGRKEVPK  112

Query  439  TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQX  618
             N QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    PR Q +ISFQ 
Sbjct  113  GNEQKSESKGDSNTDDN----QETFMKQFQNLITPLVVIGLFLSSFSFGPREQQQISFQE  168

Query  619  XK  624
             K
Sbjct  169  FK  170



>gb|KJB55847.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=785

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  402
            S  + R+ G  G++R YL S+GAGK   ++AYLSD++ +  NPR+RR F S+APKKKNYE
Sbjct  39   SGSVDRIIGQSGYLRGYLASIGAGKEFTSKAYLSDLNFVLANPRIRRFFSSEAPKKKNYE  98

Query  403  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  582
            N+YPK KKEIPK N+QK +S +EDS +  Q + Q+ FLK +QNL+T LL +   LS   +
Sbjct  99   NFYPKEKKEIPKQNDQKPDS-KEDSKTDDQWNFQETFLKLFQNLVTPLLVLALFLS---M  154

Query  583  SPRT--QNEISFQXXK  624
            SP T  Q +ISFQ  K
Sbjct  155  SPWTVEQQQISFQEFK  170



>gb|KJB55846.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=816

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  402
            S  + R+ G  G++R YL S+GAGK   ++AYLSD++ +  NPR+RR F S+APKKKNYE
Sbjct  40   SGSVDRIIGQSGYLRGYLASIGAGKEFTSKAYLSDLNFVLANPRIRRFFSSEAPKKKNYE  99

Query  403  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  582
            N+YPK KKEIPK N+QK +S +EDS +  Q + Q+ FLK +QNL+T LL +   LS   +
Sbjct  100  NFYPKEKKEIPKQNDQKPDS-KEDSKTDDQWNFQETFLKLFQNLVTPLLVLALFLS---M  155

Query  583  SPRT--QNEISFQXXK  624
            SP T  Q +ISFQ  K
Sbjct  156  SPWTVEQQQISFQEFK  171



>ref|XP_010931244.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=816

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 102/178 (57%), Gaps = 5/178 (3%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M  S + RS+ +S+ S   R  + GG+G R++VL+E   QS C     GG+ F+R YLTS
Sbjct  1    MNFSSLGRSLVRSARSRSQRVALLGGFGARSRVLNETLLQSPCFRGDNGGLEFLRGYLTS  60

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            +GA K +     L D   +  NP  +R F S++P+KKNYENYYPKNKKE PK +      
Sbjct  61   IGASKAVGAGNRLYDWRFLLANPSFKRFFSSESPRKKNYENYYPKNKKENPKGDGNNKSD  120

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
             ++D  +      Q+NF+KQ Q+ +  L+FIG +LSS       Q EISFQ  +   L
Sbjct  121  SKDDHGNF-----QENFMKQLQSFLAPLIFIGLLLSSFSTGSFDQKEISFQEFRNKLL  173



>gb|KCW85527.1| hypothetical protein EUGRSUZ_B02324 [Eucalyptus grandis]
Length=799

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = +1

Query  241  VEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypkn  420
            ++G +GFVR YL S GA K    ++YLS ++ +  NPR+ R F S+ PKKKNYEN+YPK 
Sbjct  33   LDGKLGFVREYLASAGAIKAFSAKSYLSHLNRVLANPRVHRFFSSEVPKKKNYENFYPKG  92

Query  421  kkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQN  600
            +KE+PK + QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    PR Q 
Sbjct  93   RKEVPKGDKQKSESKGDSNTDDN----QETFMKQFQNLITPLVVIGLFLSSFSFGPREQQ  148

Query  601  EISFQXXK  624
            +ISFQ  K
Sbjct  149  QISFQEFK  156



>ref|XP_007208082.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
 gb|EMJ09281.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
Length=808

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 115/178 (65%), Gaps = 9/178 (5%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+ S I RS+S S+ S   R +IS     +T  L+  +   +C   V+G +G +R YLT 
Sbjct  1    MVFSSIGRSLSHSARSKFKRVIIS----QKTLFLNLFSKFISC---VDGELGLLRGYLTY  53

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
             GAGK +++  YLS+  S   NPR+RR F S+  +KKNYENYYPKNKKEIPK + QKS S
Sbjct  54   NGAGKQLVSNTYLSNFKSFLANPRIRRFFSSRGHEKKNYENYYPKNKKEIPKGDGQKSGS  113

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
             +E S++G QG+P++ F+  +Q +I  ++F GFV +S++L+P+   EISFQ  K   L
Sbjct  114  -KEGSNAGDQGNPREFFIPWHQ-IIGPIMFFGFVFTSVLLNPQQAKEISFQEFKNKLL  169



>ref|XP_010043510.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
Length=813

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = +1

Query  241  VEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypkn  420
            ++G +GFVR YL S GA K    ++YLS ++ +  NPR+ R F S+ PKKKNYEN+YPK 
Sbjct  47   LDGKLGFVREYLASAGAIKAFSAKSYLSHLNRVLANPRVHRFFSSEVPKKKNYENFYPKG  106

Query  421  kkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQN  600
            +KE+PK + QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    PR Q 
Sbjct  107  RKEVPKGDKQKSESKGDSNTDDN----QETFMKQFQNLITPLVVIGLFLSSFSFGPREQQ  162

Query  601  EISFQXXK  624
            +ISFQ  K
Sbjct  163  QISFQEFK  170



>ref|XP_010475511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Camelina sativa]
Length=815

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 114/184 (62%), Gaps = 14/184 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  267
            M+ S++  S+++SS S   +G + GG GVR+ +L E  L A S   A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGFVYGG-GVRSAILSEGRLRAPSNLEAAANQVNGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S+ A KG+ +R+   D+  +F NP LRR F SQ PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASLAARKGV-DRS--GDLSRVFANPSLRRFFSSQTPKKKNYENYYPKDTKQAPK-NE  112

Query  448  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            QKSES G E S   +  +  D F K++QN++  L+ I F+LS+  L  R Q +ISFQ  K
Sbjct  113  QKSESRGEEGSKKAKNENVGDMFTKEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFK  172

Query  625  ISCL  636
               L
Sbjct  173  NKLL  176



>ref|XP_010475512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Camelina sativa]
Length=813

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 114/183 (62%), Gaps = 14/183 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  267
            M+ S++  S+++SS S   +G + GG GVR+ +L E  L A S   A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGFVYGG-GVRSAILSEGRLRAPSNLEAAANQVNGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S+ A KG+ +R+   D+  +F NP LRR F SQ PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASLAARKGV-DRS--GDLSRVFANPSLRRFFSSQTPKKKNYENYYPKDTKQAPK-NE  112

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QKSES RE S   +  +  D F K++QN++  L+ I F+LS+  L  R Q +ISFQ  K 
Sbjct  113  QKSES-REGSKKAKNENVGDMFTKEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFKN  171

Query  628  SCL  636
              L
Sbjct  172  KLL  174



>gb|KFK43073.1| hypothetical protein AALP_AA1G075200 [Arabis alpina]
Length=814

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQST-CIARVEGGIGFVRSYLT  279
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E   Q+T  +   +GG+GF+R +  
Sbjct  1    MIFSKLGSSLARSSRS---KGLLYGG-GVRSAILSEGRFQTTPSLEAADGGLGFLRRHFA  56

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
            S+ + KG+ +     D+  +F NPRLRRLFCS+ PKKKNYENYYPK+ K+ PK N QKSE
Sbjct  57   SLVSRKGLDS----GDLSRVFVNPRLRRLFCSETPKKKNYENYYPKDAKQTPK-NEQKSE  111

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            SG E S   +  +  D F K++ N++  ++ I  +LSS  L  R Q EISFQ  K   L
Sbjct  112  SG-EGSKKSENENVGDMFTKEFHNILIPVVAIVLILSSFGLGSREQQEISFQEFKNKLL  169



>gb|KHG20351.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=816

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 112/178 (63%), Gaps = 11/178 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLI--SGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYL  276
            M+ S++ RS  +SS S   R L+   GG  +       L   S  + R+ G  G++R YL
Sbjct  1    MIFSKLGRSAPRSSHS---RKLLYRGGGGAITGGTSPSLPLLSGSVDRIIGQSGYLRGYL  57

Query  277  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
              +GAGK   ++AYLSD++ +  NPR+RR F S+APKKKNYEN+YPK KKEIPK N+QK 
Sbjct  58   ALIGAGKEFTSKAYLSDLNFVLANPRIRRFFSSEAPKKKNYENFYPKEKKEIPKQNDQKP  117

Query  457  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRT--QNEISFQXXK  624
            +S +EDS +  Q + Q+ FLK +QNL+T LL +   LS   +SP T  Q +ISFQ  K
Sbjct  118  DS-KEDSKTDDQWNFQETFLKLFQNLVTPLLVLALFLS---MSPWTVEQQQISFQEFK  171



>gb|KJB16964.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=817

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  402
            +TCI+RV  G+G VR Y    G GK +     LS++DSI  NPR+RR FCS+ PKK+NYE
Sbjct  40   NTCISRVNKGLGLVRGYFAPAGVGKQLSTNTRLSNLDSILANPRIRRFFCSEGPKKRNYE  99

Query  403  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  582
            NY+PKNKK+IPK N QKS S +EDS +G+ G+ Q N  +  QN++T+LL +G   SS+  
Sbjct  100  NYFPKNKKDIPKANEQKSGS-KEDSGAGEPGNSQ-NIQRLVQNIVTTLLLVGITYSSLS-  156

Query  583  SPRTQNEISFQXXKISCL  636
             P  Q EISFQ  K   L
Sbjct  157  GPHEQQEISFQEFKNKLL  174



>gb|KJB16965.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=782

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  402
            +TCI+RV  G+G VR Y    G GK +     LS++DSI  NPR+RR FCS+ PKK+NYE
Sbjct  40   NTCISRVNKGLGLVRGYFAPAGVGKQLSTNTRLSNLDSILANPRIRRFFCSEGPKKRNYE  99

Query  403  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  582
            NY+PKNKK+IPK N QKS S +EDS +G+ G+ Q N  +  QN++T+LL +G   SS+  
Sbjct  100  NYFPKNKKDIPKANEQKSGS-KEDSGAGEPGNSQ-NIQRLVQNIVTTLLLVGITYSSLS-  156

Query  583  SPRTQNEISFQXXKISCL  636
             P  Q EISFQ  K   L
Sbjct  157  GPHEQQEISFQEFKNKLL  174



>ref|XP_007016370.1| FTSH protease 10 [Theobroma cacao]
 gb|EOY33989.1| FTSH protease 10 [Theobroma cacao]
Length=813

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  253  IGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeI  432
            +GF+R YLTS+GA K   ++AYLSD++ +  NPR+ R F S+APKKKNYEN++PK KKEI
Sbjct  47   LGFLRGYLTSIGAPKEFNSKAYLSDLNFVLANPRISRFFSSEAPKKKNYENFHPKEKKEI  106

Query  433  PKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISF  612
            PK N+QKS+S +E+S++  QG+ Q+ FLK +QNLI+ LL I  +LS   LS   Q +ISF
Sbjct  107  PKQNDQKSDS-KENSNTDDQGNFQEMFLKLFQNLISPLLVIALLLSYSPLSASEQQQISF  165

Query  613  QXXKISCL  636
            Q  K   L
Sbjct  166  QEFKNKLL  173



>gb|KHG12964.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=817

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  402
            +TCI+R+  G+G V+ Y    G GK +     LS++DSI  NPR+RR FCS+ PKK+NYE
Sbjct  40   NTCISRINKGLGLVKGYFAPAGVGKQLSTNTPLSNLDSILANPRIRRFFCSEGPKKRNYE  99

Query  403  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  582
            NY+PKNKK+IPK N QKS S +EDS +G+ G+ Q N  +  QN++T+LL IG   SS+  
Sbjct  100  NYFPKNKKDIPKANEQKSGS-KEDSGAGEPGNSQ-NIQRLVQNIVTTLLLIGITYSSLS-  156

Query  583  SPRTQNEISFQXXKISCL  636
             P  Q EISFQ  K   L
Sbjct  157  GPHEQQEISFQEFKNKLL  174



>ref|XP_010262544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=821

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 113/184 (61%), Gaps = 10/184 (5%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQS-----TCIARVEGGIGFVR  267
            M+ S++ RS+S+S+ S   R    G YG R  +L++   +S     +C+      +G +R
Sbjct  1    MIFSKLRRSLSRSAGS---RNGYLGAYGRRFALLNDSLLRSPPHRDSCLGGEHSRLGSLR  57

Query  268  SYLTSVGAGKGIINRAYLS-DVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN  444
             YL S GA K   ++   S D + +  NPR  R F ++ PKKKNYEN+YPK+KKEIPK N
Sbjct  58   GYLASFGANKEFGSKRSSSLDFNFLLANPRFHRFFSNEVPKKKNYENFYPKDKKEIPKGN  117

Query  445  NQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            NQK+ES +E+S++  QG+ Q+NF+KQ QN +T L+FI  +LSS    P  Q +ISFQ  K
Sbjct  118  NQKTES-KEESNTEDQGNFQENFMKQLQNYLTPLIFIALLLSSFSFGPHDQKQISFQEFK  176

Query  625  ISCL  636
               L
Sbjct  177  NKLL  180



>ref|XP_010487550.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=670

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 112/184 (61%), Gaps = 14/184 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  267
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E  L A     A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGLVYGG-GVRSAILSEGRLRAPPNLEAAANQVSGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S+ A KG+       D+  +F NPRLRR F SQ PKKKN+ENYYPK++K+ PK N 
Sbjct  57   RHFASLAARKGLDAGG---DLSRVFANPRLRRFFSSQTPKKKNFENYYPKDRKQAPK-NE  112

Query  448  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            QKSES G E S   +  +  D F  ++QN++  L+ I F+LS+  L  R Q +ISFQ  K
Sbjct  113  QKSESRGEEGSKKTENENVGDMFTIEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFK  172

Query  625  ISCL  636
               L
Sbjct  173  NKLL  176



>ref|XP_010487557.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Camelina sativa]
Length=815

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 112/184 (61%), Gaps = 14/184 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  267
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E  L A     A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGLVYGG-GVRSAILSEGRLRAPPNLEAAANQVSGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S+ A KG+       D+  +F NPRLRR F SQ PKKKN+ENYYPK++K+ PK N 
Sbjct  57   RHFASLAARKGLDAGG---DLSRVFANPRLRRFFSSQTPKKKNFENYYPKDRKQAPK-NE  112

Query  448  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            QKSES G E S   +  +  D F  ++QN++  L+ I F+LS+  L  R Q +ISFQ  K
Sbjct  113  QKSESRGEEGSKKTENENVGDMFTIEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFK  172

Query  625  ISCL  636
               L
Sbjct  173  NKLL  176



>ref|XP_010487541.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=815

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 112/184 (61%), Gaps = 14/184 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  267
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E  L A     A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGLVYGG-GVRSAILSEGRLRAPPNLEAAANQVSGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S+ A KG+       D+  +F NPRLRR F SQ PKKKN+ENYYPK++K+ PK N 
Sbjct  57   RHFASLAARKGLDAGG---DLSRVFANPRLRRFFSSQTPKKKNFENYYPKDRKQAPK-NE  112

Query  448  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            QKSES G E S   +  +  D F  ++QN++  L+ I F+LS+  L  R Q +ISFQ  K
Sbjct  113  QKSESRGEEGSKKTENENVGDMFTIEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFK  172

Query  625  ISCL  636
               L
Sbjct  173  NKLL  176



>ref|XP_008784613.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=817

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 94/158 (59%), Gaps = 0/158 (0%)
 Frame = +1

Query  163  GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIF  342
            G   GGY VR+    E   QS       GG+GF+RSYLTSVGA K I  + Y +D   + 
Sbjct  21   GAFLGGYVVRSGCSKEALLQSPGFRGDNGGLGFMRSYLTSVGANKAIGAKNYQADWRFLL  80

Query  343  TNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQ  522
             +P  RR F S++P KKNYENY PK++KEIPK N       +++S++  QG+ Q+NF+KQ
Sbjct  81   ASPSFRRFFSSESPNKKNYENYQPKDRKEIPKGNETNKSDSKDNSNTEDQGNFQENFIKQ  140

Query  523  YQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
             Q+ +  +LF+G +LSS       Q EISFQ  K   L
Sbjct  141  LQSYLVPILFMGLLLSSFSFGSFDQKEISFQEFKNKLL  178



>ref|XP_004302718.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=812

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 82/182 (45%), Positives = 109/182 (60%), Gaps = 15/182 (8%)
 Frame = +1

Query  97   GTMMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYL  276
            G  +LSR ARS  + +   VN    +G    R +    LA      A +  G+G +RSYL
Sbjct  6    GGRLLSRSARSAFQKNLILVNN---NGNAAFRHQPPTPLAGN----AGITDGLGLLRSYL  58

Query  277  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
            T  GAGK +++  YLS++ S   NPR+RRLF S+ P KKNYENYYPK+KK IPK   +  
Sbjct  59   TYHGAGKQLVSNTYLSNLKSAIANPRMRRLFSSERPGKKNYENYYPKDKKGIPKGGQK--  116

Query  457  ESGREDsssgqqgsPQDNFLK--QYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKIS  630
             SG +D +  Q    QD+FLK  Q Q+LI  LLF+GFVL S++  P+ Q +ISFQ  K +
Sbjct  117  -SGSKDGAGDQGSK-QDHFLKQIQIQDLIAPLLFVGFVLISLL--PQQQKQISFQEFKNT  172

Query  631  CL  636
             L
Sbjct  173  LL  174



>ref|XP_002889652.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65911.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
Length=813

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 114/183 (62%), Gaps = 15/183 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQS--TCIARVEGGIGFVR  267
            M+ S++  S+++SS S   +GL+ GG GVR+ +L++    A Q+    + +V+GG+GF+R
Sbjct  1    MIFSKLGSSLARSSRS---KGLVYGG-GVRSAILNQGRLRAPQNLEAAVNQVDGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S+ A KG+       D+  +F NPRLRR F SQ+PKK+NYENYYPK+ K+ PK N 
Sbjct  57   RHFASLAARKGLDT----GDLSRVFANPRLRRFFSSQSPKKRNYENYYPKDSKKAPK-NE  111

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QKS+SG E S   +  +  D F K+ QN++  L+ I  +LS+  L  R Q +ISFQ  K 
Sbjct  112  QKSQSG-EGSKKNENENVGDMFTKESQNMLIPLMAIALILSTFSLGSREQQQISFQEFKN  170

Query  628  SCL  636
              L
Sbjct  171  KLL  173



>gb|KFK32242.1| hypothetical protein AALP_AA6G216200 [Arabis alpina]
Length=802

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 72/174 (41%), Positives = 109/174 (63%), Gaps = 15/174 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+ S++ RS+S+S      RGL+ GG GVR+  L  LA  +  ++ VE G+GF+R +  S
Sbjct  1    MIFSKLGRSISRS------RGLLYGG-GVRSARL--LAPPALEVSEVESGLGFLRRHFAS  51

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            + A KG++N    +D+  +F NPR+RR F  +APKKKNYENY+PK+ K+ PK+ +QKS+S
Sbjct  52   LSARKGLVN----NDLTGVFANPRIRRFFSDEAPKKKNYENYFPKDAKQTPKS-DQKSDS  106

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
             +E S   +  +  D F+ ++QNL+  LL +G   S+       Q +ISFQ  K
Sbjct  107  -KEGSEKNENENLGDMFMNRFQNLLIPLLALGVFFSTFSFGSGDQQQISFQEFK  159



>ref|XP_010106514.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
 gb|EXC10690.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
Length=817

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 70/138 (51%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = +1

Query  214  AAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkk  393
             A S    R  G +GF+R Y+ S+GA K     +  S    I  NP+ RRLF S+APKKK
Sbjct  40   GADSYLGGRGHGALGFLRGYVASIGASK-----SSASHFHYILANPQFRRLFSSEAPKKK  94

Query  394  nyenyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLS  570
            NYEN+YPK KKEIPK + QKSES  ++DS++  +GS Q+ F+KQ+QNL+T LL IG   S
Sbjct  95   NYENFYPKEKKEIPKGDEQKSESNSKDDSNTDDRGSFQEAFMKQFQNLLTPLLVIGLFFS  154

Query  571  SMVLSPRTQNEISFQXXK  624
            S    PR Q +ISFQ  K
Sbjct  155  SFSFGPREQQQISFQEFK  172



>ref|XP_002530989.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
 gb|EEF31401.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
Length=833

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 112/198 (57%), Gaps = 26/198 (13%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLI-SGGYG----VRTKVLDELAAQSTCIARVEGGIGFVR  267
            M+LSRIARS    S ST  R +I S G G     +  +L     ++ C +RV GG+G VR
Sbjct  1    MILSRIARS----SRSTFQRNVIASKGSGRILPTKESILPPTILENACNSRVHGGLGIVR  56

Query  268  SYLTSVG--------------AGKGII-NRAYLSDVDSIFTNPRLRRLFCSQApkkknye  402
             Y +S G              AGK ++ ++   S+ +SI  NPR+R  F +QAPKK++YE
Sbjct  57   DYYSSCGGVIRGYLTCSGGGGAGKQLLLSKTNFSNSNSILANPRVRLFFSTQAPKKRSYE  116

Query  403  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  582
            NY+PK KKEIPK N   S + R   +    G+PQ NF+K +QN I  LLFI F+ SS++ 
Sbjct  117  NYHPKGKKEIPKENEGNS-ANRGGGAGAGGGNPQ-NFMKPFQNFIAPLLFIAFLSSSVLF  174

Query  583  SPRTQNEISFQXXKISCL  636
              +  N+ISFQ  K   L
Sbjct  175  GAQEPNQISFQEFKTKLL  192



>emb|CDP09082.1| unnamed protein product [Coffea canephora]
Length=821

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 65/127 (51%), Positives = 83/127 (65%), Gaps = 2/127 (2%)
 Frame = +1

Query  247  GGIGFVRSYLTSVGAGKGIINRA-YLSDVDSIFTNPRLRRLFCSQApkkknyenyypknk  423
            G +G +R YL SVG   G   +A Y  D + +  NPRLRR F S+APKKK YEN+YPK+K
Sbjct  51   GKLGLLREYLASVGGKSGQFPKASYFLDFNYVIANPRLRRFFSSEAPKKKKYENFYPKDK  110

Query  424  keIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNE  603
            KE PK N QKSES +E  ++    + QD  +K  QNLIT LL +  +LSS+ +SPR Q +
Sbjct  111  KETPKENGQKSES-KEGGNADGNNNFQDTIMKLAQNLITPLLVVAIILSSLSISPREQKQ  169

Query  604  ISFQXXK  624
            ISFQ  K
Sbjct  170  ISFQEFK  176



>ref|XP_006484360.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Citrus sinensis]
Length=352

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 6/133 (5%)
 Frame = +1

Query  241  VEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyeny-ypk  417
            V+G +G +R YL ++GA     N + L D++ +  NP + R F S++PK K      YPK
Sbjct  46   VDGRLGVLRGYLAAIGAK----NESNLWDLNHVLANPGIYRFFSSESPKNKKNFENFYPK  101

Query  418  nkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQ  597
             KKEIPK + QKSES +EDS++   G+ QD F+KQ+QNLIT LL I   LSS  LSPR Q
Sbjct  102  EKKEIPKEDEQKSES-KEDSNTDDHGNFQDTFMKQFQNLITPLLVIALFLSSFSLSPREQ  160

Query  598  NEISFQXXKISCL  636
             +ISFQ  K   L
Sbjct  161  QQISFQEFKNKLL  173



>ref|XP_003539662.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 4/140 (3%)
 Frame = +1

Query  211  LAAQSTCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApk  387
            L   + C    EG +GFVR Y++S  A   G+++   L D  S+  NPR+RRLFCS+APK
Sbjct  32   LPRTNACSEGAEGVLGFVRGYVSSARARSNGLVSN--LPDFKSVAANPRIRRLFCSKAPK  89

Query  388  kknyenyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFV  564
            KKNYEN+YPK KKE+PK N++K ES    ++++   G+ Q+ F+KQ QNL+T LL +G  
Sbjct  90   KKNYENFYPKEKKEVPKGNDKKYESKDNSNANTEDSGNFQEAFMKQVQNLVTPLLLMGLF  149

Query  565  LSSMVLSPRTQNEISFQXXK  624
            L+S    PR Q +ISFQ  K
Sbjct  150  LTSFSFGPREQKQISFQEFK  169



>gb|KHN32140.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 4/140 (3%)
 Frame = +1

Query  211  LAAQSTCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApk  387
            L   + C    EG +GFVR Y++S  A   G+++   L D  S+  NPR+RRLFCS+APK
Sbjct  32   LPRTNACSEGAEGVLGFVRGYVSSARARSNGLVSN--LPDFKSVAANPRIRRLFCSKAPK  89

Query  388  kknyenyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFV  564
            KKNYEN+YPK KKE+PK N++K ES    ++++   G+ Q+ F+KQ QNL+T LL +G  
Sbjct  90   KKNYENFYPKEKKEVPKGNDKKYESKDNSNANTEDSGNFQEAFMKQVQNLVTPLLLMGLF  149

Query  565  LSSMVLSPRTQNEISFQXXK  624
            L+S    PR Q +ISFQ  K
Sbjct  150  LTSFSFGPREQKQISFQEFK  169



>ref|NP_172231.2| FTSH protease 10 [Arabidopsis thaliana]
 sp|Q8VZI8.1|FTSHA_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 10, mitochondrial; 
Short=AtFTSH10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36045.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AAM70517.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AEE28137.1| FTSH protease 10 [Arabidopsis thaliana]
Length=813

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 109/183 (60%), Gaps = 15/183 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQS--TCIARVEGGIGFVR  267
            M+ S++  S+++SS S   +G + GG GVR+ V ++    A Q+    + +V+GG+GF+R
Sbjct  1    MIFSKLGSSLARSSRS---KGFVYGG-GVRSAVFNQGRLRAPQNLEAAVNQVDGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S  A KG+       D+   F NPRLRR F SQ PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASFAARKGL----EAGDLSRAFANPRLRRFFSSQTPKKKNYENYYPKDSKKAPK-NE  111

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QKSES R+ S   +  +  D F  +YQN++  L+ I  +LS+  L  R Q +ISFQ  K 
Sbjct  112  QKSES-RDGSKKNENENAGDAFSNEYQNMLIPLMAIALILSTFSLGSREQQQISFQEFKN  170

Query  628  SCL  636
              L
Sbjct  171  KLL  173



>ref|XP_008222305.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Prunus mume]
Length=814

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 91/137 (66%), Gaps = 5/137 (4%)
 Frame = +1

Query  226  TCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyen  405
            + + RV+G +GF+RSY  S  A     ++A +SD   I  NP+LRR F S+APKKKNYEN
Sbjct  43   SYLGRVDGDLGFLRSYFASSIAA----HKACVSDFSYILGNPKLRRHFSSEAPKKKNYEN  98

Query  406  yypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS  585
            +YPK KKEIPK + QKSES ++DS +  QGS Q+ FL+Q+QNLIT LL IG  LSS    
Sbjct  99   FYPKEKKEIPKGDEQKSES-KDDSKADDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFG  157

Query  586  PRTQNEISFQXXKISCL  636
               Q +ISFQ  K   L
Sbjct  158  SPDQQQISFQEFKNKLL  174



>ref|XP_007207144.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
 gb|EMJ08343.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
Length=814

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 91/137 (66%), Gaps = 5/137 (4%)
 Frame = +1

Query  226  TCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyen  405
            + + RV+G +GF+RSY  S  A     ++A +SD   I  NP+LRR F S+APKKKNYEN
Sbjct  43   SYLGRVDGDLGFLRSYFASSIAA----HKACVSDFSYILGNPKLRRHFSSEAPKKKNYEN  98

Query  406  yypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS  585
            +YPK KKEIPK + QKSES ++DS +  QGS Q+ FL+Q+QNLIT LL IG  LSS    
Sbjct  99   FYPKEKKEIPKGDEQKSES-KDDSKADDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFG  157

Query  586  PRTQNEISFQXXKISCL  636
               Q +ISFQ  K   L
Sbjct  158  SPDQQQISFQEFKNKLL  174



>ref|XP_006306790.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
 gb|EOA39688.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
Length=811

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 110/183 (60%), Gaps = 16/183 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  267
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E  L A     A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGLVYGG-GVRSAILSEGRLRAPPNLEAAANQVNGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S+ A K         D+  +F NPRLRR F SQ+PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASLAARK-----LDTGDLSRVFANPRLRRFFSSQSPKKKNYENYYPKDSKQAPK-NE  110

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKI  627
            QKSES +E S   +  +  D F K++QN++  L+ I  +LS+  L  R Q +ISFQ  K 
Sbjct  111  QKSES-KEGSKKNENENVGDMFTKEFQNMLIPLMAIALILSTFSLGSREQQQISFQEFKN  169

Query  628  SCL  636
              L
Sbjct  170  KLL  172



>gb|KDO72822.1| hypothetical protein CISIN_1g047690mg [Citrus sinensis]
Length=811

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 67/158 (42%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = +1

Query  154  VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVD  333
            V   ++ GG     +V D L         V+G +G +R YL ++GA     N + L D++
Sbjct  26   VRSAIVGGGIPRLPRVTDGL---------VDGRLGVLRGYLAAIGAK----NESNLWDLN  72

Query  334  SIFTNPRLRRLFCSQApkkknyenyyp-knkkeIPKTNNQKSESGREDsssgqqgsPQDN  510
             +  NP + R F S++PK K     +  K KKEIPK + QKSES +EDS++   G+ QD 
Sbjct  73   HVLANPGIYRFFSSESPKNKKNFENFYPKEKKEIPKEDEQKSES-KEDSNTDDHGNFQDT  131

Query  511  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            F+KQ+QNLIT LL I   LSS  LSPR Q +ISFQ  K
Sbjct  132  FMKQFQNLITPLLVIALFLSSFSLSPREQQQISFQEFK  169



>ref|XP_006424865.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
 ref|XP_006488358.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Citrus sinensis]
 gb|ESR38105.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
Length=811

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 67/158 (42%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = +1

Query  154  VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVD  333
            V   ++ GG     +V D L         V+G +G +R YL ++GA     N + L D++
Sbjct  26   VRSAIVGGGIPRLPRVTDGL---------VDGRLGVLRGYLAAIGAK----NESNLWDLN  72

Query  334  SIFTNPRLRRLFCSQApkkknyenyyp-knkkeIPKTNNQKSESGREDsssgqqgsPQDN  510
             +  NP + R F S++PK K     +  K KKEIPK + QKSES +EDS++   G+ QD 
Sbjct  73   HVLANPGIYRFFSSESPKNKKNFENFYPKEKKEIPKEDEQKSES-KEDSNTDDHGNFQDT  131

Query  511  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            F+KQ+QNLIT LL I   LSS  LSPR Q +ISFQ  K
Sbjct  132  FMKQFQNLITPLLVIALFLSSFSLSPREQQQISFQEFK  169



>ref|XP_007133225.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
 gb|ESW05219.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
Length=811

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 107/179 (60%), Gaps = 9/179 (5%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M  S+IARS+S+SS     R L+ G    R   L  +   + C    E  +GFVRSY++S
Sbjct  1    MNFSKIARSLSRSS-----RNLLHGN--GRLGTLTGIPRTNGCSDGAESVLGFVRSYVSS  53

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
              A    I  + L D  S+  NP+LRR F S+APKKKNYE +YPK KKE+PK N++K +S
Sbjct  54   ARASNHSI-FSNLLDFKSVAANPKLRRFFSSEAPKKKNYEKFYPKEKKEVPKENDKKFDS  112

Query  463  -GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
                ++++   GS Q+ F+KQ QN+IT LL +G  L++   SPR Q EISFQ  K   L
Sbjct  113  KDNSNANTDDHGSFQEAFMKQVQNIITPLLVMGLFLTTFSSSPREQQEISFQEFKNKLL  171



>ref|XP_004164623.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
Length=824

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 113/195 (58%), Gaps = 31/195 (16%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTV---------NRGLISGGYGVRTKVLDELAAQSTCIARVEGGI  255
            M+ SRI  ++S+S+ S +         NR ++S    VR   L+     + C++RV G +
Sbjct  1    MIFSRIGAALSRSARSKLQSNGHFGFCNRRILS----VRETCLEANPFSNPCVSRVHGCL  56

Query  256  GFVRSYLTS--VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkke  429
            G  ++Y +S  VGAGK +++R YL +V+    NPR+RRLF S +P KKNYENYYPK++KE
Sbjct  57   GLAKAYSSSTGVGAGKQLVSRKYLDNVNYFLANPRVRRLFSSGSPNKKNYENYYPKDQKE  116

Query  430  IPKTNNQK-----SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS-PR  591
            IPK  +QK     S SG  DS        Q+ F KQ+Q+L+  +LF G +L+S V     
Sbjct  117  IPKAKDQKTNSKDSNSGHTDS--------QEKFTKQFQDLM--ILFFGCILASFVFDGSN  166

Query  592  TQNEISFQXXKISCL  636
             Q +ISFQ  +   L
Sbjct  167  EQKQISFQEFRNELL  181



>ref|XP_004142062.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
 gb|KGN54261.1| hypothetical protein Csa_4G296150 [Cucumis sativus]
Length=824

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 113/195 (58%), Gaps = 31/195 (16%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTV---------NRGLISGGYGVRTKVLDELAAQSTCIARVEGGI  255
            M+ SRI  ++S+S+ S +         NR ++S    VR   L+     + C++RV G +
Sbjct  1    MIFSRIGAALSRSARSKLQSNGHFGFCNRRILS----VRETCLEANPFSNPCVSRVHGCL  56

Query  256  GFVRSYLTS--VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkke  429
            G  ++Y +S  VGAGK +++R YL +V+    NPR+RRLF S +P KKNYENYYPK++KE
Sbjct  57   GLAKAYSSSTGVGAGKQLVSRKYLDNVNYFLANPRVRRLFSSGSPNKKNYENYYPKDQKE  116

Query  430  IPKTNNQK-----SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS-PR  591
            IPK  +QK     S SG  DS        Q+ F KQ+Q+L+  +LF G +L+S V     
Sbjct  117  IPKAKDQKTNSKDSNSGHTDS--------QEKFTKQFQDLM--ILFFGCILASFVFDGSN  166

Query  592  TQNEISFQXXKISCL  636
             Q +ISFQ  +   L
Sbjct  167  EQKQISFQEFRNELL  181



>ref|XP_008799731.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=820

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 104/179 (58%), Gaps = 2/179 (1%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+L+R+ RS+++SS S    G   GGYG R+    E   QS       GG+GF+RSYLTS
Sbjct  1    MILTRLGRSLARSSRSRFETGAFLGGYGARSVFSKEALLQSPVFRGDSGGLGFLRSYLTS  60

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN-NQKSE  459
            +GA K      Y  D   +  NP  RR F +++P KKNYENYYPK+KKE P  N N KSE
Sbjct  61   IGANKAFGANNYQQDWRFLLANPSFRRFFSTESPNKKNYENYYPKSKKETPNGNENNKSE  120

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            S    ++  Q   P+ NF+KQ Q+ +T LLFIG +LSS       Q EISFQ  K   L
Sbjct  121  SKENSNTEDQGYFPE-NFMKQLQSYLTPLLFIGLLLSSFSFGSSDQKEISFQQFKNKLL  178



>ref|XP_008448063.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
 ref|XP_008448071.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
Length=825

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 116/189 (61%), Gaps = 18/189 (10%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYG--------VRTKVLDELAAQSTCIARVEGGIG  258
            M+ SRI  S+S+S+ S +     +G +G        VR   L+     + CI+RV G +G
Sbjct  1    MIFSRIGASLSRSARSKLQS---NGHFGFCNGRILSVRESCLEANPLSNPCISRVHGCLG  57

Query  259  FVRSYLTSVG--AGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeI  432
              ++Y +S G  AGK +++R YL +V+    NPR+RRLF S +PKKKNYENYYPK++KEI
Sbjct  58   LAKAYSSSTGVAAGKQLVSRKYLENVNYFLANPRVRRLFSSGSPKKKNYENYYPKDQKEI  117

Query  433  PKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS-PRTQNEIS  609
            PK  +QK+ S +EDS++G     Q+ F KQ+Q+L+  +LF G +++S +      Q +IS
Sbjct  118  PKAKDQKTNS-KEDSNTGHTDI-QEKFTKQFQDLM--ILFFGCIVASFLFDGSNEQKQIS  173

Query  610  FQXXKISCL  636
            FQ  +   L
Sbjct  174  FQEFRKELL  182



>ref|XP_010542637.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010542639.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
Length=817

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 70/156 (45%), Positives = 95/156 (61%), Gaps = 12/156 (8%)
 Frame = +1

Query  163  GLISGGYGVRTKVLDE-----LAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSD  327
            G + GG GVR+ +L E     L      + RV+GG+GF+R    S+ A KG+I      D
Sbjct  20   GSLYGG-GVRSAILSEGKLQPLPGLEAAVNRVDGGLGFLRQQFASLAARKGLIG----GD  74

Query  328  VDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQD  507
            +  +  NPR+RR F S+APKKKNYENYYPK  K   K N +KSESG EDS   +  +  D
Sbjct  75   LSGVLANPRIRRFFSSEAPKKKNYENYYPKETKRTSK-NEKKSESG-EDSKKSENENFGD  132

Query  508  NFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQ  615
             F K++QN++  LL IG +LSS  L+ + Q +I+FQ
Sbjct  133  MFTKEFQNMLLPLLAIGLILSSFSLTSQEQPQITFQ  168



>ref|XP_006488359.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=810

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 66/158 (42%), Positives = 90/158 (57%), Gaps = 16/158 (10%)
 Frame = +1

Query  154  VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVD  333
            V   ++ GG     +V D L         V+G +G +R YL ++GA     N + L D++
Sbjct  26   VRSAIVGGGIPRLPRVTDGL---------VDGRLGVLRGYLAAIGAK----NESNLWDLN  72

Query  334  SIFTNPRLRRLFCSQApkkknyenyyp-knkkeIPKTNNQKSESGREDsssgqqgsPQDN  510
             +  NP + R F S++PK K     +  K KKEIPK + QKSES  +DS++   G+ QD 
Sbjct  73   HVLANPGIYRFFSSESPKNKKNFENFYPKEKKEIPKEDEQKSES--KDSNTDDHGNFQDT  130

Query  511  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            F+KQ+QNLIT LL I   LSS  LSPR Q +ISFQ  K
Sbjct  131  FMKQFQNLITPLLVIALFLSSFSLSPREQQQISFQEFK  168



>gb|AAK77908.1|AF397903_1 AAA-metalloprotease FtsH [Pisum sativum]
Length=810

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 76/177 (43%), Positives = 105/177 (59%), Gaps = 11/177 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+ SRI R++S+SS     + L+ G    R   L  +         VEGG+GF R Y++S
Sbjct  1    MIFSRIGRALSRSSRV---KNLLHGD--SRLGALSGVPRIDVYSEGVEGGLGFFRGYVSS  55

Query  283  -VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
             V    G ++   LS   S+  NPR  RLF S+APKKKNYEN+YPK +KE+PK  ++K+E
Sbjct  56   SVARNNGFVSN--LSGFKSVAGNPRFLRLFSSEAPKKKNYENFYPKGQKEVPKGGDKKNE  113

Query  460  SGREDsssgqqgsP--QDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            S +EDS S  +     Q+ F+KQ+Q+ +T LL +G  LSS    PR Q +ISFQ  K
Sbjct  114  S-KEDSKSNTEDQGGFQEAFMKQFQSFLTPLLVMGLFLSSFSFGPREQQQISFQEFK  169



>ref|XP_006409951.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
 gb|ESQ51404.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
Length=813

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 74/176 (42%), Positives = 111/176 (63%), Gaps = 12/176 (7%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVR-TKVLDELAAQSTCIARVEGG-IGFVRSYL  276
            M+ S++ RSV +SS S   RGL+ GG GVR  ++L   A ++  + +V+GG +GF+R + 
Sbjct  3    MIFSKLGRSVIQSSRS---RGLLYGG-GVRWARLLASPAIEAASVNQVDGGGLGFLRRHF  58

Query  277  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
             S+  GKG++N    +D+  +F NPR+RR F  +APKKKNYENY+PK+ K+ PK++ QKS
Sbjct  59   ASLTGGKGLVN----NDLTGVFANPRIRRFFSDEAPKKKNYENYFPKDTKQEPKSD-QKS  113

Query  457  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            ES +E S   +  +  D F+ ++QNL+  LL +    SS       Q +ISFQ  K
Sbjct  114  ES-KEGSDKNESENLGDMFMNRFQNLLIPLLALAVFFSSFSFGSGDQQQISFQEFK  168



>ref|XP_008448079.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Cucumis melo]
Length=824

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 111/189 (59%), Gaps = 19/189 (10%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYG--------VRTKVLDELAAQSTCIARVEGGIG  258
            M+ SRI  S+S+S+ S +     +G +G        VR   L+     + CI+RV G +G
Sbjct  1    MIFSRIGASLSRSARSKLQS---NGHFGFCNGRILSVRESCLEANPLSNPCISRVHGCLG  57

Query  259  FVRSYLTSVG--AGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeI  432
              ++Y +S G  AGK +++R YL +V+    NPR+RRLF S +PKKKNYENYYPK++KEI
Sbjct  58   LAKAYSSSTGVAAGKQLVSRKYLENVNYFLANPRVRRLFSSGSPKKKNYENYYPKDQKEI  117

Query  433  PKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS-PRTQNEIS  609
            PK  +QK+ S   ++        Q+ F KQ+Q+L+  +LF G +++S +      Q +IS
Sbjct  118  PKAKDQKTNSKDSNTGHTDI---QEKFTKQFQDLM--ILFFGCIVASFLFDGSNEQKQIS  172

Query  610  FQXXKISCL  636
            FQ  +   L
Sbjct  173  FQEFRKELL  181



>gb|KHN21936.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 78/178 (44%), Positives = 105/178 (59%), Gaps = 12/178 (7%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKV-LDELAAQSTCIARVEGGIGFVRSYLT  279
            M+ SRIARSVS+S  +   R  + G   + T V +    A S    RV   +GF R Y++
Sbjct  1    MIFSRIARSVSRSPRA---RNFLHGDGRLGTHVGVPRTNAYSEGAERV---LGFARGYVS  54

Query  280  SVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
            S  A   G ++   L D  S+  NPR+RRLFCS+APKKKNY+N+YPK KKE+PK N++K 
Sbjct  55   SARALSNGFVSN--LPDFKSVAANPRIRRLFCSEAPKKKNYKNFYPKEKKEVPKGNDKKH  112

Query  457  ESGREDsssgqqgsP-QDNFLKQYQNLITSLLF-IGFVLSSMVLSPRTQNEISFQXXK  624
            ES     ++ +     ++ F+KQ QNLIT LL  +G  L+S     R Q EISFQ  K
Sbjct  113  ESKDNSHANTENSGNFKEAFMKQVQNLITPLLLGMGLFLTSFSFGHREQEEISFQEFK  170



>ref|XP_003537985.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 78/178 (44%), Positives = 105/178 (59%), Gaps = 12/178 (7%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKV-LDELAAQSTCIARVEGGIGFVRSYLT  279
            M+ SRIARSVS+S  +   R  + G   + T V +    A S    RV   +GF R Y++
Sbjct  1    MIFSRIARSVSRSPRA---RNFLHGDGRLGTHVGVPRTNAYSEGAERV---LGFARGYVS  54

Query  280  SVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
            S  A   G ++   L D  S+  NPR+RRLFCS+APKKKNY+N+YPK KKE+PK N++K 
Sbjct  55   SARALSNGFVSN--LPDFKSVAANPRIRRLFCSEAPKKKNYKNFYPKEKKEVPKGNDKKH  112

Query  457  ESGREDsssgqqgsP-QDNFLKQYQNLITSLLF-IGFVLSSMVLSPRTQNEISFQXXK  624
            ES     ++ +     ++ F+KQ QNLIT LL  +G  L+S     R Q EISFQ  K
Sbjct  113  ESKDNSHANTENSGNFKEAFMKQVQNLITPLLLGMGLFLTSFSFGHREQEEISFQEFK  170



>gb|KDP42240.1| hypothetical protein JCGZ_02970 [Jatropha curcas]
Length=803

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 104/175 (59%), Gaps = 14/175 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPS-TVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  279
            M+ S+++R VS+SS S  V RG  SGG    +++    A       R++GG+GFVR YL 
Sbjct  1    MIFSKLSRQVSRSSASINVLRG--SGGRSAISRLTGGGAGGVGFSERIDGGLGFVRGYLA  58

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
            S+GA      ++YLSD + +  NPR+ RLF S+APKKKNYEN+ PK KKE PK N QKSE
Sbjct  59   SIGANS---KKSYLSDWNYLLANPRIGRLFSSKAPKKKNYENFSPKEKKEAPKGNGQKSE  115

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            S  ++ S          F++Q  NL+T+L+ IG +L         + +ISFQ  K
Sbjct  116  SKDDEWSF------DKKFIRQ-SNLLTALVVIGALL-PFAFGSHEEQQISFQEFK  162



>ref|XP_010937593.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 8, mitochondrial-like [Elaeis guineensis]
Length=820

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 95/158 (60%), Gaps = 0/158 (0%)
 Frame = +1

Query  163  GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIF  342
            G IS G+GVR+    E   QS       GG+GF+RSYLTS+GA K +    Y  D   + 
Sbjct  21   GAISCGHGVRSGCSKESLLQSPVFRGDSGGLGFLRSYLTSIGANKALGANNYQRDWRFLL  80

Query  343  TNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQ  522
             NP LRR F +++P KKNYENYYPK+KKE PK N       +E+S++  QG  Q+NF+KQ
Sbjct  81   ANPSLRRFFSTESPNKKNYENYYPKHKKETPKGNENNKSDSKENSNTEDQGYFQENFMKQ  140

Query  523  YQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
              + +T +LFIG +LSS  L    Q EISFQ  K   L
Sbjct  141  LLSYLTPILFIGLLLSSFSLGSSDQKEISFQEFKNKLL  178



>emb|CDY09913.1| BnaC08g45380D [Brassica napus]
Length=767

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 61/174 (35%), Positives = 90/174 (52%), Gaps = 11/174 (6%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+ S++ARS         ++GL+ GG  + ++    + AQS    +V+GG+GF+R    S
Sbjct  1    MVFSKLARSAR-------SKGLVYGGSAILSEG-RRVGAQSGGANQVDGGLGFLRRRFAS  52

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            + A KG ++    +D+  +F NPRLRR F SQAPKKK         K       N+    
Sbjct  53   LAARKGGVDA---NDLTRVFANPRLRRFFSSQAPKKKKKNYENYYPKDAKKGPKNEHKSE  109

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
             RE S   +  +  D   K++QNL+  L+ I  +LSS  L  R Q +ISFQ  K
Sbjct  110  SREGSKKSENENAGDFNTKEFQNLLVPLMAIALILSSFSLGSREQQQISFQEFK  163



>ref|XP_003606687.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES88884.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=807

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 105/180 (58%), Gaps = 9/180 (5%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+ SRI RS+S+SS     + L+ G    R   L  ++  +  +  VE G+GFVR Y++S
Sbjct  1    MIFSRIGRSLSRSSRV---KNLLHGE--TRLGTLYGVSRTNVFVDDVEKGLGFVRGYVSS  55

Query  283  -VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
             +    G  +  Y  D  SI  N  L R+F S++PKKKNYE +YPK KKE+PK   +KSE
Sbjct  56   AIARNNGFGSNLY--DFKSIAANRMLHRMFSSESPKKKNYEKFYPKEKKEVPKGEEKKSE  113

Query  460  SGREDsssgqqgsP-QDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            S  E  S+ + G    + F+KQ+QN +T LL +G  LSS+ L PR Q +ISFQ  K   L
Sbjct  114  SKDESKSNTEDGGSFHEAFIKQFQNYLTPLLVVGLFLSSLSLGPRDQQQISFQEFKNKLL  173



>ref|XP_008366731.1| PREDICTED: uncharacterized protein LOC103430373 [Malus domestica]
Length=220

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 88/177 (50%), Gaps = 16/177 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKV-LDELAAQSTCI--ARVEGGIGFVRSY  273
            M+ S I RS++ S+ S +NR +ISG Y  R  +  D      T +  A V+G +G +R Y
Sbjct  1    MVFSSIRRSITHSARSKLNRNVISGSYNWRNTLRHDSFPPSXTPLGNACVDGCVGILRGY  60

Query  274  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  453
            +   GAGK  +++AY+S++ S+   PR+RRLF SQ              +K + +     
Sbjct  61   IAYNGAGKQXLSKAYMSNLKSVLGIPRIRRLFSSQG-------PGKKTLRKLLSEKQEGN  113

Query  454  SESGREDsssgqqgsPQ------DNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEI  606
            SE GR +    +    +          + Y   I  L+FIGF+++S+ L+P    E+
Sbjct  114  SERGRTEIXVQRGIKCRWSGEYSGTVFEAYSRFIAPLMFIGFIVTSLFLNPHQTKEV  170



>gb|AAF79577.1|AC022464_35 F22G5.10 [Arabidopsis thaliana]
Length=843

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 104/175 (59%), Gaps = 15/175 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQS--TCIARVEGGIGFVR  267
            M+ S++  S+++SS S   +G + GG GVR+ V ++    A Q+    + +V+GG+GF+R
Sbjct  1    MIFSKLGSSLARSSRS---KGFVYGG-GVRSAVFNQGRLRAPQNLEAAVNQVDGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
             +  S  A KG+       D+   F NPRLRR F SQ PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASFAARKGL----EAGDLSRAFANPRLRRFFSSQTPKKKNYENYYPKDSKKAPK-NE  111

Query  448  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEIS  609
            QKSES G + S   +  +  D F  +YQN++  L+ I  +LS+  L  R Q + S
Sbjct  112  QKSESRGDDGSKKNENENAGDAFSNEYQNMLIPLMAIALILSTFSLGSREQQQAS  166



>ref|XP_008356937.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 68/129 (53%), Positives = 87/129 (67%), Gaps = 7/129 (5%)
 Frame = +1

Query  241  VEGGIGFVRSYLT-SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypk  417
            V+G +GF+RSY   S+GA     ++A +SD   I  NP+L R F S+ PKKKNYEN+YPK
Sbjct  48   VDGELGFLRSYFAASIGA-----HKACVSDFSCILANPKLSRHFSSETPKKKNYENFYPK  102

Query  418  nkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQ  597
             KKEIPK + QKSES +++S +  QGS Q+ FL+Q+QNLIT LL IG  LSS       Q
Sbjct  103  EKKEIPKGDEQKSES-KDESKADDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFGTPDQ  161

Query  598  NEISFQXXK  624
             +ISFQ  K
Sbjct  162  QQISFQEFK  170



>gb|AAL36270.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=809

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 68/176 (39%), Positives = 107/176 (61%), Gaps = 16/176 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRT--KVLDELAAQSTCIARVEGGIGFVRSYL  276
            +  S++ RS+S+S      +G + GG GVR+  ++L     ++  +  VEGG+GF+R + 
Sbjct  4    IFFSKLNRSISRS------KGFLYGG-GVRSAARLLTSPGLEAASVNEVEGGLGFIRRHF  56

Query  277  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
             S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+K+E PK+ +QKS
Sbjct  57   ASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDKQE-PKS-DQKS  110

Query  457  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            E  +E S   +  +  D F+ ++QNL+  LL +    S+       Q +ISFQ  K
Sbjct  111  EH-KEGSEKNENENVGDMFMNRFQNLLIPLLALAVFFSTFSFGSGDQQQISFQEFK  165



>gb|AAC33234.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=807

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 68/176 (39%), Positives = 107/176 (61%), Gaps = 16/176 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRT--KVLDELAAQSTCIARVEGGIGFVRSYL  276
            +  S++ RS+S+S      +G + GG GVR+  ++L     ++  +  VEGG+GF+R + 
Sbjct  2    IFFSKLNRSISRS------KGFLYGG-GVRSAARLLTSPGLEAASVNEVEGGLGFIRRHF  54

Query  277  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
             S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+K+E PK+ +QKS
Sbjct  55   ASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDKQE-PKS-DQKS  108

Query  457  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            E  +E S   +  +  D F+ ++QNL+  LL +    S+       Q +ISFQ  K
Sbjct  109  EH-KEGSEKNENENVGDMFMNRFQNLLIPLLALAVFFSTFSFGSGEQQQISFQEFK  163



>ref|NP_850129.1| FTSH protease 3 [Arabidopsis thaliana]
 sp|Q84WU8.1|FTSH3_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=AtFTSH3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22572.1| putative AAA-type ATPase [Arabidopsis thaliana]
 gb|AEC08208.1| FTSH protease 3 [Arabidopsis thaliana]
Length=809

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 68/176 (39%), Positives = 107/176 (61%), Gaps = 16/176 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRT--KVLDELAAQSTCIARVEGGIGFVRSYL  276
            +  S++ RS+S+S      +G + GG GVR+  ++L     ++  +  VEGG+GF+R + 
Sbjct  4    IFFSKLNRSISRS------KGFLYGG-GVRSAARLLTSPGLEAASVNEVEGGLGFIRRHF  56

Query  277  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
             S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+K+E PK+ +QKS
Sbjct  57   ASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDKQE-PKS-DQKS  110

Query  457  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            E  +E S   +  +  D F+ ++QNL+  LL +    S+       Q +ISFQ  K
Sbjct  111  EH-KEGSEKNENENVGDMFMNRFQNLLIPLLALAVFFSTFSFGSGEQQQISFQEFK  165



>ref|XP_009364366.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 66/128 (52%), Positives = 85/128 (66%), Gaps = 5/128 (4%)
 Frame = +1

Query  241  VEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypkn  420
            V+G +GF+RSY  +  A     ++A +SD   I  NP+L R F S+ PKKKNYEN+YPK 
Sbjct  48   VDGELGFLRSYFAASIAA----HKACVSDFSCILANPKLSRHFSSETPKKKNYENFYPKE  103

Query  421  kkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQN  600
            KKEIPK + QKSES +++S +  QGS Q+ FL+Q+QNLIT LL IG  LSS       Q 
Sbjct  104  KKEIPKGDEQKSES-KDESKTDDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFGSPDQQ  162

Query  601  EISFQXXK  624
            +ISFQ  K
Sbjct  163  QISFQEFK  170



>ref|XP_009118433.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Brassica rapa]
 emb|CDY06264.1| BnaA09g49390D [Brassica napus]
Length=800

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 62/177 (35%), Positives = 89/177 (50%), Gaps = 16/177 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQSTCIARVEGGIGFVRSY  273
            MM S++ARS         ++GL+  G   R+ +L E   + A S    +V+GG+GF+R  
Sbjct  1    MMFSKLARSAR-------SKGLVLYG---RSGILSEGRKVGAPSGGANQVDGGLGFLRRR  50

Query  274  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  453
              S+ A KG ++    +D+  +F NP LRR F SQAPKKK         K       N+ 
Sbjct  51   FASLAARKGGVDA---NDLSRVFANPGLRRFFSSQAPKKKKKNYENYYPKDAKKGPKNEH  107

Query  454  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
                RE S   +  +  D   K++QNL+  L+ I  +LSS  L  R Q +ISFQ  K
Sbjct  108  KSESREGSKKSENENAGDFNTKEFQNLLVPLMAIALILSSFSLGSREQQQISFQEFK  164



>ref|XP_009387530.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=818

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 70/170 (41%), Positives = 96/170 (56%), Gaps = 0/170 (0%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+ S+IAR +S+SS      G +  G+GV++    E   Q        GG+  +R YLTS
Sbjct  1    MIFSKIARPISRSSRRRSGHGWLPSGFGVKSGCSREALLQDPICHGDNGGLRSLRGYLTS  60

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            VGA + +  R +L+D      NP  RR F S++P KKNYENYYPK+KKEIPK N      
Sbjct  61   VGAHRTLGERNHLADWRFFLANPSFRRFFSSESPNKKNYENYYPKDKKEIPKANENNESD  120

Query  463  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISF  612
             +EDS++   GS ++N +K  Q  +  LLF+G + SS       Q EISF
Sbjct  121  SKEDSNADDSGSLKENLMKALQGYVAPLLFMGLLFSSSSFGSSDQKEISF  170



>ref|XP_004507174.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=800

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 62/132 (47%), Positives = 83/132 (63%), Gaps = 9/132 (7%)
 Frame = +1

Query  241  VEGGIGFVRSYLTSVGAGKGIINRAYLSD---VDSIFTNPRLRRLFCSQApkkknyenyy  411
            VEGG+GF R YL+S  A    +N  ++S+     S+  NPR  RLF S++PKKKNYE +Y
Sbjct  42   VEGGLGFFRGYLSSATA----LNNGFVSNSPYFKSVVANPRFLRLFSSESPKKKNYEKFY  97

Query  412  pknkkeIPKTNNQKSESGREDsssgqqgsP-QDNFLKQYQNLITSLLFIGFVLSSMVLSP  588
            PK KKE+PK N++K+ES  E  S+       Q+ F+KQ+QN +T LL +G  LSS     
Sbjct  98   PKEKKEVPK-NDKKNESEDESKSNTDDQGGFQEAFMKQFQNFLTPLLVMGLFLSSFSFGS  156

Query  589  RTQNEISFQXXK  624
            R Q +ISFQ  K
Sbjct  157  REQQQISFQEFK  168



>ref|XP_009384843.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=821

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 98/181 (54%), Gaps = 7/181 (4%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNR-GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  279
            M  + + RS+ +S+ S   R  L +G  G R  +  E      CI      +   R YLT
Sbjct  1    MSFANLGRSLLRSARSRSPRVALSNGNNGARPVLSGEALLHKPCIGYE--NVAGTRGYLT  58

Query  280  SVGAGK--GIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  453
            S+GA K  G+ NR  L D   +  NP  RR F S  P KKNYENY+PK+KKEIPK N   
Sbjct  59   SLGANKAVGVGNR--LLDWRFLLANPNFRRFFSSGNPNKKNYENYFPKDKKEIPKGNANN  116

Query  454  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISC  633
                + DSS+   G+ Q+NF+KQ+Q+LIT L+FIG + SS       Q EISFQ  K   
Sbjct  117  KSDPKGDSSTEDHGNFQENFMKQWQSLITPLIFIGLLFSSFSRGSFDQKEISFQEFKNKL  176

Query  634  L  636
            L
Sbjct  177  L  177



>ref|XP_003539663.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Glycine max]
Length=806

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 4/136 (3%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  399
            + C    EG +G VR Y++S  A   G ++   L D  S+  NP +RRLFCS+APKK+NY
Sbjct  36   NACSEGAEGVLGSVRGYVSSARARSNGFVSN--LPDFKSVAANPTIRRLFCSKAPKKENY  93

Query  400  enyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSM  576
             N+YPK KKE+PK N++K ES    ++++   G+ Q+ F+KQ + L+T LL +G  L+S 
Sbjct  94   GNFYPKEKKEVPKGNDKKYESKDNSNANTEDSGNFQEAFMKQVKYLVTPLLLMGLFLTSF  153

Query  577  VLSPRTQNEISFQXXK  624
               P  QN+ISFQ  K
Sbjct  154  SFGPPEQNQISFQEFK  169



>ref|XP_008384940.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
 ref|XP_008366266.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 65/128 (51%), Positives = 85/128 (66%), Gaps = 5/128 (4%)
 Frame = +1

Query  241  VEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypkn  420
            V+G +GF+RSY  +  A     ++A +SD   I  +P+L R F S+ PKKKNYEN+YPK 
Sbjct  48   VDGELGFLRSYFAASIAA----HKACVSDFSGILASPKLCRHFSSENPKKKNYENFYPKE  103

Query  421  kkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQN  600
            KKEIPK + QKSES +++S +  QGS Q+ FL+Q+QNLIT LL IG  LSS       Q 
Sbjct  104  KKEIPKGDEQKSES-KDESKTNDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFGSPDQQ  162

Query  601  EISFQXXK  624
            +ISFQ  K
Sbjct  163  QISFQEFK  170



>ref|XP_007132051.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
 gb|ESW04045.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
Length=809

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 86/139 (62%), Gaps = 2/139 (1%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  402
            + C    E  +GF RSY++S  A    I  + L D  S   NPR+RRLF S+APKKKNYE
Sbjct  34   NACSDGAESVLGFFRSYVSSARASSYRI-FSNLPDFKSAAANPRVRRLFSSEAPKKKNYE  92

Query  403  nyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMV  579
             +YPK KKE PK N++K +S    ++++   G+ Q+ F+KQ QN+IT LL +G  L++  
Sbjct  93   KFYPKEKKETPKENDKKYDSKDNSNANTDGNGNFQEAFMKQVQNIITPLLVLGLFLTTFS  152

Query  580  LSPRTQNEISFQXXKISCL  636
             SPR Q EISFQ  K   L
Sbjct  153  NSPREQQEISFQEFKNKLL  171



>ref|XP_002881027.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57286.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
Length=818

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 69/186 (37%), Positives = 108/186 (58%), Gaps = 25/186 (13%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDEL------AAQSTCIARVEGGIGFV  264
            +  S+++RS+S+S      RG + GG GVR+ VL+E         ++  + +VEGG+GF+
Sbjct  2    IFFSKLSRSISRS------RGFLYGG-GVRSAVLNEARLLTSPGLEAASVNQVEGGLGFI  54

Query  265  RSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN  444
            R +  S+ + KG++N     D+  +F NP++RR F  +APKKKNYENY+PK+ K+ PK+ 
Sbjct  55   RRHFASLASRKGLVN----YDLIGVFANPKIRRFFSDEAPKKKNYENYFPKDTKQEPKS-  109

Query  445  NQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNE------I  606
            +QKSE  +E S   +  +  D F+ ++QNL+  LL +    SS       Q +      I
Sbjct  110  DQKSEH-KEGSEKNENENVGDMFMNRFQNLLIPLLALAVFFSSFSFGSGDQQQANVVLLI  168

Query  607  SFQXXK  624
            SFQ  K
Sbjct  169  SFQEFK  174



>ref|XP_009375915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 64/128 (50%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = +1

Query  241  VEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypkn  420
            V+G +GF+RSY  +  A     ++A +SD   I  +P+L R F S+ PKKKNYEN+YPK 
Sbjct  48   VDGELGFLRSYFAASIAA----HKACVSDFSGILASPKLCRHFSSETPKKKNYENFYPKE  103

Query  421  kkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQN  600
            KKEIPK + QKSES +++S +  QGS Q+ FL+Q+QNL T LL IG  LSS       Q 
Sbjct  104  KKEIPKGDEQKSES-KDESKTNDQGSFQETFLRQFQNLFTPLLVIGLFLSSFSFGSPDQQ  162

Query  601  EISFQXXK  624
            +ISFQ  K
Sbjct  163  QISFQEFK  170



>gb|KDP35648.1| hypothetical protein JCGZ_09086 [Jatropha curcas]
Length=828

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 92/156 (59%), Gaps = 3/156 (2%)
 Frame = +1

Query  178  GYGVRTKVLDELAAQSTCIARVEGGIGFVRS--YLTSVGAGKGIINRAYLSDVDSIFTNP  351
            G  V+  +L     ++ CI+RV+GG+G      YLT VG G+ ++++  LS+ +S+  +P
Sbjct  31   GVTVKESILPSALLENACISRVDGGLGLGIIRGYLTFVGGGRQLLSKTNLSNSNSLLASP  90

Query  352  RLRRLFCSQApkkknyenyypknkkeIPKTNN-QKSESGREDsssgqqgsPQDNFLKQYQ  528
            R+R  F ++APK + YENYYPK+KKEIPK N  +  E    DS          NF+KQ+Q
Sbjct  91   RVRLFFSTEAPKNRKYENYYPKDKKEIPKGNESENKEGSGGDSGGSSGAGNSQNFMKQFQ  150

Query  529  NLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            N +  +LF  F+ SS+   P+ Q +ISFQ  K   L
Sbjct  151  NFLAPILFTIFLYSSVFFGPQEQKQISFQEFKTKLL  186



>ref|XP_006845226.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
 gb|ERN06901.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
Length=825

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 90/140 (64%), Gaps = 13/140 (9%)
 Frame = +1

Query  250  GIGFVRSYLTSVGA-------GKGIINRAY---LSDVDSIFTNPRLRRLFCSQApkkkny  399
            G+G++  YL+ + A       GK  I+  +   LS +  +  NP  RRLFCS+APKKKNY
Sbjct  46   GLGYMSRYLSYLAASGDFPTHGKAAIDFMHGRCLSQL--LLLNPGSRRLFCSEAPKKKNY  103

Query  400  enyypknkkeIPK-TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSM  576
            EN+YPK KKEIPK +N+Q+    ++DS++  QGS Q++F+KQ Q+ +T LL I FVLSS 
Sbjct  104  ENFYPKEKKEIPKGSNDQRKSDSKDDSNADDQGSFQESFMKQLQSYLTPLLLIAFVLSSF  163

Query  577  VLSPRTQNEISFQXXKISCL  636
               PR Q +ISFQ  K   L
Sbjct  164  SFGPRDQKQISFQEFKNKLL  183



>ref|XP_009384842.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=833

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 87/160 (54%), Gaps = 6/160 (4%)
 Frame = +1

Query  163  GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGK--GIINRAYLSDVDS  336
             L +G  G R  +  E      CI      +   R YLTS+GA K  G+ NR  L D   
Sbjct  34   ALSNGNNGARPVLSGEALLHKPCIGYE--NVAGTRGYLTSLGANKAVGVGNR--LLDWRF  89

Query  337  IFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFL  516
            +  NP  RR F S  P KKNYENY+PK+KKEIPK N       + DSS+   G+ Q+NF+
Sbjct  90   LLANPNFRRFFSSGNPNKKNYENYFPKDKKEIPKGNANNKSDPKGDSSTEDHGNFQENFM  149

Query  517  KQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
            KQ+Q+LIT L+FIG + SS       Q EISFQ  K   L
Sbjct  150  KQWQSLITPLIFIGLLFSSFSRGSFDQKEISFQEFKNKLL  189



>ref|XP_004294648.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=810

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 8/132 (6%)
 Frame = +1

Query  232  IARVEGGIGFVRSYLTS-VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyeny  408
            + RV+G +GF+RSY+ S +GA     ++ ++SDV  I  NP+  RLF S+APKKKN+EN+
Sbjct  43   LGRVDGDLGFMRSYIASAIGA-----HKTHVSDVSYILGNPKFLRLFSSEAPKKKNFENF  97

Query  409  ypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSP  588
            YPK KKEIPK ++QKSES ++ SS+  QGS Q+ F+KQ+QNL+  L+ IG   SS   S 
Sbjct  98   YPKEKKEIPKGDDQKSES-KDGSSTDDQGSFQEAFIKQFQNLV-PLVLIGLFFSSFSFSS  155

Query  589  RTQNEISFQXXK  624
              Q +ISFQ  K
Sbjct  156  SDQKQISFQEFK  167



>ref|XP_006417796.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
 gb|ESQ36149.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
Length=815

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 63/180 (35%), Positives = 92/180 (51%), Gaps = 15/180 (8%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLD-----ELAAQSTCIARVEGGIGFVR  267
            M+ S++  SV++S  S   +GL+ G  GVR+ +L+        A      + +GG+GF+R
Sbjct  1    MIFSKLGSSVARSYRS---KGLVYG-VGVRSAILNGGRLHAPPALEAAANQADGGLGFLR  56

Query  268  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  447
                S+ A KG+      +D+   F NPRLRR F S  PKKK     Y     +    N 
Sbjct  57   RRFASLAARKGLDT----NDLSRAFANPRLRRFFSSGNPKKKKNYENYYPKDAKKAPKNE  112

Query  448  QKSESGREDsssgqqgsPQDNFLKQYQ-NLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            Q+SES RE S   +  +  D   K++Q N++  L+ I  +LSS  L  R Q +ISFQ  K
Sbjct  113  QRSES-REGSKKIENENVGDINTKEFQINMLVPLMAIALILSSFSLGSREQQQISFQEFK  171



>ref|XP_009140963.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brassica rapa]
Length=803

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 74/175 (42%), Positives = 101/175 (58%), Gaps = 14/175 (8%)
 Frame = +1

Query  103  MMLSRIARS-VSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  279
            M+ S++ RS VS+S      R  + GG GVR+  L  LA  +     VEGG+GF+R +  
Sbjct  4    MIFSKLGRSSVSRS------RCFLYGG-GVRSARL--LAPPAIEANEVEGGLGFLRRHFN  54

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
            S+ A KG++N    SD+   F NP LRR F  +APKKKNYENY+PK  KE PK+++ KS+
Sbjct  55   SLSARKGLVNN---SDLIGAFANPILRRFFSDEAPKKKNYENYFPKATKEKPKSDH-KSD  110

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            S    S   +Q S  D F+ ++QNL+  LL +    SS       Q +ISFQ  K
Sbjct  111  SKEGSSDKNEQESVGDMFMNRFQNLLIPLLALAVFFSSFSFGSGDQQQISFQEFK  165



>gb|EYU38460.1| hypothetical protein MIMGU_mgv1a001496mg [Erythranthe guttata]
Length=808

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 58/132 (44%), Positives = 83/132 (63%), Gaps = 5/132 (4%)
 Frame = +1

Query  232  IARVEGGIGFVRSYLTSVGAGKGI-INRAYLSDVDSIFTNPRLRRLFCSQApkkknyeny  408
            I + +G I F+R Y+ +VGA KG  + R   SD  +    PR+ R F S+APKKKNYEN+
Sbjct  48   INQFDGKIQFLRGYIATVGASKGSPLPRNSFSDFTAY---PRISRFFSSEAPKKKNYENF  104

Query  409  ypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSP  588
             PK  K +P+ N QK+ S +E+ ++  QG  +D F K  QN++TSLL IG  +S++  +P
Sbjct  105  SPKENKGVPEQNEQKTGS-KEEGNTDGQGYFRDLFSKNLQNIVTSLLVIGLFISALSSTP  163

Query  589  RTQNEISFQXXK  624
            R   +ISFQ  K
Sbjct  164  REGEQISFQEFK  175



>ref|XP_010042847.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
Length=130

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = +1

Query  184  GVRTKVLDELAAQST----CIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNP  351
            GVR+  L+  ++ +      +  ++G +GFVR YL S GA KG   ++YLSD++ +  NP
Sbjct  24   GVRSGPLNGASSGTPRLDGALGGLDGKLGFVREYLASAGAIKGFSAKSYLSDLNRVLANP  83

Query  352  RLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  462
            R+ R F S+APKKKNYENY PK +KE+PK N QKSES
Sbjct  84   RVHRFFSSEAPKKKNYENYCPKGRKEVPKGNEQKSES  120



>ref|XP_006592193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X1 [Glycine max]
Length=319

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 67/135 (50%), Gaps = 26/135 (19%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  399
            + C    +G +GFVR Y++S  A   G ++   L D  S+  NP +RRLFCS+A      
Sbjct  98   NACSEGAQGVLGFVRGYVSSARALSNGFVSN--LPDFKSVAANPTIRRLFCSKA------  149

Query  400  enyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMV  579
                       PK  N  S +  EDS +      Q+ F+KQ + L+T LL +G  L+S  
Sbjct  150  -----------PKKEN-NSNANTEDSGNF-----QEAFMKQVKYLVTPLLLMGLFLTSFS  192

Query  580  LSPRTQNEISFQXXK  624
              P  QN+ISFQ  K
Sbjct  193  FGPPEQNQISFQEFK  207



>ref|XP_010469994.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010469995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=812

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 74/181 (41%), Positives = 111/181 (61%), Gaps = 20/181 (11%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQS----TCIARVEGG-IGF  261
            +  S++ RS+S+S      RG ++GG GVR+ VL+E  L A S      + +VEGG +GF
Sbjct  2    IFFSKLGRSISRS------RGFLNGG-GVRSAVLNEARLLAPSGLDAASVNQVEGGGLGF  54

Query  262  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  441
            +R +  S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+ K+ PK+
Sbjct  55   LRRHFASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDAKQEPKS  110

Query  442  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXX  621
            + QKS+  +E S   +  +  D F+ ++QNL+  LL +G   SS       Q +ISFQ  
Sbjct  111  D-QKSDH-KEGSEKNESENVGDMFMNRFQNLLIPLLALGLFFSSFSFGSGDQQQISFQEF  168

Query  622  K  624
            K
Sbjct  169  K  169



>ref|XP_008350440.1| PREDICTED: uncharacterized protein LOC103413780 [Malus domestica]
Length=253

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKV-LDELAAQSTCI--ARVEGGIGFVRSY  273
            M+ S I RS++ S+ S +NR +ISG Y  R  +  D      T +  A V+G +G +R Y
Sbjct  1    MVFSSIRRSITHSARSKLNRNVISGSYNWRNTLRHDSFPPSXTPLGNACVDGCVGILRGY  60

Query  274  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQA  381
            +   GAGK  +++AY+S++ S+   PR+RRLF SQ 
Sbjct  61   IAYNGAGKQXLSKAYMSNLKSVLGIPRIRRLFSSQG  96



>ref|XP_010414442.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Camelina sativa]
Length=812

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 74/181 (41%), Positives = 111/181 (61%), Gaps = 20/181 (11%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQS----TCIARVEGG-IGF  261
            +  S++ RS+S+S      RG ++GG GVR+ VL+E  L A S      + +VEGG +GF
Sbjct  2    IFFSKLGRSISRS------RGFLNGG-GVRSAVLNEARLLAPSGLDAASVNQVEGGGLGF  54

Query  262  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  441
            +R +  S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+ K+ PK+
Sbjct  55   LRRHFASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDAKQEPKS  110

Query  442  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXX  621
            + QKS+  +E S   +  +  D F+ ++QNL+  LL +G   SS       Q +ISFQ  
Sbjct  111  D-QKSDH-KEGSEKNESENVGDMFMNRFQNLLIPLLALGLFFSSFSFGSGDQQQISFQEF  168

Query  622  K  624
            K
Sbjct  169  K  169



>ref|XP_006592191.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Glycine max]
Length=782

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 26/135 (19%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  399
            + C    EG +G VR Y++S  A   G ++   L D  S+  NP +RRLFCS+A      
Sbjct  36   NACSEGAEGVLGSVRGYVSSARARSNGFVSN--LPDFKSVAANPTIRRLFCSKA------  87

Query  400  enyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMV  579
                       PK  N  S +  EDS +      Q+ F+KQ + L+T LL +G  L+S  
Sbjct  88   -----------PKKENN-SNANTEDSGNF-----QEAFMKQVKYLVTPLLLMGLFLTSFS  130

Query  580  LSPRTQNEISFQXXK  624
              P  QN+ISFQ  K
Sbjct  131  FGPPEQNQISFQEFK  145



>gb|KFK40664.1| hypothetical protein AALP_AA2G026000 [Arabis alpina]
Length=187

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 13/93 (14%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+ S++ RS+S+S      RGL+ GG GVR+  L  LA  +  ++ VE G+GF+R +  S
Sbjct  1    MIFSKLGRSISRS------RGLLYGG-GVRSARL--LAPPAFEVSEVESGLGFLRRHFAS  51

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQA  381
            + A KG++N    +D+  +F NPR+ R F  +A
Sbjct  52   LSARKGLVN----NDLTGVFANPRILRFFSDEA  80



>emb|CDX77230.1| BnaC04g40250D [Brassica napus]
Length=789

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 64/144 (44%), Positives = 87/144 (60%), Gaps = 14/144 (10%)
 Frame = +1

Query  103  MMLSRIARS-VSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  279
            M+ S++ RS VS+S      RG + GG GVR+  L  LA+ +     VEGG+GF+R +  
Sbjct  4    MIFSKLGRSSVSRS------RGFLYGG-GVRSARL--LASPAFEANEVEGGLGFLRRHFN  54

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
            S+ A KG++N    SD+   F NP LRR F  +APKKKNYE Y+PK  KE PK N+ KS+
Sbjct  55   SLSARKGLVNN---SDLVGAFANPILRRFFSDEAPKKKNYETYFPKATKEKPK-NDHKSD  110

Query  460  SGREDsssgqqgsPQDNFLKQYQN  531
            S    S   +Q S  D F+ ++QN
Sbjct  111  SKEGSSDKNEQESVGDMFMNRFQN  134



>gb|EPS71434.1| hypothetical protein M569_03325, partial [Genlisea aurea]
Length=778

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 54/136 (40%), Positives = 82/136 (60%), Gaps = 10/136 (7%)
 Frame = +1

Query  232  IARVEGGIG-FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLR-RLFCSQApkkknyen  405
            I  ++G  G  +RSY +++GA KG ++R+Y SD      N RL  R FC++APKKKNYE+
Sbjct  26   INLIDGRAGVLLRSYFSTLGAYKGSVSRSYASDFRHFGRNFRLNNRSFCAEAPKKKNYES  85

Query  406  yypknkkeIPKTNNQ---KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSM  576
            +YPK KKE PK   +   K E  +ED ++      Q+ F++ +QN+IT L+ +G  +S+ 
Sbjct  86   FYPKPKKETPKQEQKSGFKEEGSKEDQANF-----QETFIRNFQNVITPLIVLGLFISAF  140

Query  577  VLSPRTQNEISFQXXK  624
                  + +ISFQ  K
Sbjct  141  TPKANDEKQISFQEFK  156



>ref|XP_010510537.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Camelina sativa]
Length=809

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 67/176 (38%), Positives = 107/176 (61%), Gaps = 15/176 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRT-KVLDELAAQSTCIARVEG-GIGFVRSYL  276
            +  S++ RS+S+S      RG ++G  GVR+ ++L     ++  + +VEG G+GF+R + 
Sbjct  4    IFFSKLGRSISRS------RGFLNGS-GVRSARLLAPSGLEAASVNQVEGEGLGFLRRHF  56

Query  277  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
             S+ + KG++N    +D+  +  NPRLRR F  +APKKKNYENY+PK+ K+ PK++ QKS
Sbjct  57   ASLASRKGLVN----NDLIGVLANPRLRRFFSDEAPKKKNYENYFPKDPKQEPKSD-QKS  111

Query  457  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            +  +E S   +  +  D F+ ++QNL+  LL +G   SS       Q +ISFQ  K
Sbjct  112  DH-KEGSEKNESENVGDMFMNRFQNLLIPLLALGLFFSSFSFGSGDQQQISFQEFK  166



>gb|KHN32138.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=771

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 43/135 (32%), Positives = 64/135 (47%), Gaps = 33/135 (24%)
 Frame = +1

Query  223  STCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  399
            + C    +G +GFVR Y++S  A   G ++   L D  S+  NP +RRLFCS+A      
Sbjct  36   NACSEGAQGVLGFVRGYVSSARALSNGFVSN--LPDFKSVAANPTIRRLFCSKA------  87

Query  400  enyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMV  579
                       PK   ++ +SG            Q+ F+KQ + L+T LL +G  L+S  
Sbjct  88   -----------PK---KEKDSGNF----------QEAFMKQVKYLVTPLLLMGLFLTSFK  123

Query  580  LSPRTQNEISFQXXK  624
              P  Q +ISF+  K
Sbjct  124  FGPPKQKQISFREFK  138



>ref|XP_009125053.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Brassica rapa]
Length=814

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 66/176 (38%), Positives = 97/176 (55%), Gaps = 13/176 (7%)
 Frame = +1

Query  100  TMMLSRIARSVSKSSPSTVNRGLISGGYGVRT-KVLDELAAQSTCIARVEGGIGFVRSYL  276
            TM  S++ RS       +V+R     G GVR+ +++   A ++       GG+GF+  + 
Sbjct  2    TMFFSKLGRS-------SVSRSRFLHGGGVRSARLIGPPAVEAAASVNQGGGLGFLSRHF  54

Query  277  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
             S+   KG+++   +  V   F NPRLRR F  +APKKKNYENY+PK  K+ PK++ QKS
Sbjct  55   ASLTGRKGLVDNDLIGGV---FANPRLRRFFSDEAPKKKNYENYFPKTPKQEPKSD-QKS  110

Query  457  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
            ES +E S   +  +  D F  ++QNL+  LL +   LSS       Q +ISFQ  K
Sbjct  111  ES-KEGSDKNENENLGDMFANRFQNLLIPLLALAIFLSSFSFGSGDQQQISFQEFK  165



>emb|CDY31753.1| BnaA04g16890D [Brassica napus]
Length=788

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 63/144 (44%), Positives = 87/144 (60%), Gaps = 14/144 (10%)
 Frame = +1

Query  103  MMLSRIARS-VSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  279
            M+ S++ RS VS+S      R  + GG GVR+  L  LA  +     VEGG+GF+R +  
Sbjct  4    MIFSKLGRSSVSRS------RCFLYGG-GVRSARL--LAPPAIEANEVEGGLGFLRRHFN  54

Query  280  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
            S+ A KG++N    SD+   F NP LRR F  +APKKKNYENY+PK  KE PK+++ KS+
Sbjct  55   SLSARKGLVNN---SDLIGAFANPILRRFFSDEAPKKKNYENYFPKATKEKPKSDH-KSD  110

Query  460  SGREDsssgqqgsPQDNFLKQYQN  531
            S    S   +Q S  D F+ ++QN
Sbjct  111  SKEGSSDKNEQESVGDMFMNRFQN  134



>gb|KJB36698.1| hypothetical protein B456_006G171800 [Gossypium raimondii]
Length=617

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 9/95 (9%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDEL----AAQSTCIARVEGGIGFVRS  270
            M++SRI RS+S SS       +IS     R  +L+E        + CI+ V  G+G +R 
Sbjct  1    MIVSRIGRSLSCSSSFNFKNNVIS-----RNLLLNETHIPRPVGNACISHVSQGLGLLRG  55

Query  271  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCS  375
            Y     AGK ++  A LS +DSI  NPR+RRLF S
Sbjct  56   YFALAEAGKKLVLNARLSILDSILGNPRIRRLFSS  90



>ref|XP_002313426.1| FtsH protease family protein [Populus trichocarpa]
 gb|EEE87381.1| FtsH protease family protein [Populus trichocarpa]
Length=786

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 7/128 (5%)
 Frame = +1

Query  250  GIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkke  429
            G+G +R YLTS+G+ +G  N  +LSD++SI  NPR+RR F ++APKKKNYEN+YPK KKE
Sbjct  20   GLGLLRGYLTSIGS-RGTHN-PFLSDLNSILANPRIRRFFSTEAPKKKNYENFYPKGKKE  77

Query  430  IPKTNNQKSESGREDsssgqqgsPQDN---FLKQYQNLITSLLFIGFVLSSMVLSPRTQN  600
            +PK   QKSES +E+SS+        N   F+K +  L+  L  +  +          + 
Sbjct  78   VPKGEKQKSES-KENSSNADHDESDFNKGTFMKAFY-LLAPLFVVQLLFYPFSFGDGDKQ  135

Query  601  EISFQXXK  624
            +ISFQ  K
Sbjct  136  QISFQEFK  143



>ref|XP_010688798.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010688799.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit-like 
[Beta vulgaris subsp. vulgaris]
Length=247

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 4/92 (4%)
 Frame = +1

Query  106  MLSRIARSVSKSSPSTV-NRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M+SRI R++S+S+ S++ N  +   GYG+RT  +   +A  T  +R E G+GFV SY +S
Sbjct  3    MISRIGRNISRSARSSLLNATIGCDGYGIRTAAIANQSAGFT--SRSEQGLGFVNSYFSS  60

Query  283  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQ  378
            +GAGK   N ++ S     F NP   R F + 
Sbjct  61   IGAGKQ-ANPSFSSVFRPNFANPSFARFFSTD  91



>ref|XP_002439915.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
 gb|EES18345.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
Length=815

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 82/179 (46%), Gaps = 6/179 (3%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  282
            M L+ +AR++ +S+ S+  R     G G+R               R  G  GFVRSYLT+
Sbjct  1    MTLASLARALGRSARSSRPRQGFQLG-GLRQSPA--PPLPPPVHGRESGATGFVRSYLTA  57

Query  283  VG-AGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  459
               A  G        D   I  +P+ RRLF  ++ K         K +   PK +     
Sbjct  58   ASSAALGKPAAGKTVDWRYILASPQFRRLFSDESKKNYENYYPKGKKEA--PKGDGSNKS  115

Query  460  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXKISCL  636
              +++S++ +  + QDN +K  QN +  LL +G +LSSM  S   Q EISFQ  K   L
Sbjct  116  ESKQESNTDEGWNFQDNAMKHLQNFLAPLLILGLMLSSMSSSTADQKEISFQEFKNKLL  174



>gb|AFW82207.1| hypothetical protein ZEAMMB73_958383 [Zea mays]
Length=815

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 55/176 (31%), Positives = 83/176 (47%), Gaps = 8/176 (5%)
 Frame = +1

Query  103  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGI-GFVRSYLT  279
            M L+ +AR++ +S+ S+  R     G G+R             +   EGG  GFVRSYLT
Sbjct  1    MTLASLARALGRSARSSRPRQGFQLG-GLRQP---PAPPLPPPVHGGEGGAAGFVRSYLT  56

Query  280  SVG-AGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  456
            +   A  G  +     D   +  +P  RRLF   + K         K +  +PK +    
Sbjct  57   AASSAALGKPSAGKTVDWRYVLASPHFRRLFSDGSKKNYENYYPKGKKE--VPKGDGTNK  114

Query  457  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQXXK  624
               +++S++ +  + QDN +K  QN +  LL +G +LSSM  S   Q EISFQ  K
Sbjct  115  SESKQESNTDEGWNFQDNAMKHMQNFLAPLLILGLMLSSMSSSSADQKEISFQEFK  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125